DOCSLIB.ORG

(12) Patent Application Publication (10) Pub. No.: US 2005/0221455A1 Mcfarlan Et Al

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
(12) Patent Application Publication (10) Pub. No.: US 2005/0221455A1 Mcfarlan Et Al US 2005O221455A1 (19) United States (12) Patent Application Publication (10) Pub. No.: US 2005/0221455A1 McFarlan et al. (43) Pub. Date: Oct. 6, 2005 (54) PRODUCTION OF MONATIN AND Related U.S. Application Data MONATIN PRECURSORS (60) Provisional application No. 60/513,406, filed on Oct. (75) Inventors: Sara C. McFarlan, St. Paul, MN (US); 21, 2003. Paula M. Hicks, Eden Prairie, MN (US); Mary Jo Zidwick, Wayzata, MN Publication Classification (US); Fernando A. Sanchez-Riera, Eden Prairie, MN (US); Douglas C. 51)1) Int. Cl.Cl." .............................. C12P 17/107/10; C12N 1/21 Cameron, Plymouth, MN (US); Mervyn L. deSouza, Plymouth, MN (52) U.S. Cl. .................. 435/121; 435/252.3; 435/252.33 (US); John Rosazza, Iowa City, IA (US); Steven J. Gort, Brooklyn Center, MN (US); Timothy W. Abraham, Minnetonka, MN (US) (57) ABSTRACT Correspondence Address: CARGILL, INCORPORATED Methods and compositions that can be used to make monatin LAW/24 or Salt thereof from glucose, tryptophan, indole-3-lactic 15407 MCGINTY ROAD WEST acid, indole-3-pyruvate, and 2-hydroxy 2-(indol-3-ylm ethyl)-4-ketoglutaric acid, are provided. Methods are also WAYZATA, MN 55391 (US) disclosed for producing the indole-3-pyruvate and 2-hy (73) Assignee: CARGILL, INC. droxy 2-(indol-3-ylmethyl)-4-keto glutaric acid intermedi ates. Compositions provided include nucleic acid molecules, (21) Appl. No.: 10/969,245 polypeptides, chemical Structures, and cells. Methods include in vitro and in Vivo processes, and the in Vitro (22) Filed: Oct. 21, 2004 methods include chemical reactions. -- st Tryptophan Indole-3-lactic acid PLP and amino acceptor or NAD(P) or HO and O, and FAD NAD(P) or HO and O, and FMN Indole-3-pyruvate -- C3 molecule +PLP 2-hydroxy 2-(indol-3-ylmethyl)-4-keto glutaric acid (MP) PLP and amino donor or NAD(P)H +NH3 Patent Application Publication Oct. 6, 2005 Sheet 1 of 13 US 2005/0221455A1 -- - Tryptophan Indole-3-lactic acid PLP and amino acceptor or NAD(P) or HO and O, and FAD NAD(P) or HO and O, and FMN Indole-3-pyruvate + C3 molecule +PLP 2-hydroxy 2-(indol-3-ylmethyl)-4-keto glutaric acid (MP) PLP and amino donor or NAD(P)H +NH3 F.G. 1 Patent Application Publication Oct. 6, 2005 Sheet 2 of 13 US 2005/0221455A1 U.S. Patent No. 4,371,614 Tryptophan EC 2.6.1.27 tryptophan aminotransferase EC 2.6.1.5 tyrosine (aromatic) aminotransferase EC 1.4.1.19 tryptophan dehydrogenase EC 1.4.1.2-4 glutamate dehydrogenase EC 1.4.1.20 phenylalanine dehydrogenase EC 2.6.1.28 tryptophan-phenylpyruvate transaminase EC 2.6.1.- multiple substrate aminotransferase EC 2.6.1.1 aspartate aminotransferase EC 1.4.3.2 L-amino acid oxidase tryptophan oxidase (no EC number) D-tryptophan aminotransferase (no EC number) EC 1.4.99.1 D-amino acid dehydrogenase EC 1.4.3.3 D-amino acid oxidase EC 2.6.1.21 D-alanine aminotransferase Indole-3-pyruvate EC 4.1.3.-, 4.1.2.-lyase, synthase EC 4.1.3.16 4-Hydroxy-2-oxoglutarate glyoxylate-lyase EC 4.1.3.17 4-Hydroxy-4-methyl-2-oxoglutarate pyruvate-lyase Chemical aldol condensation 2-hydroxy 2-(indol-3-ylmethyl)-4-ketoglutaric acid EC 2.6.1.27 tryptophan aminotransferase EC 2.6.1.5 tyrosine (aromatic) aminotransferase EC 1.4.1.19 tryptophan dehydrogenase EC 2.6.1.28 tryptophan-phenylpyruvate transaminase EC 2.6.1.- multiple substrate aminotransferase EC 2.6.1.1 aspartate aminotransferase EC 1.4.1.2-4 glutamate dehydrogenase EC 1.4.1.20 phenylalanine dehydrogenase EC 1.4.99.1 D-amino acid dehydrogenase EC 2.6.1.21 D-alanine aminotransferase D-tryptophan aminotransferase (no EC number) Monatin Patent Application Publication Oct. 6, 2005 Sheet 3 of 13 US 2005/0221455A1 FIG 3 Indole-3-lactic acid EC 1.1.1.110 indolelactate dehydrogenase EC 1.1.1.222 R-4-hydroxyphenylactate dehydrogenase EC 1.1.1.2373-(4)-hydroxyphenylpyruvate reductase EC 1.1.1.27, 1.1.1.28, 1.1.2.3 lactate dehydrogenase EC 1.1.1.111 (3-imidazol-5-yl) lactate dehydrogenase EC 1.1.3.- lactate oxidase Chemical oxidation Indole-3-pyruvate FIG. 4 COOR 2 O COOR O -'s s -COOR; COOR N -a-a-a- \ OH O N N Enolate chemistry R R R=Boc, Cbz, etc. R2 and R3 = Alkyl, Aryl, etc. Patent Application Publication Oct. 6, 2005 Sheet 4 of 13 US 2005/0221455A1 FIG. 5A gigo? O 4. 8 12 6 2O 24 Time (min) F.G. 6 OO 293 5 O l5O 2OO 25O 3OO 350 4OO n/z Patent Application Publication Oct. 6, 2005 Sheet 5 of 13 US 2005/0221455A1 FIG 7A 08-Apr-2002 l OO 15:11:01 5 O O 4. 8 12 6 2O 24 Time (min) 9 OO 2 B 68 te O O. 58 9 50 13O g 74 229 r 2ll 22 \so 257 e. O-H-III. Til. II . -. E - OO . 50 2OO 250 3OO nz FG. 8 +TOF MS: 124 MCA scans from Sample 7 (293jd with Tryptophan) of carO709a.wif... Max. 9,3e4 counts, a=3569708085.37750280e-004, to= -1.246268795.8835 1580e--002 R; 2931144 90e 4 8.0e 4 We 4 Cargill Sample Sample 293 with Tryptophan as Internal Std S.Oe 4 She 4 4,0e 4 3.Oe4 2.Oe4 2.94121) 1.0e4 0. 234 28s 288 29 2S2 294 29s 298 miz, an Patent Application Publication Oct. 6, 2005 Sheet 6 of 13 US 2005/0221455A1 WB3A2 10-Jul-2002 13:11:33 22a 1. Scal is O FG. 9A Y 1228 oria, : Scan ES 1. FG. 9B 124e25 ori O23a 1: ScarES O of FG. 9C O Time 2OO 4D 6. BOO 1.O 12. 40 1. B.OO 2O, 22. 24 FIG 10 1.4OE-05 1.2OE-05 1.OOE-05 8.OOE-04 6.OOE-04 4.OOE+04 2.OOE-04 O.OOE+OO 4hr 24hr 24hr 48hr 48hr 70hr 70hr -2.OOE-04 (-) (+) () (+) () (+) -4.OOE-04 Time Patent Application Publication Oct. 6, 2005 Sheet 7 of 13 US 2005/0221455A1 FIG 11 tryptophan tryptophan oxidase Or (, O s catalase amino acid Oxidase HO indole-3-pyruvate pyruvate ProA aldolase monatin precursor (MP) aspartate 2 aspartate aminOtranSferaSefe Ny Oxaloacetate monatin v Oxaloacetate \ decarboxylase 3. pyruvate + CO Patent Application Publication Oct. 6, 2005 Sheet 8 of 13 US 2005/0221455A1 F.G. 12 tryptophan tryptophan oxidase or O catalase amino acid oxidase I HO indole-3-pyruvate pyruvate ProA aldolase monatin precursor (MP) lysine lysine &-aminotransferaseAf 7 Ny allysineh monat1n \spontaneous, - H20 1 -Piperideine 6-carboxylate Patent Application Publication Oct. 6, 2005 Sheet 9 of 13 US 2005/0221455A1 F.G. 13 tryptophan O tryptophan oxidase catalase or amino acid oxidase H.O. indole-3-pyruvate pyruvate ProA aldolase monatin precursor (MP) CO 2 dehydrogenase a NADH (reductive amination) > NAD (9/ monat1n / Formate dehydrogenase ammonium formate Patent Application Publication Oct. 6, 2005 Sheet 10 of 13 US 2005/0221455 A1 FIG. 14 Pyruvate production by E. coli strains 2YT media + lipoate 1 0.6 0.5 S bySY S.w bySY N. b wa in SYY SC bySY wa GS9) & &SS. Qss 2NN SS. QSS- A& $SS. M s SS2 M s sa 24 hr growth 48 hr growth Patent Application Publication Oct. 6, 2005 Sheet 11 of 13 US 2005/0221455A1 FIG. 15 g/L pyruvate divided by OD600 C d So So So So do O - a N C N CU O N OO 7692 7692 (DE3) O Va. 7692 lipA C 7692 lipA (DE3) D BW251 13 O in C BW25113 lipA- 8 C. S. BW25113 lipA (DE3) to 7692 e MC a 7692 (DE3) (D 7692 lipA- o sm 7692 lipA (DE3) 3. 8 BW25113 ass 2. 9 BW25113 lipA O s BW25113 lipA (DE3) S S O 7692 C O 7692 (DE3) () 7692 lipA d 7692 lipA (DE3) BW 25113 BW251 13 lipA BW251 13 lipA- (DE3) Patent Application Publication Oct. 6, 2005 Sheet 12 of 13 US 2005/0221455A1 FIG. 16 ATGTACGAACTGGGAGTTGTCTACCGCAATATCCAGCGCGCCGACCGCGC TGCTGCTGACGGCCTGGCCGCCCTGGGCTCCGCCACCGTGCACGAGGCCA TGGGCCGCGTCGGTCTGCTCAAGCCCTATATGCGCCCCATCTATGCCGGCA AGCAGGTCTCGGGCACCGCCGTCACGGTGCTGCTGCAGCCCGGCGACAAC TGGATGATGCATGTGGCTGCCGAGCAGATTCAGCCCGGCGACATCGTGGT CGCAGCCGTCACCGCAGAGTGCACCGACGGCTACTTCGGCGATCTGCTGG CCACCAGCTTCCAGGCGCGCGGCGCACGTGCGCTGATCATCGATGCCGGC GTGCGCGACGTGAAGACGCTGCAGGAGATGGACTTTCCGGTCTGGAGCAA GGCCATCTCTTCCAAGGGCACGATCAAGGCCACCCTGGGCTCGGTCA ACA TCCCCATCGTCTGCGCCGGCATGCTGGTCACGCCCGGTGACGTGATCGTGG CCGACGACGACGGCGTGGTCTGCGTGCCCGCCGCGCGTGCCGTGGAAGTG CTGGCCGCCGCCCAGAAGCGTGAAAGCTTCGAAGGCGAAAAGCGCGCCA AGCTGGCCTCGGGCATCCTCGGCCTGGATATGTACAAGATGCGCGAGCCC CTGGAAAAGGCCGGCCTGAAATATATTGACTAA Patent Application Publication Oct. 6, 2005 Sheet 13 of 13 US 2005/0221455 A1 - FIG. 17 MYELGVVYRNIQRADRAAADGLAALGSATVHEAMGRVGLLKPYMRPIYAG KQVSGTAVTVLLQPGDNWMMHVAAEQIQPGDIVVAAVTAECTDGYFGDLL ATSFQARGARALIIDAGVRDVKTLOEMDFPVWSKAISSKGTIKATLGSVNIPIV CAGMLVTPGDVIVADDDGVVCVPAARAVEVLAAAQKRESFEGEKRAKLASG ILGLDMYKMREPLEKAGLKYD US 2005/0221455 A1 Oct. 6, 2005 PRODUCTION OF MONATIN AND MONATIN pentanedioic acid, or alternatively, based on an alternate PRECURSORS numbering System, 4-hydroxy-4-(3-indolylmethyl)glutamic 0001. This application claims priority of U.S. provisional acid), a compound having the formula: patent application No. 60/513,406, filed Oct. 21, 2003, which is incorporated herein by reference for all purposes. TECHNICAL FIELD 0002 This disclosure provides methods and materials that are useful in the production of indole-3-pyruvate, 2-hy droxy 2-(indol-3ylmethyl)-4-ketoglutaric acid and/or mona tin. BACKGROUND 0.003 Indole-3-pyruvate is a strong antioxidant that is believed to counter act oxidative StreSS in tissues with high 0007 Monatin also has the following chemical names: oxygen concentrations (Politi et al. “Recent advances in 3-(1-amino-1,3-dicarboxy-3-hydroxy-but-4-yl)-indole; Tryptophan Research', edited by G. A. Filippini et al. 4-(indole-3-ylmethyl)-4-hydroxy-glutamic acid; and 3-(1- Plenum Press, New York, 1996, pp. 291-8). Indole pyruvate amino-1,3-dicarboxy-3-hydroxybutane-4-yl)-indole. also is an intermediate in a pathway to produce indole-acetic acid (IAA), the primary plant growth hormone auxin (dif 0008 Monatin is a naturally-occurring, high intensity fusible growth promoting factor).
Load more

Recommended publications
  • Tryptophan Catabolism During Sporulation in Bacillus Cereus. Chandan Prasad Louisiana State University and Agricultural & Mechanical College
    Louisiana State University LSU Digital Commons LSU Historical Dissertations and Theses Graduate School 1970 Tryptophan Catabolism During Sporulation in Bacillus Cereus. Chandan Prasad Louisiana State University and Agricultural & Mechanical College Follow this and additional works at: https://digitalcommons.lsu.edu/gradschool_disstheses Recommended Citation Prasad, Chandan, "Tryptophan Catabolism During Sporulation in Bacillus Cereus." (1970). LSU Historical Dissertations and Theses. 1804. https://digitalcommons.lsu.edu/gradschool_disstheses/1804 This Dissertation is brought to you for free and open access by the Graduate School at LSU Digital Commons. It has been accepted for inclusion in LSU Historical Dissertations and Theses by an authorized administrator of LSU Digital Commons. For more information, please contact [email protected]. 71 - 34-36 PRASAD, Chandan, 1942- TRYPTOPHAN CATABOLISM DURING SPORULATION IN BACILLUS CEREUS. The Louisiana State University and Agricultural and Mechanical College, Ph.D., 1970 Microbiology University Microfilms, Inc., Ann Arbor, Michigan THIS DISSERTATION HAS BEEN MICROFILMED EXACTLY AS RECEIVED Tryptophan Catabolism During Sporulation in Bacillus cereus A Dissertation Submitted to the Graduate Faculty of the Louisiana State University and Agricultural and Mechanical College in partial fulfillment of the requirements for the degree of Doctor of Philosophy in The Department of Microbiology by Chandan Prasad B. Sc. (Hons.) U. P. Agricultural University, India, 1964 M. Sc. U. P. Agricultural University, India, 1966 May, 1970 ACKNOWLEDGME NTS The author wishes to express his appreciation to the staff and faculty members of the Department of Microbiology, who in their own ways contri­ buted to the progress of this work. It is with great pleasure that acknowledgment is made to Dr.
    [Show full text]
  • Clostridium Sporogenes
    (R)-Indolelactyl-CoA dehydratase, the key enzyme of tryptophan reduction to indolepropionate in Clostridium sporogenes Dissertation zur Erlangung des Doktorgrades der Naturwissenschaften (Dr. rer. Nat.) dem Fachbereich Biologie der Philipps-Universität Marburg vorgelegt von Diplom-Chemikerin Huan Li aus JiLin VR. China Marburg/Lahn, 2014 Die Untersuchungen zur vorliegenden Arbeit wurden von September 2010 bis Dezember 2013 im Max-Planck-Institut für terrestrische Mikrobiologie, Marburg und im Laboratorium für Mikrobiologie, Fachbereich Biologie, der Philipps-Universität Marburg (Hochschulkennziffer: 1180) unter der Leitung von Prof. Dr. Wolfgang Buckel durchgeführt. Vom Fachbereich Biologie der Philipps-Universität Marburg als Dissertation am angenommen. Erstgutachter: Prof. Dr. Wolfgang Buckel Zweitgutachter: Prof. Dr. Johann Heider Tag der mündlichen Prüfung am: Für den gläubigen Menschen steht Gott am Anfang, für den Wissenschaftler am Ende aller seiner Überlegungen. Max Planck 献给最亲爱的爸爸妈妈 Index Zusammenfassung 1 Summary 2 Introduction 3 1. The role of gastrointestinal microbiota metabolites ........................................................... 3 2. Fermentation of amino acids and Stickland-reaction ......................................................... 5 3. Clostridium sporogenes ........................................................................................................... 7 4. 2-Hydroxyacyl-CoA dehydratases and the unusual radical H2O-elimination ................. 9 5. Family Ш CoA-transferases ...............................................................................................
    [Show full text]
  • Tryptophan Catabolism by Lactobacillus Spp. : Biochemistry and Implications on Flavor Development in Reduced-Fat Cheddar Cheese
    Utah State University DigitalCommons@USU All Graduate Theses and Dissertations Graduate Studies 5-1998 Tryptophan Catabolism by Lactobacillus spp. : Biochemistry and Implications on Flavor Development in Reduced-Fat Cheddar Cheese Sanjay Gummalla Utah State University Follow this and additional works at: https://digitalcommons.usu.edu/etd Part of the Food Chemistry Commons, Food Microbiology Commons, and the Food Processing Commons Recommended Citation Gummalla, Sanjay, "Tryptophan Catabolism by Lactobacillus spp. : Biochemistry and Implications on Flavor Development in Reduced-Fat Cheddar Cheese" (1998). All Graduate Theses and Dissertations. 5454. https://digitalcommons.usu.edu/etd/5454 This Thesis is brought to you for free and open access by the Graduate Studies at DigitalCommons@USU. It has been accepted for inclusion in All Graduate Theses and Dissertations by an authorized administrator of DigitalCommons@USU. For more information, please contact [email protected]. TRYPTOPHAN CATABOLISM BY LACTOBACILLUS SPP.: BIOCHEMISTRY AND IMPLICATIONS ON FLAVOR DEVELOPMENT IN REDUCED-FAT CHEDDAR CHEESE by Sanjay Gummalla A thesis submitted in partial fulfillment of the requirements for the degree of MASTER OF SCIENCE m Nutrition and Food Sciences Approved: UTAH STATE UNIVERSITY Logan, Utah 1998 11 Copyright © Sanjay Gummalla 1998 All Rights Reserved w ABSTRACT Tryptophan Catabolism by Lactobacillus spp. : Biochemistry and Implications on Flavor Development in Reduced-Fat Cheddar Cheese by Sanjay Gummalla, Master of Science Utah State University, 1998 Major Professor: Dr. Jeffery R. Broadbent Department: Nutrition and Food Sciences Amino acids derived from the degradation of casein in cheese serve as precursors for the generation of key flavor compounds. Microbial degradation of tryptophan (Trp) is thought to promote formation of aromatic compounds that impart putrid fecal or unclean flavors in cheese, but pathways for their production have not been established.
    [Show full text]
  • Mice Carrying a Human GLUD2 Gene Recapitulate Aspects of Human Transcriptome and Metabolome Development
    Mice carrying a human GLUD2 gene recapitulate aspects of human transcriptome and metabolome development Qian Lia,b,1, Song Guoa,1, Xi Jianga, Jaroslaw Brykc,2, Ronald Naumannd, Wolfgang Enardc,3, Masaru Tomitae, Masahiro Sugimotoe, Philipp Khaitovicha,c,f,4, and Svante Pääboc,4 aChinese Academy of Sciences Key Laboratory of Computational Biology, Chinese Academy of Sciences-Max Planck Partner Institute for Computational Biology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 200031 Shanghai, China; bUniversity of Chinese Academy of Sciences, 100049 Beijing, China; cMax Planck Institute for Evolutionary Anthropology, 04103 Leipzig, Germany; dMax Planck Institute of Molecular Cell Biology and Genetics, D-01307 Dresden, Germany; eInstitute for Advanced Biosciences, Keio University, 997-0035 Tsuruoka, Yamagata, Japan; and fSkolkovo Institute for Science and Technology, 143025 Skolkovo, Russia Edited by Joshua M. Akey, University of Washington, Seattle, WA, and accepted by the Editorial Board April 1, 2016 (received for review September 28, 2015) Whereas all mammals have one glutamate dehydrogenase gene metabolic flux from glucose and glutamine to lipids by way of the (GLUD1), humans and apes carry an additional gene (GLUD2), TCA cycle (12). which encodes an enzyme with distinct biochemical properties. To investigate the physiological role the GLUD2 gene may We inserted a bacterial artificial chromosome containing the human play in human and ape brains, we generated mice transgenic for GLUD2. GLUD2 gene into mice and analyzed the resulting changes in the a genomic region containing human We compared effects transcriptome and metabolome during postnatal brain development. on gene expression and metabolism during postnatal development Effects were most pronounced early postnatally, and predominantly of the frontal cortex of the brain in these mice and their wild-type genes involved in neuronal development were affected.
    [Show full text]
  • Combined Network Analysis and Machine Learning Allows the Prediction of Metabolic Pathways from Tomato Metabolomics Data
    ARTICLE https://doi.org/10.1038/s42003-019-0440-4 OPEN Combined network analysis and machine learning allows the prediction of metabolic pathways from tomato metabolomics data David Toubiana 1, Rami Puzis 2, Lingling Wen3, Noga Sikron3, Assylay Kurmanbayeva3, 1234567890():,; Aigerim Soltabayeva3, Maria del Mar Rubio Wilhelmi1, Nir Sade3,4, Aaron Fait3, Moshe Sagi3, Eduardo Blumwald 1 & Yuval Elovici2 The identification and understanding of metabolic pathways is a key aspect in crop improvement and drug design. The common approach for their detection is based on gene annotation and ontology. Correlation-based network analysis, where metabolites are arran- ged into network formation, is used as a complentary tool. Here, we demonstrate the detection of metabolic pathways based on correlation-based network analysis combined with machine-learning techniques. Metabolites of known tomato pathways, non-tomato pathways, and random sets of metabolites were mapped as subgraphs onto metabolite correlation networks of the tomato pericarp. Network features were computed for each subgraph, generating a machine-learning model. The model predicted the presence of the β-alanine- degradation-I, tryptophan-degradation-VII-via-indole-3-pyruvate (yet unknown to plants), the β-alanine-biosynthesis-III, and the melibiose-degradation pathway, although melibiose was not part of the networks. In vivo assays validated the presence of the melibiose- degradation pathway. For the remaining pathways only some of the genes encoding reg- ulatory enzymes were detected. 1 Department of Plant Sciences, University of California, Davis, CA, USA. 2 Telekom Innovation Labs, Department of Software and Information Systems Engineering, Ben-Gurion University of the Negev, Beer Sheva, Israel.
    [Show full text]
  • Characterization of Two Aromatic Amino Acid Aminotransferases and Production of Indoleacetic Acid in Azospirillum Strains
    Soil Biol. Biochem.Vol. 26, No. 1, pp. 51-63, 1994 Pergamon Copyright 0 1994 Elsevier Science Ltd Printed in Great Britain. All rights reserved 0038-0717/94$6.00 + 0.00 CHARACTERIZATION OF TWO AROMATIC AMINO ACID AMINOTRANSFERASES AND PRODUCTION OF INDOLEACETIC ACID IN AZOSPIRILLUM STRAINS B. E. BACA, L. SOTO-URZUA, Y. G. XOCHIHUA-CORONAand A. CUERVO-GARCIA Department0 de Investigaciones Microbiologicas, Instituto de Ciencias, Universidad Autonoma de Puebla, Apartado Postal 1622, 72000 Puebla Pue, Mexico (Accepted 30 May 1993) Sunnnary-Experiments were made to quantify indole-3-acetic acid (IAA) excreted by different wild type strains of Azospirilhun spp. The microorganisms produce IAA, during the late stationary growth phase and show a significant increase in IAA production when tryptophan is present in the medium. Under these conditions with the A. brusilense strain UAP 14, we observed two aromatic amino acid aminotransferases. Their enzymatic activity and electrophoretic mobility under non-denaturating conditions were character- ized using cell-free extracts. Biochemical studies showed that these two enzymes can be distinguished by their electrophoretic mobilities. These enzymes are constitutively produced and they are not repressed by tyrosine or by tyrosine plus phenlylalanine. INTRODUCTION described in Pseudomonas savastanoi and Agrobac- terium tumefaciens. In Azospirillum this process is Soil bacteria of the genus Azospirillum live in associ- poorly understood. Hartman et al. (1983) and Zim- ation with the root zones of grasses and other plants, mer et al. (1988) identified indole-3-pyruvic acid among which are the economically-important culti- (IPyA), indole-3-acetaldehyde, and IAA as the sub- vated plants maize, wheat, barley, rye, oat and rice.
    [Show full text]
  • O O2 Enzymes Available from Sigma Enzymes Available from Sigma
    COO 2.7.1.15 Ribokinase OXIDOREDUCTASES CONH2 COO 2.7.1.16 Ribulokinase 1.1.1.1 Alcohol dehydrogenase BLOOD GROUP + O O + O O 1.1.1.3 Homoserine dehydrogenase HYALURONIC ACID DERMATAN ALGINATES O-ANTIGENS STARCH GLYCOGEN CH COO N COO 2.7.1.17 Xylulokinase P GLYCOPROTEINS SUBSTANCES 2 OH N + COO 1.1.1.8 Glycerol-3-phosphate dehydrogenase Ribose -O - P - O - P - O- Adenosine(P) Ribose - O - P - O - P - O -Adenosine NICOTINATE 2.7.1.19 Phosphoribulokinase GANGLIOSIDES PEPTIDO- CH OH CH OH N 1 + COO 1.1.1.9 D-Xylulose reductase 2 2 NH .2.1 2.7.1.24 Dephospho-CoA kinase O CHITIN CHONDROITIN PECTIN INULIN CELLULOSE O O NH O O O O Ribose- P 2.4 N N RP 1.1.1.10 l-Xylulose reductase MUCINS GLYCAN 6.3.5.1 2.7.7.18 2.7.1.25 Adenylylsulfate kinase CH2OH HO Indoleacetate Indoxyl + 1.1.1.14 l-Iditol dehydrogenase L O O O Desamino-NAD Nicotinate- Quinolinate- A 2.7.1.28 Triokinase O O 1.1.1.132 HO (Auxin) NAD(P) 6.3.1.5 2.4.2.19 1.1.1.19 Glucuronate reductase CHOH - 2.4.1.68 CH3 OH OH OH nucleotide 2.7.1.30 Glycerol kinase Y - COO nucleotide 2.7.1.31 Glycerate kinase 1.1.1.21 Aldehyde reductase AcNH CHOH COO 6.3.2.7-10 2.4.1.69 O 1.2.3.7 2.4.2.19 R OPPT OH OH + 1.1.1.22 UDPglucose dehydrogenase 2.4.99.7 HO O OPPU HO 2.7.1.32 Choline kinase S CH2OH 6.3.2.13 OH OPPU CH HO CH2CH(NH3)COO HO CH CH NH HO CH2CH2NHCOCH3 CH O CH CH NHCOCH COO 1.1.1.23 Histidinol dehydrogenase OPC 2.4.1.17 3 2.4.1.29 CH CHO 2 2 2 3 2 2 3 O 2.7.1.33 Pantothenate kinase CH3CH NHAC OH OH OH LACTOSE 2 COO 1.1.1.25 Shikimate dehydrogenase A HO HO OPPG CH OH 2.7.1.34 Pantetheine kinase UDP- TDP-Rhamnose 2 NH NH NH NH N M 2.7.1.36 Mevalonate kinase 1.1.1.27 Lactate dehydrogenase HO COO- GDP- 2.4.1.21 O NH NH 4.1.1.28 2.3.1.5 2.1.1.4 1.1.1.29 Glycerate dehydrogenase C UDP-N-Ac-Muramate Iduronate OH 2.4.1.1 2.4.1.11 HO 5-Hydroxy- 5-Hydroxytryptamine N-Acetyl-serotonin N-Acetyl-5-O-methyl-serotonin Quinolinate 2.7.1.39 Homoserine kinase Mannuronate CH3 etc.
    [Show full text]
  • Role of Tryptophan-Metabolizing Microbiota in Mice Diarrhea Caused
    Zhang et al. BMC Microbiology (2020) 20:185 https://doi.org/10.1186/s12866-020-01864-x RESEARCH ARTICLE Open Access Role of tryptophan-metabolizing microbiota in mice diarrhea caused by Folium sennae extracts Chenyang Zhang1,2, Haoqing Shao1,2, Dandan Li3, Nenqun Xiao3* and Zhoujin Tan2,3* Abstract Background: Although reports have provided evidence that diarrhea caused by Folium sennae can result in intestinal microbiota diversity disorder, the intestinal bacterial characteristic and specific mechanism are still unknown. The objective of our study was to investigate the mechanism of diarrhea caused by Folium sennae, which was associated with intestinal bacterial characteristic reshaping and metabolic abnormality. Results: For the intervention of Folium sennae extracts, Chao1 index and Shannon index were statistical decreased. The Beta diversity clusters of mice interfered by Folium sennae extracts were distinctly separated from control group. Combining PPI network analysis, cytochrome P450 enzymes metabolism was the main signaling pathway of diarrhea caused by Folium sennae. Moreover, 10 bacterial flora communities had statistical significant difference with Folium sennae intervention: the abundance of Paraprevotella, Streptococcus, Epulopiscium, Sutterella and Mycoplasma increased significantly; and the abundance of Adlercreutzia, Lactobacillus, Dehalobacterium, Dorea and Oscillospira reduced significantly. Seven of the 10 intestinal microbiota communities were related to the synthesis of tryptophan derivatives, which affected the transformation of aminotryptophan into L-tryptophan, leading to abnormal tryptophan metabolism in the host. Conclusions: Folium sennae targeted cytochrome P450 3A4 to alter intestinal bacterial characteristic and intervene the tryptophan metabolism of intestinal microbiota, such as Streptococcus, Sutterella and Dorea, which could be the intestinal microecological mechanism of diarrhea caused by Folium sennae extracts.
    [Show full text]
  • Michigan State University
    ..____ LIEMRY Michigan State University ———— OVERDUE FINES: 25¢ per day per ite- RETURNING LIBRARY MATERIALS: Place in book return to remove charge from c1 rcuht1on records BRAIN IRON'IN THE RAT: DISTRIBUTION, SEX DIFFERENCES, AND EFFECTS OF SEX HORMONES By Joanna Marie Hill A DISSERTATION Submitted to Michigan State University in partial fulfillment of the requirements for the degree of DOCTOR OF PHILOSOPHY Department of Zoology 1981 ABSTRACT BRAIN IRON IN THE RAT: DISTRIBUTION, SEX DIFFERENCES, AND EFFECTS OF SEX HORMONES By Joanna Marie Hill Although the brain contains relatively large amounts of iron, and iron deficiency alters behavior, little is known about those factors which affect brain iron or the role of n J .r iron in the brain. Sex hormones are responsible for sex r’ ’7 differences in many aspects of iron metabolism throughout ,l' .3 I the body. 6// The purposes of this study were to: (l) localize iron deposits in the rat brain; (2) determine if a sex difference exists in brain iron stores; (3) determine the effects on brain iron levels of natural events in which sex hormones fluctuate (e.g. estrous cycle and pregnancy); and (4) determine if exogenous estrogen alters the effects of ovari- ectomy and castration on brain iron levels. Brain iron was localized by histochemical methods and direct measurement of iron concentrations of high-iron areas (pooled globus pallidus and substantia nigra) and lower iron areas (cortex) of the brain, as well as the serum and liver were made by spectr0photometry. This study has determined that brain iron: is unevenly distributed in the rat brain; occurs in different cellular and extracellular compartments in different parts of the Joanna Marie Hill brain; and increases with age.
    [Show full text]
  • 81975707.Pdf
    View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Elsevier - Publisher Connector Chemistry & Biology Article A One-Pot Chemoenzymatic Synthesis for the Universal Precursor of Antidiabetes and Antiviral Bis-Indolylquinones Patrick Schneider,1 Monika Weber,1 Karen Rosenberger,1 and Dirk Hoffmeister1,2,* 1 Pharmaceutical Biology and Biotechnology, Albert-Ludwigs-Universita¨ t, Stefan-Meier-Strasse 19, 79104 Freiburg, Germany 2 Present address: University of Minnesota, Plant Pathology, 1991 Upper Buford Circle, St. Paul, MN 55108, USA. *Correspondence: [email protected] DOI 10.1016/j.chembiol.2007.05.005 SUMMARY pound, this finding prompted increased interest in the bis-indolylquinones; protocols for their chemical synthesis Bis-indolylquinones represent a class of fungal were devised [7, 8]. The accepted hypothesis on bis- natural products that display antiretroviral, indolylquinone biosynthesis put forth by Arai and antidiabetes, or cytotoxic bioactivities. Recent Yamamoto [9] includes deamination of L-tryptophan to advances in Aspergillus genomic mining efforts indole-3-pyruvic acid, which feeds into a dimerization have led to the discovery of the tdiA-E-gene reaction to yield DDAQ D. This symmetric compound cluster, which is the first genetic locus dedi- represents the generic intermediate en route to numerous derivatives, including the aforementioned compounds, cated to bis-indolylquinone biosynthesis. We whose pathways diverge due to regiospecific transfers have now genetically and biochemically charac- of prenyl groups, the most prominent structural decora- terized the enzymes TdiA (bis-indolylquinone tions of bis-indolylquinones. The C- or N-prenyltransfer synthetase) and TdiD (L-tryptophan:phenylpyru- reactions may occur symmetrically or disturb molecular vate aminotransferase), which, together, symmetry by transfer of one single prenyl unit or two units confer biosynthetic abilities for didemethylas- to different acceptor positions.
    [Show full text]
  • Natural Product Biosyntheses in Cyanobacteria: a Treasure Trove of Unique Enzymes
    Natural product biosyntheses in cyanobacteria: A treasure trove of unique enzymes Jan-Christoph Kehr, Douglas Gatte Picchi and Elke Dittmann* Review Open Access Address: Beilstein J. Org. Chem. 2011, 7, 1622–1635. University of Potsdam, Institute for Biochemistry and Biology, doi:10.3762/bjoc.7.191 Karl-Liebknecht-Str. 24/25, 14476 Potsdam-Golm, Germany Received: 22 July 2011 Email: Accepted: 19 September 2011 Jan-Christoph Kehr - [email protected]; Douglas Gatte Picchi - Published: 05 December 2011 [email protected]; Elke Dittmann* - [email protected] This article is part of the Thematic Series "Biosynthesis and function of * Corresponding author secondary metabolites". Keywords: Guest Editor: J. S. Dickschat cyanobacteria; natural products; NRPS; PKS; ribosomal peptides © 2011 Kehr et al; licensee Beilstein-Institut. License and terms: see end of document. Abstract Cyanobacteria are prolific producers of natural products. Investigations into the biochemistry responsible for the formation of these compounds have revealed fascinating mechanisms that are not, or only rarely, found in other microorganisms. In this article, we survey the biosynthetic pathways of cyanobacteria isolated from freshwater, marine and terrestrial habitats. We especially empha- size modular nonribosomal peptide synthetase (NRPS) and polyketide synthase (PKS) pathways and highlight the unique enzyme mechanisms that were elucidated or can be anticipated for the individual products. We further include ribosomal natural products and UV-absorbing pigments from cyanobacteria. Mechanistic insights obtained from the biochemical studies of cyanobacterial pathways can inspire the development of concepts for the design of bioactive compounds by synthetic-biology approaches in the future. Introduction The role of cyanobacteria in natural product research Cyanobacteria flourish in diverse ecosystems and play an enor- [2] (Figure 1).
    [Show full text]
  • Production of Monatin and Monatin Precursors Herstellung Von Monatin Und Monatinvorläufer Production De Monatine Et Précurseurs De Monatine
    (19) TZZ ¥Z Z_T (11) EP 2 302 067 B1 (12) EUROPEAN PATENT SPECIFICATION (45) Date of publication and mention (51) Int Cl.: of the grant of the patent: C12P 13/04 (2006.01) C12N 9/88 (2006.01) 05.03.2014 Bulletin 2014/10 C12N 9/10 (2006.01) C12N 1/21 (2006.01) (21) Application number: 10009952.2 (22) Date of filing: 21.10.2004 (54) Production of monatin and monatin precursors Herstellung von Monatin und Monatinvorläufer Production de monatine et précurseurs de monatine (84) Designated Contracting States: • Sanchez-Riera, Fernando A. AT BE BG CH CY CZ DE DK EE ES FI FR GB GR Eden Prairie, MN 55346 (US) HU IE IT LI LU MC NL PL PT RO SE SI SK TR • Cameron, Douglas C. Plymouth, MN 55447 (US) (30) Priority: 21.10.2003 US 513406 P • Desouza, Mervyn L. Plymouth, MN 55441 (US) (43) Date of publication of application: • Rosazza, Jack 30.03.2011 Bulletin 2011/13 Iowa City, IA 55240 (US) • Gort, Steven J. (62) Document number(s) of the earlier application(s) in Brooklyn Center, MN 55429 (US) accordance with Art. 76 EPC: • Abraham, Timothy W. 04795689.1 / 1 678 313 Minnetonka, MN 55345 (US) (73) Proprietor: Cargill, Incorporated (74) Representative: Wibbelmann, Jobst Wayzata, MN 55391-5624 (US) Wuesthoff & Wuesthoff Patent- und Rechtsanwälte (72) Inventors: Schweigerstrasse 2 • McFarlan, Sara C. 81541 München (DE) St.Paul, MN 55116 (US) • Hicks, Paula M. (56) References cited: Bend, Oregon 97702 (US) WO-A-03/056026 WO-A-2005/016022 • Zidwick, Mary Jo WO-A-2005/020721 WO-A2-03/091396 Wayzata, MN 55391 (US) WO-A2-2005/014839 Note: Within nine months of the publication of the mention of the grant of the European patent in the European Patent Bulletin, any person may give notice to the European Patent Office of opposition to that patent, in accordance with the Implementing Regulations.
    [Show full text]