DOCSLIB.ORG

Fig.S1. the Pairwise Aligments of High Scoring Pairs of Recognizable Pseudogenes

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Fig.S1. the Pairwise Aligments of High Scoring Pairs of Recognizable Pseudogenes LysR transcriptional regulator Identities = 57/164 (35%), Positives = 82/164 (50%), Gaps = 13/164 (8%) 70530- SNQAIKTYLMPK*LRLLRQK*SPVEFQLQVHLIKKIRLNIVIRDINLTIIEN-TPVKLKI -70354 ++Q TYLMP+ + L RQK V QLQVH ++I ++ INL II P++LK 86251- ASQTTGTYLMPRLIGLFRQKYPQVAVQLQVHSTRRIAWSVANGHINLAIIGGEVPIELKN -86072 70353- FYTLLRMKERI*H*YCLGFL------FQFLIAYKKKNLYGLRLIKVDIPFPIRGIMNNP* -70192 + E L + F L + +K++LY LR I +D IR +++ 86071- MLQVTSYAED-----ELALILPKSHPFSMLRSIQKEDLYRLRFIALDRQSTIRKVIDKVL -85907 70191- IKTELIPRNLN-EMELSLFKPIKNAV*PGLNVTLIFVSAIAKEL -70063 + + EMEL+ + IKNAV GL + VSAIAKEL 85906- NQNGIDSTRFKIEMELNSVEAIKNAVQSGLGAAFVSVSAIAKEL -85775 ycf3 Photosystem I assembly protein Identities = 25/59 (42%), Positives = 39/59 (66%), Gaps = 3/59 (5%) 19162- NRSYML-SIQCM-PNNSDYVNTLKHCR*ALDLSSKL-LAIRNVTISYYCQDIIFSEKKD -19329 +RSY+L +I + +N +YV L++ ALDL+S+L AI N+ + Y+ Q + SEKKD 19583- DRSYILYNIGLIYASNGEYVKALEYYHQALDLNSRLPPAINNIAVIYHYQGVKASEKKD -19759 Fig.S1. The pairwise aligments of high scoring pairs of recognizable pseudogenes. The upper amino acid sequences indicates Cryptomonas sp. SAG977-2f. The lower sequences are corresponding amino acid sequences of homologs in C. curvata CCAP979/52. Table S1. Presence/absence of protein genes in the plastid genomes of Cryptomonas and representative species of Cryptomonadales. Note; y indicates pseudogenes. Photosynthetic Non-Photosynthetic Guillardia Rhodomonas Cryptomonas C. C. curvata C. curvata parameciu Guillardia Rhodomonas FBCC300 CCAP979/ SAG977 CCAC1634 m theta salina -2f B 012D 52 CCAP977/2 a rps2 + + + + + + + rps3 + + + + + + + rps4 + + + + + + + rps5 + + + + + + + rps6 + + + + + + - rps7 + + + + + + + rps8 + + + + + + + rps9 + + + + + + + rps10 + + + + + + + rps11 + + + + + + + rps12 + + + + + + + rps13 + + + + + + + rps14 + + + + + + + rps16 + + + + + + + rps17 + + + + + + + rps18 + + + + + + + rps19 + + + + + + + rps20 + + + + + + + rpl1 + + + + + + + rpl2 + + + + + + + rpl3 + + + + + + + rpl4 + + + + + + + rpl5 + + + + + + + rpl6 + + + + + + + rpl11 + + + + + + + rpl12 + + + + + + + rpl13 + + + + + + + rpl14 + + + + + + + rpl16 + + + + + + + rpl18 + + + + + + + rpl19 + + + + + + + rpl20 + + + + + + + rpl21 + + + + + + + rpl22 + + + + + + + rpl23 + + + + + + + rpl24 + + + + + + + rpl27 + + + + + + + rpl29 + + + + + + + rpl31 + + + + + + + rpl32 + + + + + + - rpl33 + + + + + + + rpl34 + + + + + - + rpl35 + + + + + + + rpl36 + + + + + + + infB + + + + + + + tufA + + + + + + + tsf + + + + + + + rpoA + + + + + + + rpoB + + + + + + + rpoC1 + + + + + + + rpoC2 + + + + + + + atpA + + + + + + + atpB + + + + + + + atpD + + + + + + + atpE + + + + + + + atpF + + + + + + y atpG + + + + + + + atpH + + + + + + + atpI + + + + + + + sufB + + + + + + + sufC + + + + + + + petF + + + + + + + tatC + + + + + + + secA + + + + + + + secG + + + + + - - secY + + + + + + + clpC + + + + + + + dnaK + + + + + + + groEL + + + + + + + ftsH + + + + + + - dnaX - + y - - - - dnaB + + y - - - - rbcL + + + + y - + rbcR(lysR) + + + + y - - rbcS + + + + - - + cbbX + + + + y - + chlB - y + + + + - chlI + + + + + + + chlL - y + + + + - chlN - y + + + + - pbsA + + + + + - + hlpA + + + + - - - hlip + + + + - - - ccsA + + + + - - - cemA + + + + + + + rne + + + + + - - ftrB + + + + y - - cpeB + + + + + - - ccs1 + + + + - - - ilvB + + + + + + + ilvH + + + + + + + acpP + + + + + + + minD + + + + + + - minE + + + + + + - RT - + + + - - - psaA + + + + - - - psaB + + + + - - - psaC + + + + - - - psaD + + + + - - - psaE + + + + - - - psaF + + + + y - - psaI + + + + - - - psaJ + + + + - - - psaK + + + + - - - psaL + + + + - - - psaM + + + + - - - psbA + + + + - - - psbB + + + + y - - psbC + + + + - - - psbD + + + + - - - psbE + + + + - - - psbF + + + + - - - psbH + + + + - - - psbI + + + + - - - psbJ + + + + - - - psbK + + + + - - - psbL + + + + - - - psbN + + + + - - - psbT + + + + - - - psbV + + + + y - - psbW + + + + - - - psbX + + + + - - - psbY + + + + - - - psbZ + + + + - - - petA + + + + - - - petB + + + + - - - petD + + + + - - - petG + + + + - - - petL + + + + - - - petM + + + + - - - petN + + + + - - - ycf3 + + + + y - - ycf4 + + + + - - - ycf12 + + + + - - - ycf19 + + + + + + + ycf20 + - - + + - + ycf26 - + - - - - - ycf27(omp + + + + y - - R) ycf29/tctD + + + + + + + ycf33 + + + + - - - ycf35 + + + + - - - ycf36 + + + + - - - ycf37 + + + + - - - ycf39 + + + + y - - ycf46 + + + + - - - ycf61 + + + + + + + ycf65 + + + + + + - Table S2 Synonymous (dS) and nonsynonymous (dN) substitution rates between Cryptomonas curvata CCAC979/52 and FBCC300012D plastid genome genes. dS dN dNdS 146 genes (Average) 7.4467 0.0716 0.0096 Concatenate 2.6798 0.0609 0.0227 Table S3 Averages of synonymous (dS) and nonsynonymous (dN) substitution rates of available rbcL gene sequences of Cryptomonadales genera. dS dN dNdS Cryptomonas (n=12) 1.5286 0.0134 0.0116 Rhodomonas (n=6) 0.3006 0.0052 0.0142 Hemiselmis (n=6) 0.1724 0.0095 0.0587 .
Load more

Recommended publications
  • University of Oklahoma
    UNIVERSITY OF OKLAHOMA GRADUATE COLLEGE MACRONUTRIENTS SHAPE MICROBIAL COMMUNITIES, GENE EXPRESSION AND PROTEIN EVOLUTION A DISSERTATION SUBMITTED TO THE GRADUATE FACULTY in partial fulfillment of the requirements for the Degree of DOCTOR OF PHILOSOPHY By JOSHUA THOMAS COOPER Norman, Oklahoma 2017 MACRONUTRIENTS SHAPE MICROBIAL COMMUNITIES, GENE EXPRESSION AND PROTEIN EVOLUTION A DISSERTATION APPROVED FOR THE DEPARTMENT OF MICROBIOLOGY AND PLANT BIOLOGY BY ______________________________ Dr. Boris Wawrik, Chair ______________________________ Dr. J. Phil Gibson ______________________________ Dr. Anne K. Dunn ______________________________ Dr. John Paul Masly ______________________________ Dr. K. David Hambright ii © Copyright by JOSHUA THOMAS COOPER 2017 All Rights Reserved. iii Acknowledgments I would like to thank my two advisors Dr. Boris Wawrik and Dr. J. Phil Gibson for helping me become a better scientist and better educator. I would also like to thank my committee members Dr. Anne K. Dunn, Dr. K. David Hambright, and Dr. J.P. Masly for providing valuable inputs that lead me to carefully consider my research questions. I would also like to thank Dr. J.P. Masly for the opportunity to coauthor a book chapter on the speciation of diatoms. It is still such a privilege that you believed in me and my crazy diatom ideas to form a concise chapter in addition to learn your style of writing has been a benefit to my professional development. I’m also thankful for my first undergraduate research mentor, Dr. Miriam Steinitz-Kannan, now retired from Northern Kentucky University, who was the first to show the amazing wonders of pond scum. Who knew that studying diatoms and algae as an undergraduate would lead me all the way to a Ph.D.
    [Show full text]
  • Old Woman Creek National Estuarine Research Reserve Management Plan 2011-2016
    Old Woman Creek National Estuarine Research Reserve Management Plan 2011-2016 April 1981 Revised, May 1982 2nd revision, April 1983 3rd revision, December 1999 4th revision, May 2011 Prepared for U.S. Department of Commerce Ohio Department of Natural Resources National Oceanic and Atmospheric Administration Division of Wildlife Office of Ocean and Coastal Resource Management 2045 Morse Road, Bldg. G Estuarine Reserves Division Columbus, Ohio 1305 East West Highway 43229-6693 Silver Spring, MD 20910 This management plan has been developed in accordance with NOAA regulations, including all provisions for public involvement. It is consistent with the congressional intent of Section 315 of the Coastal Zone Management Act of 1972, as amended, and the provisions of the Ohio Coastal Management Program. OWC NERR Management Plan, 2011 - 2016 Acknowledgements This management plan was prepared by the staff and Advisory Council of the Old Woman Creek National Estuarine Research Reserve (OWC NERR), in collaboration with the Ohio Department of Natural Resources-Division of Wildlife. Participants in the planning process included: Manager, Frank Lopez; Research Coordinator, Dr. David Klarer; Coastal Training Program Coordinator, Heather Elmer; Education Coordinator, Ann Keefe; Education Specialist Phoebe Van Zoest; and Office Assistant, Gloria Pasterak. Other Reserve staff including Dick Boyer and Marje Bernhardt contributed their expertise to numerous planning meetings. The Reserve is grateful for the input and recommendations provided by members of the Old Woman Creek NERR Advisory Council. The Reserve is appreciative of the review, guidance, and council of Division of Wildlife Executive Administrator Dave Scott and the mapping expertise of Keith Lott and the late Steve Barry.
    [Show full text]
  • The Plankton Lifeform Extraction Tool: a Digital Tool to Increase The
    Discussions https://doi.org/10.5194/essd-2021-171 Earth System Preprint. Discussion started: 21 July 2021 Science c Author(s) 2021. CC BY 4.0 License. Open Access Open Data The Plankton Lifeform Extraction Tool: A digital tool to increase the discoverability and usability of plankton time-series data Clare Ostle1*, Kevin Paxman1, Carolyn A. Graves2, Mathew Arnold1, Felipe Artigas3, Angus Atkinson4, Anaïs Aubert5, Malcolm Baptie6, Beth Bear7, Jacob Bedford8, Michael Best9, Eileen 5 Bresnan10, Rachel Brittain1, Derek Broughton1, Alexandre Budria5,11, Kathryn Cook12, Michelle Devlin7, George Graham1, Nick Halliday1, Pierre Hélaouët1, Marie Johansen13, David G. Johns1, Dan Lear1, Margarita Machairopoulou10, April McKinney14, Adam Mellor14, Alex Milligan7, Sophie Pitois7, Isabelle Rombouts5, Cordula Scherer15, Paul Tett16, Claire Widdicombe4, and Abigail McQuatters-Gollop8 1 10 The Marine Biological Association (MBA), The Laboratory, Citadel Hill, Plymouth, PL1 2PB, UK. 2 Centre for Environment Fisheries and Aquacu∑lture Science (Cefas), Weymouth, UK. 3 Université du Littoral Côte d’Opale, Université de Lille, CNRS UMR 8187 LOG, Laboratoire d’Océanologie et de Géosciences, Wimereux, France. 4 Plymouth Marine Laboratory, Prospect Place, Plymouth, PL1 3DH, UK. 5 15 Muséum National d’Histoire Naturelle (MNHN), CRESCO, 38 UMS Patrinat, Dinard, France. 6 Scottish Environment Protection Agency, Angus Smith Building, Maxim 6, Parklands Avenue, Eurocentral, Holytown, North Lanarkshire ML1 4WQ, UK. 7 Centre for Environment Fisheries and Aquaculture Science (Cefas), Lowestoft, UK. 8 Marine Conservation Research Group, University of Plymouth, Drake Circus, Plymouth, PL4 8AA, UK. 9 20 The Environment Agency, Kingfisher House, Goldhay Way, Peterborough, PE4 6HL, UK. 10 Marine Scotland Science, Marine Laboratory, 375 Victoria Road, Aberdeen, AB11 9DB, UK.
    [Show full text]
  • Assessment of Transoceanic NOBOB Vessels and Low-Salinity Ballast Water As Vectors for Non-Indigenous Species Introductions to the Great Lakes
    A Final Report for the Project Assessment of Transoceanic NOBOB Vessels and Low-Salinity Ballast Water as Vectors for Non-indigenous Species Introductions to the Great Lakes Principal Investigators: Thomas Johengen, CILER-University of Michigan David Reid, NOAA-GLERL Gary Fahnenstiel, NOAA-GLERL Hugh MacIsaac, University of Windsor Fred Dobbs, Old Dominion University Martina Doblin, Old Dominion University Greg Ruiz, Smithsonian Institution-SERC Philip Jenkins, Philip T Jenkins and Associates Ltd. Period of Activity: July 1, 2001 – December 31, 2003 Co-managed by Cooperative Institute for Limnology and Ecosystems Research School of Natural Resources and Environment University of Michigan Ann Arbor, MI 48109 and NOAA-Great Lakes Environmental Research Laboratory 2205 Commonwealth Blvd. Ann Arbor, MI 48105 April 2005 (Revision 1, May 20, 2005) Acknowledgements This was a large, complex research program that was accomplished only through the combined efforts of many persons and institutions. The Principal Investigators would like to acknowledge and thank the following for their many activities and contributions to the success of the research documented herein: At the University of Michigan, Cooperative Institute for Limnology and Ecosystem Research, Steven Constant provided substantial technical and field support for all aspects of the NOBOB shipboard sampling and maintained the photo archive; Ying Hong provided technical laboratory and field support for phytoplankton experiments and identification and enumeration of dinoflagellates in the NOBOB residual samples; and Laura Florence provided editorial support and assistance in compiling the Final Report. At the Great Lakes Institute for Environmental Research, University of Windsor, Sarah Bailey and Colin van Overdijk were involved in all aspects of the NOBOB shipboard sampling and conducted laboratory analyses of invertebrates and invertebrate resting stages.
    [Show full text]
  • Biovolumes and Size-Classes of Phytoplankton in the Baltic Sea
    Baltic Sea Environment Proceedings No.106 Biovolumes and Size-Classes of Phytoplankton in the Baltic Sea Helsinki Commission Baltic Marine Environment Protection Commission Baltic Sea Environment Proceedings No. 106 Biovolumes and size-classes of phytoplankton in the Baltic Sea Helsinki Commission Baltic Marine Environment Protection Commission Authors: Irina Olenina, Centre of Marine Research, Taikos str 26, LT-91149, Klaipeda, Lithuania Susanna Hajdu, Dept. of Systems Ecology, Stockholm University, SE-106 91 Stockholm, Sweden Lars Edler, SMHI, Ocean. Services, Nya Varvet 31, SE-426 71 V. Frölunda, Sweden Agneta Andersson, Dept of Ecology and Environmental Science, Umeå University, SE-901 87 Umeå, Sweden, Umeå Marine Sciences Centre, Umeå University, SE-910 20 Hörnefors, Sweden Norbert Wasmund, Baltic Sea Research Institute, Seestr. 15, D-18119 Warnemünde, Germany Susanne Busch, Baltic Sea Research Institute, Seestr. 15, D-18119 Warnemünde, Germany Jeanette Göbel, Environmental Protection Agency (LANU), Hamburger Chaussee 25, D-24220 Flintbek, Germany Slawomira Gromisz, Sea Fisheries Institute, Kollataja 1, 81-332, Gdynia, Poland Siv Huseby, Umeå Marine Sciences Centre, Umeå University, SE-910 20 Hörnefors, Sweden Maija Huttunen, Finnish Institute of Marine Research, Lyypekinkuja 3A, P.O. Box 33, FIN-00931 Helsinki, Finland Andres Jaanus, Estonian Marine Institute, Mäealuse 10 a, 12618 Tallinn, Estonia Pirkko Kokkonen, Finnish Environment Institute, P.O. Box 140, FIN-00251 Helsinki, Finland Iveta Ledaine, Inst. of Aquatic Ecology, Marine Monitoring Center, University of Latvia, Daugavgrivas str. 8, Latvia Elzbieta Niemkiewicz, Maritime Institute in Gdansk, Laboratory of Ecology, Dlugi Targ 41/42, 80-830, Gdansk, Poland All photographs by Finnish Institute of Marine Research (FIMR) Cover photo: Aphanizomenon flos-aquae For bibliographic purposes this document should be cited to as: Olenina, I., Hajdu, S., Edler, L., Andersson, A., Wasmund, N., Busch, S., Göbel, J., Gromisz, S., Huseby, S., Huttunen, M., Jaanus, A., Kokkonen, P., Ledaine, I.
    [Show full text]
  • Lateral Gene Transfer of Anion-Conducting Channelrhodopsins Between Green Algae and Giant Viruses
    bioRxiv preprint doi: https://doi.org/10.1101/2020.04.15.042127; this version posted April 23, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. 1 5 Lateral gene transfer of anion-conducting channelrhodopsins between green algae and giant viruses Andrey Rozenberg 1,5, Johannes Oppermann 2,5, Jonas Wietek 2,3, Rodrigo Gaston Fernandez Lahore 2, Ruth-Anne Sandaa 4, Gunnar Bratbak 4, Peter Hegemann 2,6, and Oded 10 Béjà 1,6 1Faculty of Biology, Technion - Israel Institute of Technology, Haifa 32000, Israel. 2Institute for Biology, Experimental Biophysics, Humboldt-Universität zu Berlin, Invalidenstraße 42, Berlin 10115, Germany. 3Present address: Department of Neurobiology, Weizmann 15 Institute of Science, Rehovot 7610001, Israel. 4Department of Biological Sciences, University of Bergen, N-5020 Bergen, Norway. 5These authors contributed equally: Andrey Rozenberg, Johannes Oppermann. 6These authors jointly supervised this work: Peter Hegemann, Oded Béjà. e-mail: [email protected] ; [email protected] 20 ABSTRACT Channelrhodopsins (ChRs) are algal light-gated ion channels widely used as optogenetic tools for manipulating neuronal activity 1,2. Four ChR families are currently known. Green algal 3–5 and cryptophyte 6 cation-conducting ChRs (CCRs), cryptophyte anion-conducting ChRs (ACRs) 7, and the MerMAID ChRs 8. Here we 25 report the discovery of a new family of phylogenetically distinct ChRs encoded by marine giant viruses and acquired from their unicellular green algal prasinophyte hosts.
    [Show full text]
  • Chloroplast Structure of the Cryptophyceae
    CHLOROPLAST STRUCTURE OF THE CRYPTOPHYCEAE Evidence for Phycobiliproteins within Intrathylakoidal Spaces E . GANTT, M . R . EDWARDS, and L . PROVASOLI From the Radiation Biology Laboratory, Smithsonian Institution, Rockville, Maryland 20852, the Division of Laboratories and Research, New York State Department of Health, Albany, New York 12201, and the Haskins Laboratories, New Haven, Connecticut 06520 ABSTRACT Selective extraction and morphological evidence indicate that the phycobiliproteins in three Cryptophyceaen algae (Chroomonas, Rhodomonas, and Cryptomonas) are contained within intrathylakoidal spaces and are not on the stromal side of the lamellae as in the red and blue-green algae . Furthermore, no discrete phycobilisome-type aggregates have thus far been observed in the Cryptophyceae . Structurally, although not necessarily functionally, this is a radical difference . The width of the intrathylakoidal spaces can vary but is gen- erally about 200-300 A . While the thylakoid membranes are usually closely aligned, grana- type fusions do not occur. In Chroomonas these membranes evidence an extensive periodic display with a spacing on the order of 140-160 A . This periodicity is restricted to the mem- branes and has not been observed in the electron-opaque intrathylakoidal matrix . INTRODUCTION The varied characteristics of the cryptomonads (3), Greenwood in Kirk and Tilney-Bassett (10), are responsible for their indefinite taxonomic and Lucas (13) . The thylakoids have a tendency position (17), but at the same time they enhance to be arranged in pairs, that is, for two of them to their status in evolutionary schemes (1, 4) . Their be closely associated with a 30-50 A space between chloroplast structure is distinct from that of every them .
    [Show full text]
  • The CSIRO Collection of Living Microalgae: an Australian Perspective on Microalgal Biodiversity and Applications
    The CSIRO Collection of Living Microalgae: An Australian Perspective on Microalgal Biodiversity and Applications S.I. Blackburn, I.D. Jameson, D. Frampton, M. Brown, M. Mansour, A. Negri, N.S. Parker, S. Robert, C.J. Bolch, P.D. Nichols and J.K. Volkman CSIRO Marine Research, Hobart, Tasmania, Australia [email protected] [email protected] ABSTRACT The CSIRO Collection of Living Microalgae maintains over 800 strains from 140 genera representing the majority of marine and some freshwater microalgal classes. The Collection is incorpoarted within the CSIRO Microalgal Research Centre (CMARC) which provides a supply service of microalgal strains to industry, government and university organizations. Research within CMARC and in partnership with collaborators spans a wide base within the three themes of Environment, Aquaculture and Biotechnology. Some of the research projects undertaken include physiological studies of different life-history stages of microalgae, toxin production in harmful algal bloom (HAB) species, phylogenetic studies of different populations of HAB species, optimizing the nutritional benefit of microalgal diets in larval and broodstock aquaculture species, including important nutrients such as vitamins and polyunstaurated fatty acids. Research is also being undertaken into optimizing high biomass production systems through the use of photobioreactors. 1. THE CSIRO COLLECTION OF LIVING MICROALGAE The CSIRO Collection of Living Microalgae maintains over 800 strains from 140 genera representing the majority of marine and some freshwater microalgal classes (see Fig.1 for summary, list of strains available from the authors or downloadable from http://www.marine.csiro.au). There are also some selected micro-heterotrophic strains. This collection is the largest and most diverse microalgal culture collection in Australia and, with NIES-Collection (National Institute for Environmental Studies, Environment Agency) in Japan, ranks as a major microalgal collection in the the Asia-Pacific region.
    [Show full text]
  • Bangor University DOCTOR of PHILOSOPHY
    Bangor University DOCTOR OF PHILOSOPHY Studies on micro algal fine-structure, taxonomy and systematics : cryptophyceae and bacillariophyceae. Novarino, Gianfranco Award date: 1990 Link to publication General rights Copyright and moral rights for the publications made accessible in the public portal are retained by the authors and/or other copyright owners and it is a condition of accessing publications that users recognise and abide by the legal requirements associated with these rights. • Users may download and print one copy of any publication from the public portal for the purpose of private study or research. • You may not further distribute the material or use it for any profit-making activity or commercial gain • You may freely distribute the URL identifying the publication in the public portal ? Take down policy If you believe that this document breaches copyright please contact us providing details, and we will remove access to the work immediately and investigate your claim. Download date: 02. Oct. 2021 Studies on microalgal fine-structure, taxonomy, and systematics: Cryptopbyceae and Bacillariopbyceae In Two Volumes Volume I (Text) ,, ý,ý *-ýýI Twl by Gianfranco Novarino, Dottore in Scienze Biologiche (Rom) A Thesis submitted to the University of Wales in candidature for the degree of Philosophiae Doctor University of Wales (Bangor) School of Ocean Sciences Marine Science Laboratories Menai Bridge, Isle of Anglesey, United Kingdom December 1990 Lýýic. JýýVt. BEST COPY AVAILABLE Acknowledge mehts Dr I. A. N. Lucas, who supervised this work, kindly provided his helpful guidance, sharing his knowledge and expertise with patience and concern, critically reading the manuscripts of papers on the Cryptophyceae, and supplying many starter cultures of the strains studied here.
    [Show full text]
  • Nanoplankton Protists from the Western Mediterranean Sea. II. Cryptomonads (Cryptophyceae = Cryptomonadea)*
    sm69n1047 4/3/05 20:30 Página 47 SCI. MAR., 69 (1): 47-74 SCIENTIA MARINA 2005 Nanoplankton protists from the western Mediterranean Sea. II. Cryptomonads (Cryptophyceae = Cryptomonadea)* GIANFRANCO NOVARINO Department of Zoology, The Natural History Museum, Cromwell Road, London SW7 5BD, U.K. E-mail: [email protected] SUMMARY: This paper is an electron microscopical account of cryptomonad flagellates (Cryptophyceae = Cryptomon- adea) in the plankton of the western Mediterranean Sea. Bottle samples collected during the spring-summer of 1998 in the Sea of Alboran and Barcelona coastal waters contained a total of eleven photosynthetic species: Chroomonas (sensu aucto- rum) sp., Cryptochloris sp., 3 species of Hemiselmis, 3 species of Plagioselmis including Plagioselmis nordica stat. nov/sp. nov., Rhinomonas reticulata (Lucas) Novarino, Teleaulax acuta (Butcher) Hill, and Teleaulax amphioxeia (Conrad) Hill. Identification was based largely on cell surface features, as revealed by scanning electron microscopy (SEM). Cells were either dispersed in the water-column or associated with suspended particulate matter (SPM). Plagioselmis prolonga was the most common species both in the water-column and in association with SPM, suggesting that it might be a key primary pro- ducer of carbon. Taxonomic keys are given based on SEM. Key words: Cryptomonadea, cryptomonads, Cryptophyceae, flagellates, nanoplankton, taxonomy, ultrastructure. RESUMEN: PROTISTAS NANOPLANCTÓNICOS DEL MAR MEDITERRANEO NOROCCIDENTAL II. CRYPTOMONADALES (CRYPTOPHY- CEAE = CRYPTOMONADEA). – Este estudio describe a los flagelados cryptomonadales (Cryptophyceae = Cryptomonadea) planctónicos del Mar Mediterraneo Noroccidental mediante microscopia electrónica. La muestras recogidas en botellas durante la primavera-verano de 1998 en el Mar de Alboran y en aguas costeras de Barcelona, contenian un total de 11 espe- cies fotosintéticas: Chroomonas (sensu auctorum) sp., Cryptochloris sp., 3 especies de Hemiselmis, 3 especies de Plagio- selmis incluyendo Plagioselmis nordica stat.
    [Show full text]
  • Nuclear Genome Sequence of the Plastid-Lacking
    Cenci et al. BMC Biology (2018) 16:137 https://doi.org/10.1186/s12915-018-0593-5 RESEARCH ARTICLE Open Access Nuclear genome sequence of the plastid- lacking cryptomonad Goniomonas avonlea provides insights into the evolution of secondary plastids Ugo Cenci1,2†, Shannon J. Sibbald1,2†, Bruce A. Curtis1,2, Ryoma Kamikawa3, Laura Eme1,2,11, Daniel Moog1,2,12, Bernard Henrissat4,5,6, Eric Maréchal7, Malika Chabi8, Christophe Djemiel8, Andrew J. Roger1,2,9, Eunsoo Kim10 and John M. Archibald1,2,9* Abstract Background: The evolution of photosynthesis has been a major driver in eukaryotic diversification. Eukaryotes have acquired plastids (chloroplasts) either directly via the engulfment and integration of a photosynthetic cyanobacterium (primary endosymbiosis) or indirectly by engulfing a photosynthetic eukaryote (secondary or tertiary endosymbiosis). The timing and frequency of secondary endosymbiosis during eukaryotic evolution is currently unclear but may be resolved in part by studying cryptomonads, a group of single-celled eukaryotes comprised of both photosynthetic and non-photosynthetic species. While cryptomonads such as Guillardia theta harbor a red algal-derived plastid of secondary endosymbiotic origin, members of the sister group Goniomonadea lack plastids. Here, we present the genome of Goniomonas avonlea—the first for any goniomonad—to address whether Goniomonadea are ancestrally non-photosynthetic or whether they lost a plastid secondarily. Results: We sequenced the nuclear and mitochondrial genomes of Goniomonas avonlea and carried out a comparative analysis of Go. avonlea, Gu. theta, and other cryptomonads. The Go. avonlea genome assembly is ~ 92 Mbp in size, with 33,470 predicted protein-coding genes. Interestingly, some metabolic pathways (e.g., fatty acid biosynthesis) predicted to occur in the plastid and periplastidal compartment of Gu.
    [Show full text]
  • Lake Spokane Dissolved Oxygen Water Quality Attainment Plan Five Year Report
    AVISTA CORPORATION LAKE SPOKANE DISSOLVED OXYGEN WATER QUALITY ATTAINMENT PLAN FIVE YEAR REPORT WASHINGTON 401 CERTIFICATION FERC LICENSE APPENDIX B, SECTION 5.6 SPOKANE RIVER HYDROELECTRIC PROJECT FERC PROJECT NO. 2545 Prepared By: March 24, 2017 [Page intentionally left blank] TABLE OF CONTENTS 1.0 INTRODUCTION ........................................................................................................ 1 2.0 BASELINE MONITORING ........................................................................................ 3 2.1 2016 Monitoring Results .............................................................................................. 3 2.2 Assessment of Lake Spokane Water Quality (2010 – 2016) ........................................ 7 2.3 Monitoring Recommendations ..................................................................................... 8 3.0 IMPLEMENTATION ACTIVITIES ........................................................................... 9 3.1 Studies .......................................................................................................................... 9 3.1.1 Carp Population Reduction Program ...................................................................... 10 3.1.2 Aquatic Weed Management .................................................................................... 10 3.2 2016 Implementation Measures .................................................................................. 11 3.2.1 Carp ........................................................................................................................
    [Show full text]