Rabbit Anti-Human KCNAB2 Polyclonal antibody (DPABH-15471) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Immunogen KCNAB2 fusion protein, sequence: MYPESTTGSPARLSLRQTGSPGMIYSTRYGSPKRQLQFYRNLGKSGLRVSCLGLGTWVTFGG QITDEMAEQLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETE RGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWS SMEIMEAYSVARQFNLTPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKY DSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSV LLGASNADQLMENIGAIQVRVRGPAGQRAHPSPSPVQCILPGSSCVPGSVLGTQDAPVNHQSC APGELAFQQEQT (1-395 aa encoded by BC110351) Isotype IgG Source/Host Rabbit Species Reactivity Human, Mouse, Rat Purification Antigen affinity purification Conjugate Unconjugated Applications WB, IHC, ELISA Positive Control mouse brain tissue, HepG2 cells Format Liquid Size 50 uL; 100 uL Buffer PBS with 0.02% sodium azide and 50% glycerol pH 7.3. Preservative 0.02% Sodium Azide Storage Store at -20°C. Aliquoting is unnecessary for -20°C storage. BACKGROUND Introduction Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member alters functional properties of the KCNA4 gene product. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. Keywords KCNAB2; potassium channel, voltage gated subfamily A regulatory beta subunit 2; AKR6A5; KCNA2B; HKvbeta2; KV-BETA-2; HKvbeta2.1; HKvbeta2.2; voltage-gated potassium channel subunit beta-2; K+ channel beta-2 subunit; K(+) channel subunit beta-2; potassium channel shaker chain beta 2; potassium voltage-gated channel, shaker-related subfamily, beta member 2; GENE INFORMATION Entrez Gene ID 8514 UniProt ID A0A024R4E3 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.