Baffinellaceae Fam. Nov., Cryptophyceae) from Baffin Bay: Morphology, Pigment Profile, Phylogeny, and Growth Rate Response to Three Abiotic Factors1

Total Page:16

File Type:pdf, Size:1020Kb

Load more

J. Phycol. *, ***–*** (2018) © 2018 Phycological Society of America DOI: 10.1111/jpy.12766 BAFFINELLA FRIGIDUS GEN. ET SP. NOV. (BAFFINELLACEAE FAM. NOV., CRYPTOPHYCEAE) FROM BAFFIN BAY: MORPHOLOGY, PIGMENT PROFILE, PHYLOGENY, AND GROWTH RATE RESPONSE TO THREE ABIOTIC FACTORS1 Niels Daugbjerg,2 Andreas Norlin Marine Biological Section, Department of Biology, University of Copenhagen, Universitetsparken 4, Copenhagen Ø DK-2100, Denmark and Connie Lovejoy Departement de Biologie, Universite Laval, 1045 avenue de la Medecine, Quebec, Quebec, G1V 0A6, Canada Twenty years ago an Arctic cryptophyte was Abbreviations: BA, Bayesian analysis; BS, bootstrap isolated from Baffin Bay and given strain number support; Cr-PC, cryptophyte-phycocyanin; Cr-PE, CCMP2045. Here, it was described using cryptophyte-phycoerythrin; ML, maximum likeli- morphology, water- and non-water soluble pigments hood; PP, posterior probability and nuclear-encoded SSU rDNA. The influence of temperature, salinity, and light intensity on growth rates was also examined. Microscopy revealed = typical cryptophyte features but the chloroplast Cryptophytes ( cryptomonads) are ubiquitous in color was either green or red depending on the marine and freshwater ecosystems worldwide and a few species have been recorded to form blooms light intensity provided. Phycoerythrin (Cr-PE 566) was only produced when cells were grown under (e.g., Laza-Martınez 2012, Supraha et al. 2014, and À À low-light conditions (5 lmol photons Á m 2 Á s 1). references therein). However, they also reside in Non-water-soluble pigments included chlorophyll a, more extreme environments, for example, soil (Paulsen et al. 1992), snow (Javornicky and Hindak c2 and five major carotenoids. Cells measured 8.2 3 5.1 lm and a tail-like appendage gave them a 1970), and inside ikaite columns (Ikka fjord, South- comma-shape. The nucleus was located posteriorly west Greenland; Kristiansen and Kristiansen 1999, and a horseshoe-shaped chloroplast contained a N. Daugbjerg, unpub. data). The currently accepted single pyrenoid. Ejectosomes of two sizes and a taxonomy of Cryptomonada includes two classes: nucleomorph anterior to the pyrenoid were the photoautotrophic Cryptophyceae (note: Chilomo- discerned in TEM. SEM revealed a slightly elevated nas is heterotrophic but this state is most likely sec- vestibular plate in the vestibulum. The inner ondarily derived) and the phagotrophic periplast component consisted of slightly Goniomonadea. Until recently, the latter class con- overlapping hexagonal plates arranged in 16–20 sisted of only a single genus Goniomonas and some oblique rows. Antapical plates were smaller and environmental sequences, but Shiratori and Ishida their shape less profound. Temperature and salinity (2016) have described the second heterotrophic studies revealed CCMP2045 as stenothermal and cryptomonad (Hemiarma marina). euryhaline and growth was saturated between 5 and The species diversity of Cryptophyceae has been À À 20 lmol photons Á m 2 Á s 1. The phylogeny based studied for more than 180 years as Ehrenberg dis- on SSU rDNA showed that CCMP2045 formed a covered the first cryptophyte (Cryptomonas ovata)in distinct clade with CCMP2293 and Falcomonas sp. 1831. However, the first detailed descriptions and isolated from Spain. Combining pheno- and drawings were published 7 years later (Ehrenberg genotypic data, the Arctic cryptophyte could not be 1838). According to AlgaeBase, as of May 2018, placed in an existing family and genus and there are 41 genera listed in the Cryptophyceae (Guiry and Guiry 2018) and of these 21 are mono- therefore Baffinellaceae fam. nov. and Baffinella = frigidus gen. et sp. nov. were proposed. typic ( 53.7%). At the biochemical level, cryptophytes possess a Key index words: Arctic flagellates; cryptophytes; unique combination of pigments that include growth rates; phylogeny; taxonomy; ultrastructure chlorophylls a and c2, one of two phycobiliproteins and the cryptophyte specific carotenoid alloxanthin, alongside other common carotenoids (Hill and Rowan 1989, Cerino and Zingone 2007, Egeland 1 Received 17 April 2018. Accepted 27 June 2018. First Published 2016). The two phycobiliproteins found in crypto- Online 25 July 2018. 2Author for correspondence: e-mail [email protected]. phytes are phycoerythrin and phycocyanin, and Editorial Responsibility: L. Graham (Associate Editor) these have different structural configurations 1 2 NIELS DAUGBJERG ET AL. identified by their absorption peaks. Some of these with existing families. Thus, a new family Baffinel- configurations are unique (Hill and Rowan 1989, laceae fam. nov. was also described. Novarino 2012). For each genus, only one type of phycobiliprotein is present except for Hemiselmis that has been shown to contain species with either MATERIALS AND METHODS Cr-PC 615 and Cr-PE 555 (Hill and Rowan 1989). Culture. Strain CCMP2045 was isolated from a water sam- 0 As some families possess the same phycobiliprotein ple collected in Baffin Bay (June 23, 1998; 76°19 15″ N, ° 0 ″ (Clay et al. 1999), it has been discussed if the pho- 75 49 02 W; Fig. 1) at a depth of 11 m. A sub-culture of this tosynthetic pigment profile can be used to distin- strain was sent to the Marine Biological Section at University of Copenhagen where it has been kept at 4°C in L1 medium guish taxa at the family level (Fritsch 1935, (Guillard and Hargraves 1993) with a salinity of 30 and a Pringsheim 1944, Butcher 1967, Hill and Rowan light:dark cycle of 16:8 h. 1989). Microscopy. Live cells were studied using a Carl Zeiss Axio At the light microscopical level, the gross mor- Imager.M2 with a 639 oil immersion lens. Micrographs were phology of cryptophytes is somewhat similar: droplet taken with a Zeiss AxioCam HRc digital camera (Zeiss, Ober- cell shape and two flagella that emerge from the kochen, Germany). Chlorophyll fluorescence was recorded subapical end. Thus, most taxonomic differences using a Zeiss AxioCam MRc digital camera and the filter set 09 (excitation BP450-490, emission LP515). Length and width relate to the ultrastructure of the periplast compo- of 59 cells were measured using Zen image acquisition soft- nent, position of the nucleomorph, appearance of ware from Zeiss. Means and standard deviations were calcu- the rhizostyle, and the furrow-gullet complex (Clay lated using IBM SPSS statistics (ver. 24, Armonk, NY, USA). et al. 1999). For transmission electron microscopy, 5 mL of a dense cul- In the Arctic, cryptomonads have been shown to ture was fixed in 5 mL of 4% glutaraldehyde in 0.2 M cacody- contribute to both pelagic and sympagic communi- late buffer containing 0.5 M sucrose for 1 h and 25 min. The ties of microalgae. They are also part of the spring fixed cells were pelleted by centrifugation and the super- natant except for 2 mL was removed. Two milliliter 0.2 M bloom when the sea ice melts and nutrients are cacodylate buffer containing 0.5 M sucrose was added. After released to the open water column (Mikkelsen 20 min, 2 mL of the supernatant was removed and replaced et al. 2008, Vallieres et al. 2008, Poulin et al. 2011, with 2 mL 0.2 M cacodylate buffer without sucrose for Coupel et al. 2012). However, very few studies have 20 min. The mix was centrifuged at 1,201 g for 10 min after addressed the taxonomy of Arctic cryptophytes. each of these steps. For post-fixation 2 mL of the supernatant Recently, the species diversity of Arctic marine pro- tists including cryptomonads was studied by molec- ular techniques (e.g., clone libraries and high throughput sequencing; Sørensen et al. 2012, Mar- quardt et al. 2016, Stecher et al. 2016). These stud- ies have provided detailed information on operational taxonomic units, but for many of the determined ribotype sequences we have little understanding of the corresponding morphos- pecies. In this study, a cryptophyte was isolated from material collected in Baffin Bay in Arctic Canada (1998), and later deposited at Provasoli-Guillard National Center for Marine Micro Algae and Micro- biota in Maine, USA (Potvin and Lovejoy 2009), where it was given the strain number CCMP2045. The aim of this study was to describe this strain using a polyphasic approach, which included a mor- phological characterization using LM, TEM and SEM. The composition of both water and non-water- soluble pigments was analyzed to describe the pro- file of photosynthetic marker pigments. To infer the phylogeny of CCMP2045, the nuclear-encoded SSU rDNA sequence was compared to 50 other cryp- tomonads. Finally, growth rates were estimated through autecological experiments elucidating salin- ity and temperature tolerance limits as well as growth rates at different light intensities. Based on these results, a new genus and species Baffinella frigi- dus gen. et sp. nov. was proposed to accommodate for strain CCMP2045. The combination of morpho- FIG. 1. Map of sampling location (*)ofBaffinella frigidus gen. logical features and phycobiliproteins did not fit et sp. nov. in Baffin Bay. BAFFINELLA FRIGIDUS, AN ARTIC MARINE CRYPTOPHYTE 3 was removed and 2 mL, consisting of 0.5 mL 4% OsO4 and previously been determined by Potvin and Lovejoy. The 1.5 mL 0.2 M cacodylate buffer was added for 1 h before sequences were retrieved from GenBank (accession number being rinsed with 0.2 M cacodylate buffer. For dehydration, a GQ375264 and GQ375265, respectively) and added to an series of ethanol was used, 20 min for each concentration alignment consisting of 50 other SSU rDNA sequences of (30%, 50%, 70%, 90%, and 100% in molecular sieves) with cryptomonads including 18 genera and 38 taxa identified to 100% in molecular sieves used twice. The pellet was rinsed species. The data matrix was edited using the JALVIEW twice in propylene oxide before embedding and left over- sequence editor (ver. 2.9.0b2; Waterhouse et al. 2009) follow- night in a mix of 1:1 propylene oxide and Spurr’s resin. The ing an alignment based on ClustalW as implemented in the next day Spurr’s resin was replaced by fresh Spurr’s resin for software.
Recommended publications
  • High Abundance of Plagioselmis Cf. Prolonga in the Krka River Estuary (Eastern Adriatic Sea)

    High Abundance of Plagioselmis Cf. Prolonga in the Krka River Estuary (Eastern Adriatic Sea)

    SCIENTIA MARINA 78(3) September 2014, 329-338, Barcelona (Spain) ISSN-L: 0214-8358 doi: http://dx.doi.org/10.3989/scimar.03998.28C Cryptophyte bloom in a Mediterranean estuary: High abundance of Plagioselmis cf. prolonga in the Krka River estuary (eastern Adriatic Sea) Luka Šupraha 1, 2, Sunčica Bosak 1, Zrinka Ljubešić 1, Hrvoje Mihanović 3, Goran Olujić 3, Iva Mikac 4, Damir Viličić 1 1 Department of Biology, Faculty of Science, University of Zagreb, Rooseveltov trg 6, 10000 Zagreb, Croatia. 2 Present address: Department of Earth Sciences, Paleobiology Programme, Uppsala University, Villavägen 16, SE-752 36 Uppsala, Sweden. E-mail: [email protected] 3 Hydrographic Institute of the Republic of Croatia, Zrinsko-Frankopanska 161, 21000 Split, Croatia. 4 Ruđer Bošković Institute, Bijenička cesta 54, 10000 Zagreb, Croatia. Summary: During the June 2010 survey of phytoplankton and physicochemical parameters in the Krka River estuary (east- ern Adriatic Sea), a cryptophyte bloom was observed. High abundance of cryptophytes (maximum 7.9×106 cells l–1) and high concentrations of the class-specific biomarker pigment alloxanthine (maximum 2312 ng l–1) were detected in the surface layer and at the halocline in the lower reach of the estuary. Taxonomical analysis revealed that the blooming species was Plagioselmis cf. prolonga. Analysis of the environmental parameters in the estuary suggested that the bloom was supported by the slower river flow as well as the increased orthophosphate and ammonium concentrations. The first record of a crypto- phyte bloom in the Krka River estuary may indicate that large-scale changes are taking place in the phytoplankton commu- nity.
  • University of Oklahoma

    University of Oklahoma

    UNIVERSITY OF OKLAHOMA GRADUATE COLLEGE MACRONUTRIENTS SHAPE MICROBIAL COMMUNITIES, GENE EXPRESSION AND PROTEIN EVOLUTION A DISSERTATION SUBMITTED TO THE GRADUATE FACULTY in partial fulfillment of the requirements for the Degree of DOCTOR OF PHILOSOPHY By JOSHUA THOMAS COOPER Norman, Oklahoma 2017 MACRONUTRIENTS SHAPE MICROBIAL COMMUNITIES, GENE EXPRESSION AND PROTEIN EVOLUTION A DISSERTATION APPROVED FOR THE DEPARTMENT OF MICROBIOLOGY AND PLANT BIOLOGY BY ______________________________ Dr. Boris Wawrik, Chair ______________________________ Dr. J. Phil Gibson ______________________________ Dr. Anne K. Dunn ______________________________ Dr. John Paul Masly ______________________________ Dr. K. David Hambright ii © Copyright by JOSHUA THOMAS COOPER 2017 All Rights Reserved. iii Acknowledgments I would like to thank my two advisors Dr. Boris Wawrik and Dr. J. Phil Gibson for helping me become a better scientist and better educator. I would also like to thank my committee members Dr. Anne K. Dunn, Dr. K. David Hambright, and Dr. J.P. Masly for providing valuable inputs that lead me to carefully consider my research questions. I would also like to thank Dr. J.P. Masly for the opportunity to coauthor a book chapter on the speciation of diatoms. It is still such a privilege that you believed in me and my crazy diatom ideas to form a concise chapter in addition to learn your style of writing has been a benefit to my professional development. I’m also thankful for my first undergraduate research mentor, Dr. Miriam Steinitz-Kannan, now retired from Northern Kentucky University, who was the first to show the amazing wonders of pond scum. Who knew that studying diatoms and algae as an undergraduate would lead me all the way to a Ph.D.
  • Development of Molecular Probes for Dinophysis (Dinophyceae) Plastid: a Tool to Predict Blooming and Explore Plastid Origin

    Development of Molecular Probes for Dinophysis (Dinophyceae) Plastid: a Tool to Predict Blooming and Explore Plastid Origin

    Development of Molecular Probes for Dinophysis (Dinophyceae) Plastid: A Tool to Predict Blooming and Explore Plastid Origin Yoshiaki Takahashi,1 Kiyotaka Takishita,2 Kazuhiko Koike,1 Tadashi Maruyama,2 Takeshi Nakayama,3 Atsushi Kobiyama,1 Takehiko Ogata1 1School of Fisheries Sciences, Kitasato University, Sanriku, Ofunato, Iwate, 022-01011, Japan 2Marine Biotechnology Institute, Heita Kamaishi, Iwate, 026-0001, Japan 3Institute of Biological Sciences, University of Tsukuba, Tennoh-dai, Tsukuba, Ibaraki, 305-8577, Japan Received: 9 July 2004 / Accepted: 19 August 2004 / Online publication: 24 March 2005 Abstract Introduction Dinophysis are species of dinoflagellates that cause Some phytoplankton species are known to produce diarrhetic shellfish poisoning. We have previously toxins that accumulate in plankton feeders. In par- reported that they probably acquire plastids from ticular, toxin accumulation in bivalves causes food cryptophytes in the environment, after which they poisoning in humans, and often leads to severe eco- bloom. Thus monitoring the intracellular plastid nomic damage to the shellfish industry. density in Dinophysis and the source cryptophytes Diarrhetic shellfish poisoning (DSP) is a gastro- occurring in the field should allow prediction of intestinal syndrome caused by phytoplankton tox- Dinophysis blooming. In this study the nucleotide ins, including okadaic acid, and several analogues of sequences of the plastid-encoded small subunit dinophysistoxin (Yasumoto et al., 1985). These tox- ribosomal RNA gene and rbcL (encoding the large ins are derived from several species of dinoflagellates subunit of RuBisCO) from Dinophysis spp. were belonging to the genus Dinophysis (Yasumoto et al, compared with those of cryptophytes, and genetic 1980; Lee et al., 1989). Despite extensive studies in probes specific for the Dinophysis plastid were de- the last 2 decades, little is known about the eco- signed.
  • Old Woman Creek National Estuarine Research Reserve Management Plan 2011-2016

    Old Woman Creek National Estuarine Research Reserve Management Plan 2011-2016

    Old Woman Creek National Estuarine Research Reserve Management Plan 2011-2016 April 1981 Revised, May 1982 2nd revision, April 1983 3rd revision, December 1999 4th revision, May 2011 Prepared for U.S. Department of Commerce Ohio Department of Natural Resources National Oceanic and Atmospheric Administration Division of Wildlife Office of Ocean and Coastal Resource Management 2045 Morse Road, Bldg. G Estuarine Reserves Division Columbus, Ohio 1305 East West Highway 43229-6693 Silver Spring, MD 20910 This management plan has been developed in accordance with NOAA regulations, including all provisions for public involvement. It is consistent with the congressional intent of Section 315 of the Coastal Zone Management Act of 1972, as amended, and the provisions of the Ohio Coastal Management Program. OWC NERR Management Plan, 2011 - 2016 Acknowledgements This management plan was prepared by the staff and Advisory Council of the Old Woman Creek National Estuarine Research Reserve (OWC NERR), in collaboration with the Ohio Department of Natural Resources-Division of Wildlife. Participants in the planning process included: Manager, Frank Lopez; Research Coordinator, Dr. David Klarer; Coastal Training Program Coordinator, Heather Elmer; Education Coordinator, Ann Keefe; Education Specialist Phoebe Van Zoest; and Office Assistant, Gloria Pasterak. Other Reserve staff including Dick Boyer and Marje Bernhardt contributed their expertise to numerous planning meetings. The Reserve is grateful for the input and recommendations provided by members of the Old Woman Creek NERR Advisory Council. The Reserve is appreciative of the review, guidance, and council of Division of Wildlife Executive Administrator Dave Scott and the mapping expertise of Keith Lott and the late Steve Barry.
  • An Integrative Approach Sheds New Light Onto the Systematics

    An Integrative Approach Sheds New Light Onto the Systematics

    www.nature.com/scientificreports OPEN An integrative approach sheds new light onto the systematics and ecology of the widespread ciliate genus Coleps (Ciliophora, Prostomatea) Thomas Pröschold1*, Daniel Rieser1, Tatyana Darienko2, Laura Nachbaur1, Barbara Kammerlander1, Kuimei Qian1,3, Gianna Pitsch4, Estelle Patricia Bruni4,5, Zhishuai Qu6, Dominik Forster6, Cecilia Rad‑Menendez7, Thomas Posch4, Thorsten Stoeck6 & Bettina Sonntag1 Species of the genus Coleps are one of the most common planktonic ciliates in lake ecosystems. The study aimed to identify the phenotypic plasticity and genetic variability of diferent Coleps isolates from various water bodies and from culture collections. We used an integrative approach to study the strains by (i) cultivation in a suitable culture medium, (ii) screening of the morphological variability including the presence/absence of algal endosymbionts of living cells by light microscopy, (iii) sequencing of the SSU and ITS rDNA including secondary structures, (iv) assessment of their seasonal and spatial occurrence in two lakes over a one‑year cycle both from morphospecies counts and high‑ throughput sequencing (HTS), and, (v) proof of the co‑occurrence of Coleps and their endosymbiotic algae from HTS‑based network analyses in the two lakes. The Coleps strains showed a high phenotypic plasticity and low genetic variability. The algal endosymbiont in all studied strains was Micractinium conductrix and the mutualistic relationship turned out as facultative. Coleps is common in both lakes over the whole year in diferent depths and HTS has revealed that only one genotype respectively one species, C. viridis, was present in both lakes despite the diferent lifestyles (mixotrophic with green algal endosymbionts or heterotrophic without algae).
  • The Plankton Lifeform Extraction Tool: a Digital Tool to Increase The

    The Plankton Lifeform Extraction Tool: a Digital Tool to Increase The

    Discussions https://doi.org/10.5194/essd-2021-171 Earth System Preprint. Discussion started: 21 July 2021 Science c Author(s) 2021. CC BY 4.0 License. Open Access Open Data The Plankton Lifeform Extraction Tool: A digital tool to increase the discoverability and usability of plankton time-series data Clare Ostle1*, Kevin Paxman1, Carolyn A. Graves2, Mathew Arnold1, Felipe Artigas3, Angus Atkinson4, Anaïs Aubert5, Malcolm Baptie6, Beth Bear7, Jacob Bedford8, Michael Best9, Eileen 5 Bresnan10, Rachel Brittain1, Derek Broughton1, Alexandre Budria5,11, Kathryn Cook12, Michelle Devlin7, George Graham1, Nick Halliday1, Pierre Hélaouët1, Marie Johansen13, David G. Johns1, Dan Lear1, Margarita Machairopoulou10, April McKinney14, Adam Mellor14, Alex Milligan7, Sophie Pitois7, Isabelle Rombouts5, Cordula Scherer15, Paul Tett16, Claire Widdicombe4, and Abigail McQuatters-Gollop8 1 10 The Marine Biological Association (MBA), The Laboratory, Citadel Hill, Plymouth, PL1 2PB, UK. 2 Centre for Environment Fisheries and Aquacu∑lture Science (Cefas), Weymouth, UK. 3 Université du Littoral Côte d’Opale, Université de Lille, CNRS UMR 8187 LOG, Laboratoire d’Océanologie et de Géosciences, Wimereux, France. 4 Plymouth Marine Laboratory, Prospect Place, Plymouth, PL1 3DH, UK. 5 15 Muséum National d’Histoire Naturelle (MNHN), CRESCO, 38 UMS Patrinat, Dinard, France. 6 Scottish Environment Protection Agency, Angus Smith Building, Maxim 6, Parklands Avenue, Eurocentral, Holytown, North Lanarkshire ML1 4WQ, UK. 7 Centre for Environment Fisheries and Aquaculture Science (Cefas), Lowestoft, UK. 8 Marine Conservation Research Group, University of Plymouth, Drake Circus, Plymouth, PL4 8AA, UK. 9 20 The Environment Agency, Kingfisher House, Goldhay Way, Peterborough, PE4 6HL, UK. 10 Marine Scotland Science, Marine Laboratory, 375 Victoria Road, Aberdeen, AB11 9DB, UK.
  • Metagenomic Characterization of Unicellular Eukaryotes in the Urban Thessaloniki Bay

    Metagenomic Characterization of Unicellular Eukaryotes in the Urban Thessaloniki Bay

    Metagenomic characterization of unicellular eukaryotes in the urban Thessaloniki Bay George Tsipas SCHOOL OF ECONOMICS, BUSINESS ADMINISTRATION & LEGAL STUDIES A thesis submitted for the degree of Master of Science (MSc) in Bioeconomy Law, Regulation and Management May, 2019 Thessaloniki – Greece George Tsipas ’’Metagenomic characterization of unicellular eukaryotes in the urban Thessaloniki Bay’’ Student Name: George Tsipas SID: 268186037282 Supervisor: Prof. Dr. Savvas Genitsaris I hereby declare that the work submitted is mine and that where I have made use of another’s work, I have attributed the source(s) according to the Regulations set in the Student’s Handbook. May, 2019 Thessaloniki - Greece Page 2 of 63 George Tsipas ’’Metagenomic characterization of unicellular eukaryotes in the urban Thessaloniki Bay’’ 1. Abstract The present research investigates through metagenomics sequencing the unicellular protistan communities in Thermaikos Gulf. This research analyzes the diversity, composition and abundance in this marine environment. Water samples were collected monthly from April 2017 to February 2018 in the port of Thessaloniki (Harbor site, 40o 37’ 55 N, 22o 56’ 09 E). The extraction of DNA was completed as well as the sequencing was performed, before the downstream read processing and the taxonomic classification that was assigned using PR2 database. A total of 1248 Operational Taxonomic Units (OTUs) were detected but only 700 unicellular eukaryotes were analyzed, excluding unclassified OTUs, Metazoa and Streptophyta. In this research-based study the most abundant and diverse taxonomic groups were Dinoflagellata and Protalveolata. Specifically, the most abundant groups of all samples are Dinoflagellata with 190 OTUs (27.70%), Protalveolata with 139 OTUs (20.26%) Ochrophyta with 73 OTUs (10.64%), Cercozoa with 67 OTUs (9.77%) and Ciliophora with 64 OTUs (9.33%).
  • Ocean Acidification and High Irradiance Stimulate Growth of The

    Ocean Acidification and High Irradiance Stimulate Growth of The

    Biogeosciences Discuss., https://doi.org/10.5194/bg-2019-97 Manuscript under review for journal Biogeosciences Discussion started: 26 March 2019 c Author(s) 2019. CC BY 4.0 License. Ocean acidification and high irradiance stimulate growth of the Antarctic cryptophyte Geminigera cryophila Scarlett Trimborn1,2, Silke Thoms1, Pascal Karitter1, Kai Bischof2 5 1EcoTrace, Biogeosciences section, Alfred Wegener Institute, Bremerhaven, 27568, Germany 2Marine Botany, Department 2 Biology/Chemistry, University of Bremen, Bremen, 28359, Germany Correspondence to: Scarlett Trimborn ([email protected]) Abstract. Ecophysiological studies on Antarctic cryptophytes to assess whether climatic changes such as ocean acidification 10 and enhanced stratification affect their growth in Antarctic coastal waters in the future are lacking so far. This is the first study that investigated the combined effects of increasing availability of pCO2 (400 and 1000 µatm) and irradiance (20, 200 and 500 μmol photons m−2 s−1) on growth, elemental composition and photophysiology of the Antarctic cryptophyte Geminigera cryophila. Under ambient pCO2, this species was characterized by a pronounced sensitivity to increasing irradiance with complete growth inhibition at the highest light intensity. Interestingly, when 15 grown under high pCO2 this negative light effect vanished and it reached highest rates of growth and particulate organic carbon production at the highest irradiance compared to the other tested experimental conditions. Our results for G. cryophila reveal beneficial effects of ocean acidification in conjunction with enhanced irradiance on growth and photosynthesis. Hence, cryptophytes such as G. cryophila may be potential winners of climate change, potentially thriving better in more stratified and acidic coastal waters and contributing in higher abundance to future 20 phytoplankton assemblages of coastal Antarctic waters.
  • Plant Life Magill’S Encyclopedia of Science

    Plant Life Magill’S Encyclopedia of Science

    MAGILLS ENCYCLOPEDIA OF SCIENCE PLANT LIFE MAGILLS ENCYCLOPEDIA OF SCIENCE PLANT LIFE Volume 4 Sustainable Forestry–Zygomycetes Indexes Editor Bryan D. Ness, Ph.D. Pacific Union College, Department of Biology Project Editor Christina J. Moose Salem Press, Inc. Pasadena, California Hackensack, New Jersey Editor in Chief: Dawn P. Dawson Managing Editor: Christina J. Moose Photograph Editor: Philip Bader Manuscript Editor: Elizabeth Ferry Slocum Production Editor: Joyce I. Buchea Assistant Editor: Andrea E. Miller Page Design and Graphics: James Hutson Research Supervisor: Jeffry Jensen Layout: William Zimmerman Acquisitions Editor: Mark Rehn Illustrator: Kimberly L. Dawson Kurnizki Copyright © 2003, by Salem Press, Inc. All rights in this book are reserved. No part of this work may be used or reproduced in any manner what- soever or transmitted in any form or by any means, electronic or mechanical, including photocopy,recording, or any information storage and retrieval system, without written permission from the copyright owner except in the case of brief quotations embodied in critical articles and reviews. For information address the publisher, Salem Press, Inc., P.O. Box 50062, Pasadena, California 91115. Some of the updated and revised essays in this work originally appeared in Magill’s Survey of Science: Life Science (1991), Magill’s Survey of Science: Life Science, Supplement (1998), Natural Resources (1998), Encyclopedia of Genetics (1999), Encyclopedia of Environmental Issues (2000), World Geography (2001), and Earth Science (2001). ∞ The paper used in these volumes conforms to the American National Standard for Permanence of Paper for Printed Library Materials, Z39.48-1992 (R1997). Library of Congress Cataloging-in-Publication Data Magill’s encyclopedia of science : plant life / edited by Bryan D.
  • Fig.S1. the Pairwise Aligments of High Scoring Pairs of Recognizable Pseudogenes

    Fig.S1. the Pairwise Aligments of High Scoring Pairs of Recognizable Pseudogenes

    LysR transcriptional regulator Identities = 57/164 (35%), Positives = 82/164 (50%), Gaps = 13/164 (8%) 70530- SNQAIKTYLMPK*LRLLRQK*SPVEFQLQVHLIKKIRLNIVIRDINLTIIEN-TPVKLKI -70354 ++Q TYLMP+ + L RQK V QLQVH ++I ++ INL II P++LK 86251- ASQTTGTYLMPRLIGLFRQKYPQVAVQLQVHSTRRIAWSVANGHINLAIIGGEVPIELKN -86072 70353- FYTLLRMKERI*H*YCLGFL------FQFLIAYKKKNLYGLRLIKVDIPFPIRGIMNNP* -70192 + E L + F L + +K++LY LR I +D IR +++ 86071- MLQVTSYAED-----ELALILPKSHPFSMLRSIQKEDLYRLRFIALDRQSTIRKVIDKVL -85907 70191- IKTELIPRNLN-EMELSLFKPIKNAV*PGLNVTLIFVSAIAKEL -70063 + + EMEL+ + IKNAV GL + VSAIAKEL 85906- NQNGIDSTRFKIEMELNSVEAIKNAVQSGLGAAFVSVSAIAKEL -85775 ycf3 Photosystem I assembly protein Identities = 25/59 (42%), Positives = 39/59 (66%), Gaps = 3/59 (5%) 19162- NRSYML-SIQCM-PNNSDYVNTLKHCR*ALDLSSKL-LAIRNVTISYYCQDIIFSEKKD -19329 +RSY+L +I + +N +YV L++ ALDL+S+L AI N+ + Y+ Q + SEKKD 19583- DRSYILYNIGLIYASNGEYVKALEYYHQALDLNSRLPPAINNIAVIYHYQGVKASEKKD -19759 Fig.S1. The pairwise aligments of high scoring pairs of recognizable pseudogenes. The upper amino acid sequences indicates Cryptomonas sp. SAG977-2f. The lower sequences are corresponding amino acid sequences of homologs in C. curvata CCAP979/52. Table S1. Presence/absence of protein genes in the plastid genomes of Cryptomonas and representative species of Cryptomonadales. Note; y indicates pseudogenes. Photosynthetic Non-Photosynthetic Guillardia Rhodomonas Cryptomonas C. C. curvata C. curvata parameciu Guillardia Rhodomonas FBCC300 CCAP979/ SAG977 CCAC1634 m theta salina -2f B 012D 52 CCAP977/2 a rps2 + + + +
  • Biovolumes and Size-Classes of Phytoplankton in the Baltic Sea

    Biovolumes and Size-Classes of Phytoplankton in the Baltic Sea

    Baltic Sea Environment Proceedings No.106 Biovolumes and Size-Classes of Phytoplankton in the Baltic Sea Helsinki Commission Baltic Marine Environment Protection Commission Baltic Sea Environment Proceedings No. 106 Biovolumes and size-classes of phytoplankton in the Baltic Sea Helsinki Commission Baltic Marine Environment Protection Commission Authors: Irina Olenina, Centre of Marine Research, Taikos str 26, LT-91149, Klaipeda, Lithuania Susanna Hajdu, Dept. of Systems Ecology, Stockholm University, SE-106 91 Stockholm, Sweden Lars Edler, SMHI, Ocean. Services, Nya Varvet 31, SE-426 71 V. Frölunda, Sweden Agneta Andersson, Dept of Ecology and Environmental Science, Umeå University, SE-901 87 Umeå, Sweden, Umeå Marine Sciences Centre, Umeå University, SE-910 20 Hörnefors, Sweden Norbert Wasmund, Baltic Sea Research Institute, Seestr. 15, D-18119 Warnemünde, Germany Susanne Busch, Baltic Sea Research Institute, Seestr. 15, D-18119 Warnemünde, Germany Jeanette Göbel, Environmental Protection Agency (LANU), Hamburger Chaussee 25, D-24220 Flintbek, Germany Slawomira Gromisz, Sea Fisheries Institute, Kollataja 1, 81-332, Gdynia, Poland Siv Huseby, Umeå Marine Sciences Centre, Umeå University, SE-910 20 Hörnefors, Sweden Maija Huttunen, Finnish Institute of Marine Research, Lyypekinkuja 3A, P.O. Box 33, FIN-00931 Helsinki, Finland Andres Jaanus, Estonian Marine Institute, Mäealuse 10 a, 12618 Tallinn, Estonia Pirkko Kokkonen, Finnish Environment Institute, P.O. Box 140, FIN-00251 Helsinki, Finland Iveta Ledaine, Inst. of Aquatic Ecology, Marine Monitoring Center, University of Latvia, Daugavgrivas str. 8, Latvia Elzbieta Niemkiewicz, Maritime Institute in Gdansk, Laboratory of Ecology, Dlugi Targ 41/42, 80-830, Gdansk, Poland All photographs by Finnish Institute of Marine Research (FIMR) Cover photo: Aphanizomenon flos-aquae For bibliographic purposes this document should be cited to as: Olenina, I., Hajdu, S., Edler, L., Andersson, A., Wasmund, N., Busch, S., Göbel, J., Gromisz, S., Huseby, S., Huttunen, M., Jaanus, A., Kokkonen, P., Ledaine, I.
  • 1 Specific Eukaryotic Plankton Are Good Predictors of Net

    1 Specific Eukaryotic Plankton Are Good Predictors of Net

    Specific eukaryotic plankton are good predictors of net community production in the Western Antarctic Peninsula Yajuan Lin, Nicolas Cassar, Adrian Marchetti, Carly Moreno, Hugh Ducklow & Zuchuan Li Supplementary figures and tables; Supplementary Figure S1 Chlorophyll concentration Supplementary Figure S2 Relative abundance (%) of OTU 4 Supplementary Figure S3 Empirical relationship of POC and Chlorophyll Supplementary Figure S4 Monthly averaged sea ice coverage for Jan 2014 Supplementary Table S1 Correlations of 18S taxonomy at higher level (Phylum to Division) versus NCP and NCP/POC Supplementary Table S2 Stochastic search variable selection (SSVS) Supplementary Table S3 Stepwise regression based on AICc for selection of OTUs best predictors of NCP and NCP/POC Supplementary Table S4 Taxonomy assignments of the representative sequences from the top 20 OTUs Supplementary Table S5 SSVS with station 600.40 removed 1 ) 1 - Chl (µg Chl (µg L Supplementary Figure S1: Chlorophyll concentration. Map created with Ocean Data View version 4.6.3.1 (Schlitzer, R., Ocean Data View, http://odv.awi.de, 2015). 2 OTU4 (Fragilariopsis) Supplementary Figure S2: Relative abundance (%) of OTU 4. OTU 4 (Fragilariopsis) is the most dominant OTU. Map created with Ocean Data View version 4.6.3.1 (Schlitzer, R., Ocean Data View, http://odv.awi.de, 2015). 3 2000 1600 y = 59.147x + 102.14 ) R² = 0.8932 3 - 1200 800 POC (mgm POC 400 0 0 10 20 30 Chl (mg m-3) Supplementary Figure S3: Empirical relationship of POC and Chlorophyll. The relationship is derived from Palmer LTER annual cruise data 2008 – 2011 (n = 93). 4 Supplementary Figure S4: Monthly averaged sea ice coverage for Jan 2014.