DOCSLIB.ORG

Rabbit Anti-Human KCNAB2 Polyclonal Antibody (DPABH-15471) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Rabbit Anti-Human KCNAB2 Polyclonal Antibody (DPABH-15471) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use Rabbit Anti-Human KCNAB2 Polyclonal antibody (DPABH-15471) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Immunogen KCNAB2 fusion protein, sequence: MYPESTTGSPARLSLRQTGSPGMIYSTRYGSPKRQLQFYRNLGKSGLRVSCLGLGTWVTFGG QITDEMAEQLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETE RGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWS SMEIMEAYSVARQFNLTPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKY DSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSV LLGASNADQLMENIGAIQVRVRGPAGQRAHPSPSPVQCILPGSSCVPGSVLGTQDAPVNHQSC APGELAFQQEQT (1-395 aa encoded by BC110351) Isotype IgG Source/Host Rabbit Species Reactivity Human, Mouse, Rat Purification Antigen affinity purification Conjugate Unconjugated Applications WB, IHC, ELISA Positive Control mouse brain tissue, HepG2 cells Format Liquid Size 50 uL; 100 uL Buffer PBS with 0.02% sodium azide and 50% glycerol pH 7.3. Preservative 0.02% Sodium Azide Storage Store at -20°C. Aliquoting is unnecessary for -20°C storage. BACKGROUND Introduction Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member alters functional properties of the KCNA4 gene product. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. Keywords KCNAB2; potassium channel, voltage gated subfamily A regulatory beta subunit 2; AKR6A5; KCNA2B; HKvbeta2; KV-BETA-2; HKvbeta2.1; HKvbeta2.2; voltage-gated potassium channel subunit beta-2; K+ channel beta-2 subunit; K(+) channel subunit beta-2; potassium channel shaker chain beta 2; potassium voltage-gated channel, shaker-related subfamily, beta member 2; GENE INFORMATION Entrez Gene ID 8514 UniProt ID A0A024R4E3 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.
Load more

Recommended publications
  • The Mineralocorticoid Receptor Leads to Increased Expression of EGFR
    www.nature.com/scientificreports OPEN The mineralocorticoid receptor leads to increased expression of EGFR and T‑type calcium channels that support HL‑1 cell hypertrophy Katharina Stroedecke1,2, Sandra Meinel1,2, Fritz Markwardt1, Udo Kloeckner1, Nicole Straetz1, Katja Quarch1, Barbara Schreier1, Michael Kopf1, Michael Gekle1 & Claudia Grossmann1* The EGF receptor (EGFR) has been extensively studied in tumor biology and recently a role in cardiovascular pathophysiology was suggested. The mineralocorticoid receptor (MR) is an important efector of the renin–angiotensin–aldosterone‑system and elicits pathophysiological efects in the cardiovascular system; however, the underlying molecular mechanisms are unclear. Our aim was to investigate the importance of EGFR for MR‑mediated cardiovascular pathophysiology because MR is known to induce EGFR expression. We identifed a SNP within the EGFR promoter that modulates MR‑induced EGFR expression. In RNA‑sequencing and qPCR experiments in heart tissue of EGFR KO and WT mice, changes in EGFR abundance led to diferential expression of cardiac ion channels, especially of the T‑type calcium channel CACNA1H. Accordingly, CACNA1H expression was increased in WT mice after in vivo MR activation by aldosterone but not in respective EGFR KO mice. Aldosterone‑ and EGF‑responsiveness of CACNA1H expression was confrmed in HL‑1 cells by Western blot and by measuring peak current density of T‑type calcium channels. Aldosterone‑induced CACNA1H protein expression could be abrogated by the EGFR inhibitor AG1478. Furthermore, inhibition of T‑type calcium channels with mibefradil or ML218 reduced diameter, volume and BNP levels in HL‑1 cells. In conclusion the MR regulates EGFR and CACNA1H expression, which has an efect on HL‑1 cell diameter, and the extent of this regulation seems to depend on the SNP‑216 (G/T) genotype.
    [Show full text]
  • Pharmacogenomics of Drug-Induced Conditions
    Pharmacogenomics of Drug-Induced Conditions Dan M. Roden, M.D. Professor of Medicine and Pharmacology Director, Oates Institute for Experimental Therapeutics Assistant Vice-Chancellor for Personalized Medicine Vanderbilt University School of Medicine !1 An “idiosyncratic” drug response AR, 78 year old male • Coronary artery disease; 13 years s/p bypass surgery • 2 days after starting dofetilide (potent IKr blocker)… No personal or family history of syncope, sudden death • KCNQ1 variant leading to R583C identified • In vitro: ↓IKs • Not found in >400 ethnically-matched controls • ∴this is likely subclinical congenital Long QT Syndrome !2 Another face of the congenital long QT syndrome !3 Father’s ECG !4 Mother’s ECG !5 9-year-old sister’s ECG !6 Family tree Aunt, cousin, niece with 402 426 syncope 462 405 439 428 (RBBB) 436 428 492 411 419 404 • One episode of syncope, age 20 • Multiple ER visits for acute allergic reactions à epinephrine without incident !7 Mother’s ECG post-exercise !8 Identifying a mutation in KCNQ1 mothersister …YI G FLGLI… …YI D FLGLI… G269D !9 Family tree Aunt, cousin, niece with 402 426 syncope 462 405 439 428 (RBBB) 436 428 492 411 419 404 Incomplete penetrance !10 Grandfather’s ECG !11 Defining the “drug-induced long QT syndrome” • Marked QT prolongation and typical pause-dependent torsades de pointes with drug challenge, both resolving with drug withdrawal • Variants: • Marked QT prolongation (e.g. >520 or 550 or 600 msec), recognized and drug withdrawn (no torsades) • pause-dependent polymorphic VT after administration
    [Show full text]
  • Expression Profiling of Ion Channel Genes Predicts Clinical Outcome in Breast Cancer
    UCSF UC San Francisco Previously Published Works Title Expression profiling of ion channel genes predicts clinical outcome in breast cancer Permalink https://escholarship.org/uc/item/1zq9j4nw Journal Molecular Cancer, 12(1) ISSN 1476-4598 Authors Ko, Jae-Hong Ko, Eun A Gu, Wanjun et al. Publication Date 2013-09-22 DOI http://dx.doi.org/10.1186/1476-4598-12-106 Peer reviewed eScholarship.org Powered by the California Digital Library University of California Ko et al. Molecular Cancer 2013, 12:106 http://www.molecular-cancer.com/content/12/1/106 RESEARCH Open Access Expression profiling of ion channel genes predicts clinical outcome in breast cancer Jae-Hong Ko1, Eun A Ko2, Wanjun Gu3, Inja Lim1, Hyoweon Bang1* and Tong Zhou4,5* Abstract Background: Ion channels play a critical role in a wide variety of biological processes, including the development of human cancer. However, the overall impact of ion channels on tumorigenicity in breast cancer remains controversial. Methods: We conduct microarray meta-analysis on 280 ion channel genes. We identify candidate ion channels that are implicated in breast cancer based on gene expression profiling. We test the relationship between the expression of ion channel genes and p53 mutation status, ER status, and histological tumor grade in the discovery cohort. A molecular signature consisting of ion channel genes (IC30) is identified by Spearman’s rank correlation test conducted between tumor grade and gene expression. A risk scoring system is developed based on IC30. We test the prognostic power of IC30 in the discovery and seven validation cohorts by both Cox proportional hazard regression and log-rank test.
    [Show full text]
  • Investigation of the Underlying Hub Genes and Molexular Pathogensis in Gastric Cancer by Integrated Bioinformatic Analyses
    bioRxiv preprint doi: https://doi.org/10.1101/2020.12.20.423656; this version posted December 22, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Investigation of the underlying hub genes and molexular pathogensis in gastric cancer by integrated bioinformatic analyses Basavaraj Vastrad1, Chanabasayya Vastrad*2 1. Department of Biochemistry, Basaveshwar College of Pharmacy, Gadag, Karnataka 582103, India. 2. Biostatistics and Bioinformatics, Chanabasava Nilaya, Bharthinagar, Dharwad 580001, Karanataka, India. * Chanabasayya Vastrad [email protected] Ph: +919480073398 Chanabasava Nilaya, Bharthinagar, Dharwad 580001 , Karanataka, India bioRxiv preprint doi: https://doi.org/10.1101/2020.12.20.423656; this version posted December 22, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Abstract The high mortality rate of gastric cancer (GC) is in part due to the absence of initial disclosure of its biomarkers. The recognition of important genes associated in GC is therefore recommended to advance clinical prognosis, diagnosis and and treatment outcomes. The current investigation used the microarray dataset GSE113255 RNA seq data from the Gene Expression Omnibus database to diagnose differentially expressed genes (DEGs). Pathway and gene ontology enrichment analyses were performed, and a proteinprotein interaction network, modules, target genes - miRNA regulatory network and target genes - TF regulatory network were constructed and analyzed. Finally, validation of hub genes was performed. The 1008 DEGs identified consisted of 505 up regulated genes and 503 down regulated genes.
    [Show full text]
  • An Advance About the Genetic Causes of Epilepsy
    E3S Web of Conferences 271, 03068 (2021) https://doi.org/10.1051/e3sconf/202127103068 ICEPE 2021 An advance about the genetic causes of epilepsy Yu Sun1, a, *, †, Licheng Lu2, b, *, †, Lanxin Li3, c, *, †, Jingbo Wang4, d, *, † 1The School of Molecular and Cellular Biology, University of Illinois at Urbana-Champaign, Urbana, IL 61801-3633, US 2High School Affiliated to Shanghai Jiao Tong University, Shanghai, 200441, China 3Applied Biology program, University of British Columbia, Vancouver, V6r3b1, Canada 4School of Chemical Machinery and Safety, Dalian University of Technology, Dalian, 116023, China †These authors contributed equally. Abstract: Human hereditary epilepsy has been found related to ion channel mutations in voltage-gated channels (Na+, K+, Ca2+, Cl-), ligand gated channels (GABA receptors), and G-protein coupled receptors, such as Mass1. In addition, some transmembrane proteins or receptor genes, including PRRT2 and nAChR, and glucose transporter genes, such as GLUT1 and SLC2A1, are also about the onset of epilepsy. The discovery of these genetic defects has contributed greatly to our understanding of the pathology of epilepsy. This review focuses on introducing and summarizing epilepsy-associated genes and related findings in recent decades, pointing out related mutant genes that need to be further studied in the future. 1 Introduction Epilepsy is a neurological disorder characterized by 2 Malfunction of Ion channel epileptic seizures caused by abnormal brain activity. 1 in Functional variation in voltage or ligand-gated ion 100 (50 million people) people are affected by symptoms channel mutations is a major cause of idiopathic epilepsy, of this disorder worldwide, with men, young children, and especially in rare genetic forms.
    [Show full text]
  • Genomics Analysis of Potassium Channel Genes in Songbirds Reveals
    Lovell et al. BMC Genomics 2013, 14:470 http://www.biomedcentral.com/1471-2164/14/470 RESEARCH ARTICLE Open Access Genomics analysis of potassium channel genes in songbirds reveals molecular specializations of brain circuits for the maintenance and production of learned vocalizations Peter V Lovell, Julia B Carleton and Claudio V Mello* Abstract Background: A fundamental question in molecular neurobiology is how genes that determine basic neuronal properties shape the functional organization of brain circuits underlying complex learned behaviors. Given the growing availability of complete vertebrate genomes, comparative genomics represents a promising approach to address this question. Here we used genomics and molecular approaches to study how ion channel genes influence the properties of the brain circuitry that regulates birdsong, a learned vocal behavior with important similarities to human speech acquisition. We focused on potassium (K-)Channels, which are major determinants of neuronal cell excitability. Starting with the human gene set of K-Channels, we used cross-species mRNA/protein alignments, and syntenic analysis to define the full complement of orthologs, paralogs, allelic variants, as well as novel loci not previously predicted in the genome of zebra finch (Taeniopygia guttata). We also compared protein coding domains in chicken and zebra finch orthologs to identify genes under positive selective pressure, and those that contained lineage-specific insertions/deletions in functional domains. Finally, we conducted comprehensive in situ hybridizations to determine the extent of brain expression, and identify K-Channel gene enrichments in nuclei of the avian song system. Results: We identified 107 K-Channel finch genes, including 6 novel genes common to non-mammalian vertebrate lineages.
    [Show full text]
  • Dimethylation of Histone 3 Lysine 9 Is Sensitive to the Epileptic Activity
    1368 MOLECULAR MEDICINE REPORTS 17: 1368-1374, 2018 Dimethylation of Histone 3 Lysine 9 is sensitive to the epileptic activity, and affects the transcriptional regulation of the potassium channel Kcnj10 gene in epileptic rats SHAO-PING ZHANG1,2*, MAN ZHANG1*, HONG TAO1, YAN LUO1, TAO HE3, CHUN-HUI WANG3, XIAO-CHENG LI3, LING CHEN1,3, LIN-NA ZHANG1, TAO SUN2 and QI-KUAN HU1-3 1Department of Physiology; 2Ningxia Key Laboratory of Cerebrocranial Diseases, Incubation Base of National Key Laboratory, Ningxia Medical University; 3General Hospital of Ningxia Medical University, Yinchuan, Ningxia 750004, P.R. China Received February 18, 2017; Accepted September 13, 2017 DOI: 10.3892/mmr.2017.7942 Abstract. Potassium channels can be affected by epileptic G9a by 2-(Hexahydro-4-methyl-1H-1,4-diazepin-1-yl)-6,7-di- seizures and serve a crucial role in the pathophysiology of methoxy-N-(1-(phenyl-methyl)-4-piperidinyl)-4-quinazolinamine epilepsy. Dimethylation of histone 3 lysine 9 (H3K9me2) and tri-hydrochloride hydrate (bix01294) resulted in upregulation its enzyme euchromatic histone-lysine N-methyltransferase 2 of the expression of Kir4.1 proteins. The present study demon- (G9a) are the major epigenetic modulators and are associated strated that H3K9me2 and G9a are sensitive to epileptic seizure with gene silencing. Insight into whether H3K9me2 and G9a activity during the acute phase of epilepsy and can affect the can respond to epileptic seizures and regulate expression of transcriptional regulation of the Kcnj10 channel. genes encoding potassium channels is the main purpose of the present study. A total of 16 subtypes of potassium channel Introduction genes in pilocarpine-modelled epileptic rats were screened by reverse transcription-quantitative polymerase chain reac- Epilepsies are disorders of neuronal excitability, characterized tion, and it was determined that the expression ATP-sensitive by spontaneous and recurrent seizures.
    [Show full text]
  • Single Cell Transcriptomics in Schizophrenia Postmortem Brain: Moving Beyond Bulk Lysate
    SINGLE CELL TRANSCRIPTOMICS IN SCHIZOPHRENIA POSTMORTEM BRAIN: MOVING BEYOND BULK LYSATE Richard Crist June 8th, 2020 Schizophrenia Transcriptomics ■ Microarray and RNA sequencing ■ Differentially expressed genes across many cortical and sub-cortical regions – Dorsolateral prefrontal cortex (dlPFC) (Fillman et al, 2013) – Anterior Cingulate Cortex (Zhao et al, 2015; Hong et al, 2013) – Superior temporal gyrus (Wu et al, 2012) – Hippocampus (Hwang et al, 2013; Kohen et al, 2014) – Amygdala (Chang et al, 2017) ■ Enrichment of pathways and gene networks – Neural development – Axon guidance – Inflammation and immune-related proteins CommonMind Consortium ■ Largest transcriptomic analysis of schizophrenia – 258 cases/279 controls – RNAseq in dlPFC ■ 693 differentially expressed genes Fromer et al, 2016 Cell Diversity in Postmortem Brain ■ Brain, like all tissues, consists of many cell types – Major cell populations (e.g. astrocytes) – Distinct sub-populations (e.g. PVALB+ interneurons) ■ Problems in assessing differential expression in bulk lysate – Inability to identify which cells are affected – Missed expression changes in less common cell types Penney et al, 2019 Schizophrenia Single Cell Transcriptomics ■ Immunofluorescence and laser capture microdissection to collect individual populations of cells ■ Layer III/V pyramidal neurons (Arion et al, 2017) – 72 PFC samples – 36 cases/36 controls – 100 cells per layer for each sample – Expression assessed by microarray – 1,783 differentially expressed probe sets corresponding to 1,420 genes
    [Show full text]
  • Perkinelmer Genomics to Request the Saliva Swab Collection Kit for Patients That Cannot Provide a Blood Sample As Whole Blood Is the Preferred Sample
    Autism and Intellectual Disability TRIO Panel Test Code TR002 Test Summary This test analyzes 2429 genes that have been associated with Autism and Intellectual Disability and/or disorders associated with Autism and Intellectual Disability with the analysis being performed as a TRIO Turn-Around-Time (TAT)* 3 - 5 weeks Acceptable Sample Types Whole Blood (EDTA) (Preferred sample type) DNA, Isolated Dried Blood Spots Saliva Acceptable Billing Types Self (patient) Payment Institutional Billing Commercial Insurance Indications for Testing Comprehensive test for patients with intellectual disability or global developmental delays (Moeschler et al 2014 PMID: 25157020). Comprehensive test for individuals with multiple congenital anomalies (Miller et al. 2010 PMID 20466091). Patients with autism/autism spectrum disorders (ASDs). Suspected autosomal recessive condition due to close familial relations Previously negative karyotyping and/or chromosomal microarray results. Test Description This panel analyzes 2429 genes that have been associated with Autism and ID and/or disorders associated with Autism and ID. Both sequencing and deletion/duplication (CNV) analysis will be performed on the coding regions of all genes included (unless otherwise marked). All analysis is performed utilizing Next Generation Sequencing (NGS) technology. CNV analysis is designed to detect the majority of deletions and duplications of three exons or greater in size. Smaller CNV events may also be detected and reported, but additional follow-up testing is recommended if a smaller CNV is suspected. All variants are classified according to ACMG guidelines. Condition Description Autism Spectrum Disorder (ASD) refers to a group of developmental disabilities that are typically associated with challenges of varying severity in the areas of social interaction, communication, and repetitive/restricted behaviors.
    [Show full text]
  • RT² Profiler PCR Array (Rotor-Gene® Format) Mouse Neuronal Ion Channels
    RT² Profiler PCR Array (Rotor-Gene® Format) Mouse Neuronal Ion Channels Cat. no. 330231 PAMM-036ZR For pathway expression analysis Format For use with the following real-time cyclers RT² Profiler PCR Array, Rotor-Gene Q, other Rotor-Gene cyclers Format R Description The Mouse Neuronal Ion Channels RT² Profiler PCR Array was developed to profile expression of a panel of 84 genes encoding neuroscience-related ion channels and transporters. The genes represented on the array are listed below, grouped according to their functional and structural features. Included are calcium channels, potassium channels, sodium channels, chloride channels, and transporters. Using real-time PCR, you can easily and reliably analyze expression of a focused panel of genes related to the neuronal ion channels and transporters with this array. For further details, consult the RT² Profiler PCR Array Handbook. Shipping and storage RT² Profiler PCR Arrays in the Rotor-Gene format are shipped at ambient temperature, on dry ice, or blue ice packs depending on destination and accompanying products. For long term storage, keep plates at –20°C. Note: Ensure that you have the correct RT² Profiler PCR Array format for your real-time cycler (see table above). Note: Open the package and store the products appropriately immediately on receipt. Sample & Assay Technologies Array layout The 96 real-time assays in the Rotor-Gene format are located in wells 1–96 of the Rotor-Disc™ (plate A1–A12=Rotor-Disc 1–12, plate B1–B12=Rotor-Disc 13–24, etc.). To maintain data analysis compatibility, wells 97–100 do not contain real-time assays but will contain master mix to account for weight balance.
    [Show full text]
  • A Meta-Analysis of the Effects of High-LET Ionizing Radiations in Human Gene Expression
    Supplementary Materials A Meta-Analysis of the Effects of High-LET Ionizing Radiations in Human Gene Expression Table S1. Statistically significant DEGs (Adj. p-value < 0.01) derived from meta-analysis for samples irradiated with high doses of HZE particles, collected 6-24 h post-IR not common with any other meta- analysis group. This meta-analysis group consists of 3 DEG lists obtained from DGEA, using a total of 11 control and 11 irradiated samples [Data Series: E-MTAB-5761 and E-MTAB-5754]. Ensembl ID Gene Symbol Gene Description Up-Regulated Genes ↑ (2425) ENSG00000000938 FGR FGR proto-oncogene, Src family tyrosine kinase ENSG00000001036 FUCA2 alpha-L-fucosidase 2 ENSG00000001084 GCLC glutamate-cysteine ligase catalytic subunit ENSG00000001631 KRIT1 KRIT1 ankyrin repeat containing ENSG00000002079 MYH16 myosin heavy chain 16 pseudogene ENSG00000002587 HS3ST1 heparan sulfate-glucosamine 3-sulfotransferase 1 ENSG00000003056 M6PR mannose-6-phosphate receptor, cation dependent ENSG00000004059 ARF5 ADP ribosylation factor 5 ENSG00000004777 ARHGAP33 Rho GTPase activating protein 33 ENSG00000004799 PDK4 pyruvate dehydrogenase kinase 4 ENSG00000004848 ARX aristaless related homeobox ENSG00000005022 SLC25A5 solute carrier family 25 member 5 ENSG00000005108 THSD7A thrombospondin type 1 domain containing 7A ENSG00000005194 CIAPIN1 cytokine induced apoptosis inhibitor 1 ENSG00000005381 MPO myeloperoxidase ENSG00000005486 RHBDD2 rhomboid domain containing 2 ENSG00000005884 ITGA3 integrin subunit alpha 3 ENSG00000006016 CRLF1 cytokine receptor like
    [Show full text]
  • (KCNAB2) (NM 003636) Human Tagged ORF Clone Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC211690 Kv beta 2 (KCNAB2) (NM_003636) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: Kv beta 2 (KCNAB2) (NM_003636) Human Tagged ORF Clone Tag: Myc-DDK Symbol: KCNAB2 Synonyms: AKR6A5; HKvbeta2; HKvbeta2.1; HKvbeta2.2; KCNA2B; KV-BETA-2 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC211690 ORF sequence Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTATCCAGAATCAACGACGGGCTCCCCGGCTCGGCTCTCGCTGCGGCAGACGGGCTCCCCCGGGATGA TCTACAGTACTCGGTATGGGAGTCCCAAAAGACAGCTCCAGTTTTACAGGAACCTGGGCAAGTCTGGCCT GCGGGTCTCCTGCCTGGGACTTGGAACATGGGTGACCTTCGGAGGCCAGATCACCGATGAGATGGCAGAG CAGCTCATGACCTTGGCCTATGATAATGGCATCAACCTCTTCGATACAGCAGAAGTCTACGCAGCCGGCA AGGCTGAAGTGGTACTGGGAAACATCATTAAGAAGAAAGGATGGAGGCGGTCCAGCCTCGTCATCACCAC CAAGATCTTCTGGGGCGGAAAGGCGGAGACGGAGCGGGGCCTGTCCAGGAAGCACATAATCGAAGGTCTG AAAGCTTCCCTGGAGCGACTGCAGCTGGAGTACGTGGATGTGGTGTTTGCCAACCGCCCGGACCCCAACA CCCCGATGGAAGAGACCGTCCGCGCCATGACCCACGTCATCAACCAGGGGATGGCCATGTACTGGGGCAC GTCACGCTGGAGCTCCATGGAGATCATGGAGGCCTACTCCGTGGCCCGGCAGTTCAACCTGACCCCGCCC ATCTGCGAGCAGGCTGAGTACCACATGTTCCAGCGTGAGAAAGTGGAGGTGCAGCTGCCGGAGCTGTTCC ACAAGATAGGAGTGGGCGCCATGACCTGGTCCCCTCTGGCCTGTGGCATTGTTTCTGGCAAGTACGACAG TGGCATCCCACCCTACTCAAGAGCCTCCTTGAAGGGCTACCAGTGGCTGAAGGACAAGATCCTCAGTGAG
    [Show full text]