Perth 2005 - 2015 I Autumn 2015

THE ARCHITECT

AUTUMN 2015 PERTH 2005 - 2015 I AUTUMN 2015

PERTH 2005 - 2015 mondoluce.com.au

editor’s message Author Olivia Chetkovich

2005 - 2015 has been a period of great It has certainly been a focus in the OCMGTUOGODGTUQHVJGCTEJKVGEVWTCN change in Perth and as our city, suburbs past decade but the response of the community and contributors to and surrounds continue to develop, built environment and its role in the the public discourse. Essays and we thought the Autumn 2015 issue investment in our city is also crucial. investigations into this theme invite presented a timely opportunity to As we explore and develop our identity, you to see the city through the eyes TGɔGEVQPVJKUKOOGFKCVGCPFF[PCOKE YGCUMOQTGQHQWTFGUKIPGTURNCPPGTU of architect as participant, public past. FGXGNQRGTUFGEKUKQPOCMGTUCPFVJG ɑIWTGRJQVQITCRJGTCPFCECFGOKE Perth public itself to contribute to this Students have also engaged in this And whilst I have certainly appreciated movement. examination: Beth George’s PhD their proliferation, it’s not all just YQTMKPXGUVKICVKPIOCRRKPIUQHVJG small bars. In the city predominantly, With proposals to increase density on City has informed design studios in major ambitious architectural projects our suburbs’ doorsteps, the next 10 the Master of Architecture course. have changed our built landscape, years of change in Perth may indeed be 5GNGEVGFYQTMHTQOVJKUEQWTUGYKNN TGɔGEVKPICPWPOKUVCMCDNGEQPɑFGPEG concentrated in this realm, should this be exhibited at Australian Urban (do I need to even mention the Arena, density be realised. As Perth becomes Design Research Centre in July of State Theatre Centre…). Projects more accustomed to density, a change this year. Initiatives, organisations promoting the use of civic space to the grain and understanding of and responsive governance measures (both completed and to be realised) our suburbs and the development EQPVKPWGVQFGXGNQRTGɔGEVKPICPF are bringing liveliness to the city, of infrastructure (both built and informing the nature of our changing prompting public engagement, interest, social) to accommodate this, will no built environment. Projects of both critique and anticipation. As a result of doubt demand the investment and large and small scale are explored. And the investment in the inner suburbs, engagement in these areas that we have CUYGRTGUGPVVJKUEQPVGPVUQOGCUMVJG VJGFGɑPKVKQPQHVJGUGCTGCUJCUDGGP seen in the more central precincts. SWGUVKQPȄKU2GTVJɑZGF!ӑ extended – not just in terms of their increasing relative proximity to the city, 5QCUYGEQPVKPWGVQNQQMHQTYCTF So please read on. It’s not just a pat on but also in their evident shift in lifestyle and imagine the changes to come, VJGDCEM CNVJQWIJVJGTGӑUCHCKTDKVQH and identity. YGRTGUGPVJGTGCTGɔGEVKQPQPKFGCU VJCVȁDWVYJ[PQV! DWVCTGɔGEVKQP initiatives and developments of the a moment for recognition and an However, is ‘vitality’ the only, or most last 10 years in our changing city. exhibition of this period of development important, measure of success of a Speculations on ‘PERTH 2005 – 2015’ that will continue to inform our future. developing city centre or suburb? CTGRTGUGPVGFHTQOMG[FGEKUKQP

+61 8 9321 0101 Elegant lighting solutions are integral to making profound architectural Mondoluce nurtures partnerships with statements. They provide the dramatic contrast, shades, subtlety and vibrancy key design professionals such as Griffiths mondoluce.com.au Architects, resulting in this Shenton Park that accentuate the hard work we put into making memorable buildings. private residence. A partnership with Mondoluce through the design process is signiﬁcant to the mondoluce.perth For more information speak to one of our overall outcome of our work. Poor lighting can make or break a project — with lighting application specialists or visit the Mondoluce it well and truly makes it. online project page using the QR code Griffiths Architects - Architect, Ron Tan - Photography reader on your smart-phone.

- 1 - CUSTOM The Official Journal of the Australian DESIGN Institute of Architects: WA Chapter DESIGNING FOR YOUR SPACE 4 Contributors Before After CONTENTS 5 Editor’s Message At Jenny Jones Rugs we offer a 6 President’s Message unique custom design service. initiative. Overseen by Creative Director and

International Award 10 2nd February 2015 Winning Designer Jenny 15 MERGE Emerging Architects – a Ten Year Retrospective Jones, our dedicated team of 18 Open House Perth designers consists of Interior Architects and Textile 20 Design Advisory Committees in Perth Designers. 25 Perth Cultural Centre: Urban Life Laboratory OVER 2000 To date we have designed over 1400 custom rugs designs essay. for both and residential & commercial clients throughout 1200 32 Office of the Government Architect Asia, Europe and America. colours 36 Perth City 2005 – 2015 (R)Evolution With the ability to adjust colour, 42 Realising the Arena material, design, size 52 Ten From Ten and shape it is the attention to detail that sets us apart. 63 Scouring the Thin City Our specialised review. software can covert any design into a realistic 72 Northbridge Evolution 2004 - 2015 UHSUHVHQWDWLRQRIWKHÀQDOUXJ 76 A New Village in Town Considered ‘Art on the 78 Bellevue Terrace / Philip Stejskal Architecture all our rugs are hand- Floor’ 80 Bread in Common / spaceagency knotted to the highest quality and represent great value. 82 Sussex Street / Mountford Architects 84 Is Perth Fixed? JENNY JONES RUGS JENNYJONESRUGS.COM 08 9286 1200 6 STIRLING RD CLAREMONT, WA 6010

- 3 - CONTRIBUTORS

Mimi Cho Carmel Van Ruth ‘Perth Cultural Centre: Urban Life ‘Design Advisory Committees in Perth’ Laboratory’ Carmel is a member and past Chair of Mimi is a Graduate of Architecture and the City of Vincent Design Advisory Chair of MERGE Emerging Architects Committee and a Senior Architecture Committee Officer in the Office of the Government Architect Frazer Macfarlane ‘Perth Cultural Centre: Urban Life Laboratory’ Carly Barrett editor’s message Frazer is a Graduate of Architecture and ‘Open House Perth’, ‘Sussex Street / occasional ﬁlm maker working in practice Author Olivia Chetkovich Mountford Architects’ Carly recently set up Project857, an Tanya Trevisan architecture and interiors design office, ‘Realising the Arena’ and is the Founder and Creative Director Tanya is a registered architect and Chief of Open House Perth Operating Officer at TRG Properties 2005 - 2015 has been a period of great past decade but the response of the architectural community and Adrian Iredale David McLoughlin change in Perth and as our city, suburbs built environment and its role in contributors to the public discourse. ‘Perth City 2005 – 2015 (R)Evolution’ ‘Northbridge Evolution 2004 – 2015’ and surrounds continue to develop, the investment in our city is also Essays and investigations into this Adrian is a Director of iredale pedersen David is an architect and photographer we thought the Autumn 2015 issue crucial. As we explore and develop theme invite you to see the city hook architects and member of the City with a keen interest in the city centre RTGUGPVGFCVKOGN[QRRQTVWPKV[VQTGɔGEV QWTKFGPVKV[YGCUMOQTGQHQWT through the eyes of architect as of Vincent Design Advisory Committee and relationship of buildings to people on this immediate and dynamic past. designers, planners, developers, RCTVKEKRCPVRWDNKEɑIWTGRJQVQITCRJGT at street level FGEKUKQPOCMGTUCPFVJG2GTVJRWDNKE and academic. Students have also And whilst I have certainly appreciated itself to contribute to this movement. engaged in this examination: Beth Brad Ladyman their proliferation, it’s not all just )GQTIGӑU2J&YQTMKPXGUVKICVKPI ‘Bellevue Terrace / Philip Stejskal Beth George small bars. In the city predominantly, With proposals to increase density mappings of the City has informed Architecture’ ‘Scouring the Thin city’ major ambitious architectural projects on our suburbs’ doorsteps, the next 10 design studios in the Master of Brad is a PhD candidate at the University of Beth is a lecturer in Architecture at UWA; have changed our built landscape, years of change in Perth may indeed be #TEJKVGEVWTGEQWTUG5GNGEVGFYQTM Western Australia she cofounded Spacemarket and Post- TGɔGEVKPICPWPOKUVCMCDNGEQPɑFGPEG concentrated in this realm, should this from this course will be exhibited at Architecture and is now working solo (do I need to even mention the Arena, density be realised. As Perth becomes Australian Urban Design Research Hayley Curnow State Theatre Centre…). Projects more accustomed to density, a change Centre in July of this year. Initiatives, ‘Bread in Common / spaceagency’ promoting the use of civic space to the grain and understanding of organisations and responsive Hayley is an Interior Designer at Taylor (both completed and to be realised) our suburbs and the development governance measures continue to Robinson are bringing liveliness to the city, of infrastructure (both built and FGXGNQRTGɔGEVKPICPFKPHQTOKPI Sarah McGann prompting public engagement, social) to accommodate this, will no the nature of our changing built ‘A New Village in Town’ Andrew McDonald interest, critique and anticipation. doubt demand the investment and environment. Projects of both large Sarah is an architectural researcher and ‘Is Perth Fixed?’ As a result of the investment in the engagement in these areas that we have and small scale are explored. And a Professor at the University of Notre Andrew is a comedian who co-curates the KPPGTUWDWTDUVJGFGɑPKVKQPQHVJGUG seen in the more central precincts. as we present this content some Dame in Fremantle satirical website ‘Worst of Perth’ areas has been extended – not just CUMVJGSWGUVKQPȄKU2GTVJɑZGF!ӑ in terms of their increasing relative 5QCUYGEQPVKPWGVQNQQMHQTYCTF proximity to the city, but also in their and imagine the changes to come, So please read on. It’s not just a evident shift in lifestyle and identity. YGRTGUGPVJGTGCTGɔGEVKQPQPKFGCU RCVQPVJGDCEM CNVJQWIJVJGTGӑU initiatives and developments of the a fair bit of that – but why not?), Warranty: Persons and/or organisations and their servants and agents or Editor Advertising However, is ‘vitality’ the only, or most last 10 years in our changing city. DWVCTGɔGEVKQPCOQOGPVHQT assigns upon lodging with the publisher for publication or authorising or Olivia Chetkovich Kim Burges important, measure of success of a Speculations on ‘PERTH 2005 – 2015’ recognition and an exhibition of approving the publication of any advertising material indemnify the publisher, the editor, its servants and agents against all liability for, and costs of, any [email protected] developing city centre or suburb? CTGRTGUGPVGFHTQOMG[FGEKUKQP this period of development that will claims or proceedings whatsoever arising from such publication. Persons and/ Managing Editor Kay Cohen It has certainly been a focus in the OCMGTUOGODGTUQHVJG continue to inform our future. or organisations and their servants and agents and assigns warrant that the Michael Woodhams ɻ advertising material lodged, authorised or approved for publication complies [email protected] with all relevant laws and regulations and that its publication will not give rise to any rights or liabilities against the publisher, the editor, or its servants and Editorial Committee Produced for agents under common and/ or statute law and without limiting the generality Emma Brain of the foregoing further warrant that nothing in the material is misleading or Australian Institute of Architects WA Chapter deceptive or otherwise in breach of the Trade Practices Act 1974. Tanya Trevisan 33 Broadway Nedlands WA 6009 (08) 9287 9900 Important Disclaimer: The material contained in this publication is general comment and is not intended as advice on any particular matter. No reader Magazine Template Design [email protected] should act or fail to act on the basis of any material contained herein. Readers Public Creative www.architecture.com.au/wa should consult professional advisors. The Australian Institute of Architects, its www.publiccreative.com.au officers, the editor and authors expressly disclaim all and any liability to any persons whatsoever in respect of anything done or omitted to be done by any Cover Image such persons in reliance whether in whole or in part upon any of the contents Publisher Tabula – Grids: CBD and Northbridge of this publication. All photographs are by the respective contributor unless Australian Institute of Architects WA Chapter Beth George otherwise noted. AS ISSN: 1037-3460

- 4 - - 5 - CALLIGARIS CATTELAN ITALIA CC TAPIS

CECCOTTI /8;85<(8523($1)851,785(,17(5,256 DOMODINAMICA FIAM ITALIA FREISTIL GALLOTTI & RADICE HULSTA QUALITY IS NOT AN NOW! HULSTA ACT, IT’S A HABIT.. PRIMAFILA state president’s message ROLF BENZ ROYAL BOTANIA Author Philip Griffiths TERZANI TONIN CASA UNOPIU VALENTINI VARASCHIN AND MANY MORE.. A great deal has been said about what a accommodation. One would hope that is wrong with the city of Perth and at this will change and include a lot more the same time, an enormous amount young people. of creative energy has gone into how VQOCMGKVCDGVVGTEKV[%KV[8KUKQPJCU 5WTGYGJCXGNQQMGFCVQVJGTEKVKGUHQT DGGPNQQMKPICVCPFVT[KPIVQRTQOQVG models and Melbourne is a favourite, notions of a better city since 1987. but we are bending those models to Many architects, landscape architects our unique environment. There are and urban designers have given much the obvious large projects that are VJQWIJVVQOCMKPI2GTVJCDGVVGT either in train or can now be evaluated. and more lively place. National and $TQQMɑGNF2NCEGKUQPGVJCVJCUDGGP international talents have been here properly road tested and pronounced VQUVKOWNCVGVJKPMKPI a 9JCVKUFKɈGTGPVCDQWV! a success. Other successes are small As with all cities, change is the product Again prompted by a mineral boom, scale and some are ephemeral, of a combination of factors. Typically the City has seen a large amount of ranging through small bars, Fringe the fortunes and major changes in our development and redevelopment. (GUVKXCNCPFVJGNKMG2GTVJKP,CPWCT[ city have been prompted by mineral A shift in attitude by the City and to March 2015 shows what the City DQQOE[ENGUIQNFKTQPPKEMGNCPF State appears to have brought to ECPDGCVVKOGUa then more recently iron again, gas, reality some of the ideas that have a and many other resources. Historically long been held. The election of the Government investment in Yagan the city became the Paris of the current Lord Mayor of the City of Square and Elizabeth Quay will also UQWVJGTPJGOKURJGTGQPVJGDCEMQH Perth in 2007 has been a part of the KORCEVKPCUKIPKɑECPVYC[CPF the 1890s gold boom. A huge amount shift in attitude with a City Council one would hope, add to the mix of of development occurred in a short that is aware of the ingredients KPITGFKGPVUVJCVOCMGUVJG%KV[C of a lively and successful city. time and produced diverse and yet well better place. related streetscapes and buildings. Opportunities have been sought and a a barriers reduced. Ideas are nourished. One of the most important Subsequent booms had a more sporadic A review of plot ratio, new licensing ingredients of change has been a impact and much of the change was laws, promotion of under-utilised ‘can do’ attitude, rather than an not for the better. A series of unrelated spaces, a focus on design quality and over-regulated environment that developments caused destruction and innovative responses to the City’s created a small number of architectural heritage have all contributed to a ɑPFUCNNMKPFUQHGZEWUGUHQTPQV gems such as Council House and much improved city. doing things. If the advances made Dumas House. The pause at the end of a in 2005 - 2015 are any indication, the 20th century arrested a number of Increases in the residential component 2GTVJECPNQQMHQTYCTFVQCOQTG large developments and allowed some QHVJG%KV[ӑUOCMGWRJCXGCNUQ vibrant future and to becoming an TGVJKPMKPIVQDGFQPGKPVJGEWTTGPV contributed. So far a lot of the growth increasingly attractive place for our E[ENGCPFVQITGCVGɈGEV has been in a sector that is downsizing IWGUVUCPFHQTQWTUGNXGUaɻ XOWLPRFRPDX +XWWRQ6WUHHW 2VERUQH3DUN:$ - 6 - - 7 - initiative.

- 8 - - 9 - 2nd february 2015 Author Nic Brunsdon

As the winner of the 2014 Emerging Architect for WA and the 2015 National Emerging Architect (Australia), Nic shares his perspective on PERTH 2005 – 2015.

I’ve just been for a swim. My feet are still at a party and ranting at him. “You! and fun and sunburn. The beautiful sandy and the ocean is 20 metres away. 2GTVJPGGFU[QW%QOGDCEMCVQPEGȈ times. He, and me circa 2004-2009, 9JCVCPCDUQNWVGHWEMKPIRTKXKNGIG I do that a bit. With him I meant it. FGNKIJVGFKPCNNQH2GTVJӑUOCIPKɑEGPEG +UWURGEV+ӑODGKPICUMGFVQYTKVGVJKU yet had no idea about how to fashion Image: Braund Dorothy CUUQOGMKPFQHCOCTMGTHQT2GTVJ It’s a nice (as in logically sound but not CECTGGTQWVJGTG6YQYGGMUQHDNKUU Ȅ*QQTC[.QQMJQYHCTYGӑXGEQOGӑ emotionally pleasant) lead-in to my CPFVJGPDCEMVQCUQOGYJGTGGNUG 2CVUQPVJGDCEMIQQFLQDMGGRKVWR next bit and what I feel is going to be anywhere else, as swiftly as possible. the thrust of this piece. Perth: its beauty I’ve got some problems with this. and its terror. I’m lifting this from a That’s the challenge. How does Perth It means we’re dealing in comparisons. poem called My Country by Dorothea IGVȄUVKEM[ӑ!+ӑXGUCKFDGHQTGVJCV+YCPV 6QOCTMUQOGVJKPI[QWӑXGIQVVQ /CEMGNNCT1. The part I’m referencing Perth to be a place that is a joy to return evaluate it against something else. goes… VQCPFFKɋEWNVVQNGCXG+IWGUUYGӑXGIQV Sydney and Melbourne spring to mind. one part of that equation humming – They’re our closest aspirational centres, I love a sunburnt country VJGQVJGTPGGFUYQTM+UVJGUVKEMKPGUU and we’re smitten with each for myriad A land of sweeping plains answer as simple as ‘this place only TGCUQPU.KMGC[QWPIGTUKDNKPIUVKNN Of ragged mountain ranges YQTMUYJGP[QWJKVCPF[QWPGGF unsure of themselves and enamoured Of droughts and flooding rains your parents as babysitters for your as with their big bro’s swagger. Most often I love her far horizons [GVWPDQTPMKPӑ!+TGCNN[JQRGPQV6JKU VJGQDLGEVQHCɈGEVKQPKUPQVDGVVGT I love her jewel-sea one is a long-game that many bright endowed; they’ve just been at it for Her beauty and her terror RGQRNGCTGYQTMKPIJCTFCV2. Something longer. In the context of Perth, it’s the The wide brown land for me. VJCVHQTDTGXKV[CPFCNCEMQHGZRGTVKUG most obvious thing and something I’m going to dodge at this point. VJCVNKMGHCOKN[F[PCOKEUDGEQOGU I love this poem. My grandmother less important with a rising maturity. used to read it to me. I love that stanza, One of my friends (hi Sean) has a theory most especially ‘her beauty and her VJCV+UWDUETKDGVQVJCV2GTVJQɈGTU Simply, clearly, importantly, we are not terror’. To me, that’s the condition you ample anonymity and that that these places (or any other places) and QHNKHGKP#WUVTCNKCCPFURGEKɑECNN[ is a rare and wonderful thing. Perth, YGPGGFVQUVQRNQQMKPIGNUGYJGTGHQT wide, brown, far, blue Perth. NKMGPCVWTGKUEQORNGVGN[KPFKɈGTGPV validation or resonance. Here, we have to you and your needs. It (and he) half as many people spread over twice My friend couldn’t live here. Living here OGCPUVJCV[QWECPFQYJCV[QWNKMG as much country. This is our unique meant death (and morbidly enough, here and be unprejudiced by fashion, problem. And our exquisite opportunity. living away has now meant that too). VTGPFQTRTGEGFGPV+TGCNN[NKMGVJCV A common story, he, and countless …It’s now been three hours since I others, would return here during that If you compare that with the mega-cities wrote that bit above. I’ve just been told OCIKECNVYQYGGMTWUJQXGTUWOOGT (both Western and Eastern), they have my friend has died. I remember being where it would be families and friends so much riding on you being there. ɾ

Image: Kathie McDermott Image: Kathie - 10 - - 11 - You are the tiny imperceptible cog. about those mega-cities, the sense that a structure that champions one another: You are, in the smallest way, the [QWӑTGCNYC[UYCNMKPIKPUQOGQPG promoting talent over tenure, LWUVKɑECVKQPHQTVJGEQPVKPWCVKQPQH else’s shoes. And that is the optimism over cynicism and idea those places in whatever way they essence of why I love Perth and over hierarchy. I feel the seeds of this design themselves 3. It’s the paradox why I love now. Everyone is a part CTGCNTGCF[UQYP+VJKPMKVӑUVKOGVQDG of the heap 4 in human form – indulge of something recent here. done with cynicism. Local papers are me one second - if you have a pile of built on it. It is the most boring and sand and you remove one grain, is it 2GTVJJCUPӑV[GVFGɑPGFKVUGNH wasteful emotion. Be a participant, still a heap? It is? Good, so if you can (TQOYJGTG+UKV+VJKPM2GTVJKUC don’t be a cynic. Be a contributor and continue to remove one grain and it healthy adolescent with all the be a critic in areas where you are expert. still remains a heap, what happens nascent emotion and maturity of a If you’ve committed to abiding in a when you get to the last grain? human one. We’re in the process of EKV[KVKUKPEWODGPVQP[QWVQYQTM OCMKPIUQOGENWOU[OKUVCMGUTWDDKPI to improve your small corner. If that’s too obtuse, and it just might up against some arbitrary boundaries Life is short and you’ll be dead soon. be, I’m trying to say that the mega- CPFOKZKPIYKVJUQOGUMGVEJ[ETQYFU /CMGOQTGQHCJGCRQHQWTDGCWVKHWN cities are because they are. If you live We could very easily be great, hell, we RKNG'TQFGFQYPUQOGFGUKTGVTCEMU Image: Beth George,Spacemarket in London, you are London! London is just might be. 6CMGCFKXGTIGPVRCVJUGGDGCWV[CPF you! If tomorrow everyone in London IGVCNKVVNGDKVVGTTKɑGF6JKUKUQWT Notes people-meat going through a city-mincer UCKFȇHWEMVJKU+ӑXGJCFGPQWIJQHUJKV Which opens up the notion of, opportunity and our opportunity and that visual hasn’t left me. 1. Core of My Heart, Dorothea Mackellar, The YGCVJGTȈCPFNGHVKVYQWNFDGQXGTVJG ‘greatness’, how do you mature into is now. ɻ Spectator London 1908. This next bit is 4. From Wikipedia: The paradox goes as heap, the ‘London’, is gone. But they that? I was listening to a podcast 6 last great and especially relevant in this context: follows: consider a heap of sand from In an interview in 1967, Mackellar described which grains are individually removed. don’t leave (although they should, YGGMCPFVJG[YGTGVCNMKPICDQWVVJG her reasons for writing the poem: 'Not really One might construct the argument, using it’s rubbish). People beget people. KFGCVJCVVJGMG[VQITGCVEKVKGUYCUPӑV a special reason. But a friend was speaking premises, as follows: Event begets event. It’s very hard to ‘grounding’ but ‘mobility’. Mobility is to me about England. We had both recently come back from England. And she was 1,000,000 grains of sand is a heap of change something that is already in CPKPXKVKPIEQPEGRV+VCMGVJKUVQOGCP talking about Australia and what it didn’t sand (Premise 1) motion and has a heavy inertia. that you want your urban spaces not to have, compared to England. And I began A heap of sand minus one grain is still a NQQMHQTɑZGFPGUUDWVTGURQPUKXGPGUU talking about what it did have that England heap. (Premise 2) hadn’t, that you couldn’t expect to know 9JCV+VJKPMVJKUCNNTGPFGTUFQYPVQKU Flexibility over rigid zoning and the country to have. ‘Cause, of course, there Repeated applications of Premise 2 the innate ability, for both the good of capricious legislation. I guess it’s a part are lots of wonderful things, especially in (each time starting with one fewer each of us and the good-ness of a city, QHYJCVYGUVCTVGF5RCEGOCTMGVHQTȁKP the older parts, but they’re not the same, grain) eventually forces one to accept and, of course, the people who came here the conclusion that a heap may to be able to carve our own ‘erosion built metropolitan contingency. What a ﬁrst... I’m not blaming them for it. But it be composed of just one grain of sand (and VTCEMӑ CPQVJGTDQTTQYGFVGTO 6QHGGN wonderful plaything that would be. was so different to anything they’d known, consequently, if one grain of sand is still a NKMG4QDGTV(TQUV5 and not the grain of they didn’t understand.' heap, then removing that one grain of sand to leave no grains at all still leaves a heap UCPFQTVJGVKP[5YKUUEQI6QDGNKMGC We live in a beautifully terrifying place 2. I wont go into all of them, but as a start: of sand; indeed a negative number of grains dog doing circles before bed (and the OQUVN[KPFKɈGTGPVVQQWTFCKN[VJGCVTG The Committee for Perth, the various must also form a heap). Town Centre Networks, FORM, a few local FQIKUGPFNGUUN[EWTKQWUKVӑUCFKɈGTGPV (QTQWTQYPCFXCPEGJQYCDQWVYGDCEM governments, Spacecubed, MRA public 5. Just in case this is a missed reference, bedcircle every night) – having the in those good people who are trying to places, Fringe, PIAF, Open House Perth, etc it’s ‘The Road not Taken’ by Robert Frost. facility, interest and conviction to start parent this teen? This is God’s country. Seminal and oft-cited. ‘Two roads diverged 3. I was at a lecture given by Richard Weller in a yellow wood, And sorry I could not your own trail (or follow near to one), We need to preserve the wild sanguinity (Boomtown 2050 and general dreamboat) travel both…’ CPFPQVIGVECWIJVKPVJGRCEMGFFKTVQH that a sun setting into a warm ocean can and he talked of the grinding effect of mega-cities. I immediately thought of 6. 'Architecture on Air,' Mark Morris others. That’s what’s so depersonalising rouse. I can see a supportive society with Image: Nic Brunsdon

- 12 - - 13 - Doric. Built on powerful principles. MERGE emerging architects - The Doric column of classical architecture is a creative answer to a requirement for strength, integrity and visual appeal. It achieves durability a ten year retrospective in both form and function, yet it is relatively simple and economical to construct. These are principles that we at Doric apply to every project we undertake. We encourage our engineering and construction teams to apply 6JGTGCTGHGYRGQRNGYJQMPQYVJGJKUVQT[QHQWTNQECNGOGTIKPICTEJKVGEVUӑPGVYQTM innovative and creative thinking, but we never lose sight of the purpose +H[QWJCXGCVVGPFGFCȄ1XGT7PFGTӑHQTWOCȄ4GIK HTW UVTCVKQPӑUGOKPCTCȄ6CNMQPC2TCEVKEGӑ CPȄ'OGTIKPI#TEJKVGEV2TK\G6CNMӑCȄ)QNF/GFCN$TGCMHCUV.WPEJӑYGNN[QWJCXGGPLQ[GFVJGHTWKVUQH/'4)' of our constructions or the need for economic accountability. So who exactly is MERGE and why does MERGE exist? In celebrating 25 years of award-winning excellence, Doric is proud that our commitment to excellence and innovation in project delivery has been recognised with more than 100 professional and industry In 1998, the then Royal Australian with other professional groups ranging opportunities run by MERGE enabled Institute of Architects established a from ‘Revit Tutorials’ to ‘Site Tours’; them to build on current, and awards. Western Australian Young Architects establishing bridges between future GUVCDNKUJPGYYQTMKPITGNCVKQPUJKRU Committee (YAC) to provide a leaders of the built environment. which has produced many successful collective voice for young architects 2GTVJRTCEVKEGUYGMPQYVQFC[ within the State Chapter. In 2006, Since the formation of MERGE the committee reformed under the Emerging Architects in 2006, there Todd Paterson banner of MERGE Emerging Architects. have been six Chairs. They reﬂect MERGE Chair 2008-2009 MERGE seeks to bridge the gap from on the decade that has been. study to practice and to provide an I am proud to say that I was in the environment conducive to professional delivery room the day that MERGE was Paul Edwards development, intellectual stimulation born. I joined the committee at a time MERGE Chair 2006-2008 and the social growth of young and when similar groups across the country emerging people in Perth’s architectural As one of the original founding were banding together to establish a scene. MERGE’s mission is to assist members of YAC in 1998, I was PCVKQPCNPGVYQTMWPFGTVJGWODTGNNCQH its members in establishing and involved in assisting RAIA to address the Institute, and so EmAGN (Emerging developing their architectural career the perceived gap between student/ #TEJKVGEVU )TCFWCVGU0GVYQTM by providing opportunities to network graduate and established professional was born. At the same time YAC was with other professionals and familiarise membership. We were charged with renamed to MERGE. It was a great time themselves with the challenges VJGVCUMQHETGCVKPIQRRQTVWPKVKGU for cross-fertilisation of ideas with and issues relating to architectural to aid the transition of students and the national body. During my time practice in Perth. (Extract from graduates into the Perth architectural as Chair we introduced the ‘Small Bar EmAGN newsletter December 2007). RTQHGUUKQP/CP[UVWFGPVUFKFPӑVYQTM Tour’ and ‘Architecture Film Night’, as in the profession prior to graduating well as built on the highly successful Almost a decade on, the MERGE and found they were competing for Ȅ1XGT7PFGTӑHQTWOYJKEJ committee - a combination of young only a handful of jobs when they did continues to be a fantastic event during registered architects, graduates graduate. Those who were engaged #TEJKVGEVWTG9GGM9GCNUQPWTVWTGF and Student Organised Network of with the profession before graduating connections with other professional Architecture (SONA) representatives made valuable contacts which assisted industry bodies through the Young - continues to deliver educational and them in the transition from student 2TQHGUUKQPCNU0GVYQTMYJKEJRTQXKFGF social events. As industry trends and to graduate and gave them a distinct ITGCVPGVYQTMKPIQRRQTVWPKVKGUYKVJ partnerships have evolved, MERGE has advantage in commencing their Engineering, Accounting, Law and introduced new events in collaboration CTEJKVGEVWTCNECTGGT(WTVJGTPGVYQTMKPI Public Relations professionals, all ɾ

Level 1, 420 Hay Street, Subiaco WA 6008 Australia - 14 - T +61 (8) 9388 2655 F +61 (8) 9388 1484 www.doricgroup.com.au - 15 - Left to Right: Paul Edwards, Todd Paterson, Dean Adams, Yen Nee Goh, Elvin Chatergon, Mimi Cho. Images: Merge.

of whom are critical to the success Yen Nee Goh Western Australia, Young Builders successfully as a gateway from student- and the wider public (challenge young graduate or student. These events of an architectural practice. During MERGE Chair 2011-2012 Alliance and also Local Authorities such ship to the challenges of practice. accepted David Weir). 2015 has also stimulate professional discourse my time as Chair I met a lot of as Town of Cambridge. I also wanted to already brought us some victories: the that may continue well beyond The focus of my term as Chair was very smart and interesting young ensure MERGE remained a fun, vibrant Mimi Cho ‘Sandcastles Competition’ established the event date, creating mutually to strengthen the relevance of our and relevant committee to encourage MERGE Chair 2015— YKVJ;'9#KPJCUOCFGKVQPVQ DGPGɑEKCNQRRQTVWPKVKGUHQT[QWPICPF architects across Australia who events and interaction with peer even greater team growth and reach VJKU[GCTӑU6QYPQH%CODTKFIGӑUQɋEKCN experienced architects to interact. have emerged as award-winning groups. We saw an increase in our #VWPKXGTUKV[KVYCUEQOHQTVKPIVQMPQY out to graduates and students. To summer family calendar, the ‘Site On the cross-disciplinary front, MERGE CTEJKVGEVUCPFGXGPC68RGTUQPCNKV[ VJCVVJGTGGZKUVGFCPGVYQTMQHRGQRNG small team of volunteers, which HWNɑNVJGUGCKOUYGUVCTVGFCPWODGT Tours’ series established with YBA in has collaborated with a number of peer +MPQYVJG[YKNNGPUWTGVJGCTEJKVGEVWTG who had once stood in my shoes and boosted the level of enthusiasm of new initiatives: the ‘Sandcastles 2014 continues to promote interaction groups over the past decade. Some profession will be sustainable and would be there to welcome me into tremendously. This enabled us to Competition’ in collaboration with between architects and builders, and have disbanded while others have RTQɑVCDNGKPVQVJGHWVWTG professional practice. Both Dean and EQPVKPWGYKVJQWTGɈQTVUCPF YEWA, held at City Beach; the ‘Site ‘Urban Screening’ returns to the Perth gained enthusiasm to collaborate, as Yen Nee’s committees had a strong introduce 'Regi(fru)stration' Cultural Centre to showcase a second TGɔGEVGFKP/'4)'ӑUPGYGTKPKVKCVKXGU Tours’ series in collaboration with presence at my university - a credit to nationally with the aim of providing [GCTQHCTEJKVGEVWTGQPXKFGQ9QTMKP In a competitive environment, these Dean Adams YBA, inaugurated at the Old Treasury them and the SONA representatives. face-to-face discussions and Q&A RTQITGUUYKVJVJGENQUWTGQH6JG$CMGT[ activities and connections within and MERGE Chair 2010-2011 Building; and the ‘Revit Tutorials’ I joined the committee promptly after opportunities for graduates DGNQXGFJQOGVQȄ1XGT7PFGTӑHTQO around our profession are invaluable. series held at Curtin University and graduation and have since enjoyed ɻ By the time I became Chair and during GODCTMKPIQPVJG#TEJKVGEVWTCN 2011 to 2014) we are planning for a new the University of Western Australia. watching ambitious concepts come my term, MERGE had established its Practice Examinations. As architectural venue that is more public and capable of These have helped arm students with to fruition. During Elvin’s productive practices evolved into multi-disciplinary expanding our audience demographic. reputation for delivering architectural UMKNNUTGSWKTGFVQICKPGORNQ[OGPVKP term as Chair I had the role of practices encompassing planning If you have ideas or comments for FKUEQWTUGCPFPGVYQTMKPIGXGPVUHQT today’s increasingly technology-reliant EQQTFKPCVKPI/'4)'ӑUOCTMGVKPICPF and engineering, MERGE’s mission in any of the above, please get in touch The MERGE committee meets young architects in Western Australia. and hyper-competitive construction communications, where I learned the RTQXKFKPIQRRQTVWPKVKGUVQPGVYQTM (contact details below). We are always 'XGPVUUWEJCUȄ1XGT7PFGTӑDGICP industry, whilst gaining exposure to importance of nurturing professional every second Tuesday of with other professions became interested in meeting inspiring to include international architects industry professionals in the classroom. relationships – past, present and the month. To attend, email increasingly crucial. The inclusion architects – young and not so young. and the MERGE photographic We also evolved well-established potential. This is why the committee is [email protected]. QHGPIKPGGTUCPFRNCPPGTUCUURGCMGTU competition debuted at Architecture GXGPVUUWEJCUȄ1XGT7PFGTӑVQ now introducing a dedicated MERGE Perth’s architectural climate may now Can’t make it to meetings? CVQWTUVCRNGGXGPVUUWEJCUȄ1XGT KPENWFGIWGUVURGCMGTUQHKPVGTPCVKQPCN Relationship Manager. As immediate 9GGM/'4)'HWTVJGTUWRRQTVGF seem more competitive than when Email us to ﬁnd out how else Under’ was a step towards encouraging repute, namely John Wardle and Paul RCUVRQKPVQHEQPVCEVKVOCMGUUGPUG young architects in Western MERGE arrived on the scene (pre-GFC) a collaborative approach when Pholeros, and enjoyed partnerships HQT'NXKPVQVCMGQPVJKUTQNGKPQTFGT you can get involved. More Australia with the establishment of but the profession is as enthusiastic as discussing design amongst ourselves. with new sponsors. Additionally, when to strengthen MERGE’s relationships information on events at the Emerging Architects Prize. ever to welcome the next generation of the National Architecture Conference with sponsors and peer groups. It is not wp.architecture.com.au/emagn/ Through these events and other OQXGTUCPFUJCMGTU-G[GXGPVUUWEJ came to Perth last year, we couldn’t unusual for Chairs to remain on the initiatives MERGE has provided an Elvin Chatergon CUQWTCPPWCNȄ1XGT7PFGTӑHQTWO wa-merge/ and Facebook. pass up the opportunity to run fringe committee after the end of their term. avenue for young architects to present, MERGE Chair 2013-2014 CPFȄ6CNMUQPC2TCEVKEGӑUGTKGUVJCVECP GXGPVUVQEQORNGOGPVVJGQɋEKCN It is in fact extremely valuable, as Yen VCMGRNCEGCVCP[VKOGVJTQWIJQWVVJG discuss and exhibit their architecture. After being actively involved with program. I believe that MERGE is one Nee was Finance Manager over the [GCTCNNQYRTCEVKEGUVQȇUJQYQɈȈVJGKT I see this exposure for young MERGE for the best part of three years, of the most relevant organisations in previous two years. In the coming two QɋEGCPFVJGKTYQTMUQVJCVVJG[OKIJV architects as MERGE’s main ongoing my main aim as Chair was to expand our 2GTVJYKVJKPVJGɑGNFQHCTEJKVGEVWTG years, MERGE aims to build a dialogue just snag the interest of a promising contribution to the architectural RTQHGUUKQPCNPGVYQTMVQKPENWFG;QWPI It promotes the profession to the between our architecture community community in Western Australia. Quantity Surveyors, Young Engineers entire spectrum of architects and acts

- 16 - - 17 - KonCrete® A distinctive urban ﬁnish available in a large range of polished plaster colours offering imaginative contemporary designs and containing 40% recycled marble.

open house perth Author Carly Barrett

Open House was a little idea that grew comments we receive from people is outside WA, 14% nationally (led by out of necessity. Founded during a VJCVVJG1RGP*QWUG2GTVJGXGPVOCMGU 8KEVQTKCCPF3WGGPUNCPF CPF period of heavy recession in the early VJGOHGGNNKMGCVQWTKUVFKUEQXGTKPI internationally (led by the USA and 1990s a group of London architects RNCEGUVJG[PGXGTMPGYGZKUVGF6JKU 7- ȁVJCVӑUCTQWPFWPKSWG found a way to promote their profession is the clearest sign Open House Perth visitors (from outside WA) to our by providing access to high quality JCUUVCTVGFVQOCMGCFKɈGTGPEG website annually who are discovering design projects. Some 20 years later our city through its architecture. 1RGP*QWUGKUTGRTGUGPVGFKPCTQWPF On more than one occasion whilst cities across the globe. Australia has the meeting architects from other States, The Open House Perth team is largely most Open House cities of any country, +JCXGPQVKEGFYJGPCUMGFȄYJGTGCTG composed of volunteers who devote which illustrates that as a nation we you from?’ friends and colleagues and their time and energy to promote have a strong appetite for design and a myself respond with ‘Perth’, uttered design in WA on a local, national and desire to bring it into our own homes. in a quiet, hesitant fashion. I believe STUNNING INNOVATIVE CREATIVE international stage. You would be Open House Perth encourages us as a $CEMKPYJGPYGUVCTVGFVJG profession to be collectively proud of UWTRTKUGFVQMPQYJQYHGYQHVJGO process of founding Open House Perth, our local design culture. The quality of are architects. We would love the there were more than a few sniggers design in WA is getting better and better, profession to be more actively engaged and jeers. ‘Why would anyone want to but it is not easy pushing the value of in helping to facilitate Open House IQKPVQVJGEKV[VQNQQMCVCTEJKVGEVWTG!ӑ design in a state with a culture that Perth to ensure a continued presence YGYGTGCUMGF1WTTGURQPUGȏ GPEQWTCIGUGZEGUUKXGURTCYNHCUVVTCEM on the WA annual event calendar. ‘people in Western Australia will travel d&c and building life spans at 20-25 9JGVJGTKVDGVJTQWIJɑPCPEKCNUWRRQTV around the world to celebrate the years rather than 100+. As a profession or helping to facilitate high quality architecture and vibrancy of other we have an uphill battle ahead of us; destinations for the annual event or cities; why would they not want to UVKNNNQQMKPICTQWPFCVVJGSWCNKV[QH pop-up Open Houses or volunteering explore their own home town?’ design projects in metropolitan and on the day, we need your involvement. regional areas it is clear that WA has the As architects the desire to travel VCNGPVVQVCMGVJKUEJCNNGPIGJGCFQP As a profession I believe that architects and visit great examples of the built need to strongly demonstrate our value environment is ingrained in our Since 2012, Open House Perth has to the built environment as an essential DNA. Seeing the architecture and facilitated almost 105,000 visits to part of the design and construction Since 2003 the experienced master craftsmen of Polished Plaster have been urban environment of great cities is destinations across the CBD and its process. We need to establish stronger delivering high quality, bespoke surface ﬁnishes to suit every style for both something that inspires us, engages fringe suburbs from large venues with lines of communication to the interior and exterior application. us and educates us. It does so in a the capacity to hold 25,000 visits to general public (and our future clients) The Polished Plaster Company more technical way than the average high security sites with an allowance and Open House Perth provides an With an ever growing range of sustainable decorative surface solutions, Polished Unit 16/31 Stockdale Road, traveller who might wonder why we QHRGQRNG#UCPGXGPVQWTCKOKU Plaster’s products are both durable and versatile. O’Connor, WA 6163 photograph window mullions, door to showcase local architecture to the extraordinary opportunity for this jambs or shadowline details. But those general public, to encourage people VQQEEWT9GVJCPMCNNVJQUGYJQ Polished Plasters perfection in detail has led to clients nationwide, including high-end travellers who traverse the globe are also to not only be proud of their built have sponsored, volunteered and T: 08 9331 1569 international retailers Louis Vuitton, Burberry, Armani, Salvatore Ferragamo in search of inspiration, engagement environment but also to celebrate participated in Open House Perth M: 0424 260 367 and Western Australia’s Morrison and education. So what would it be KVCPFKVӑUPQVLWUVJCXKPICPGɈGEV UQHCTCPFCUMHQT[QWTEQPVKPWGF E: [email protected] NKMGVQHGGNNKMGCVTCXGNNGTKP[QWTQYP locally. Around 20% of visitors to the support so we can help promote great home town? One of the most repeated Open House Perth website are from local design for years to come. ɻ Authorised applicator of Showroom viewings by appointment

www.polishedplaster.com.au - 18 - - 19 - design advisory committees in perth Author Carmel Van Ruth

Design review has become an The State’s 'Better Places and Spaces: DAC design review processes increasingly common practice in A Policy for the Built Environment in DGPGɑVFGXGNQRGTUFGUKIPGTU.QECN metropolitan Local Government Western Australia' 2 establishes the Governments, and communities. development approval processes over Government’s commitment to pursuing the last decade. Many local authorities &GXGNQRGTUGPLQ[VJGɔGZKDKNKV[VJCV KORTQXGFFGUKIPSWCNKV[KPRWDNKEYQTMU are observing an increase in high density FGUKIPTGXKGYQɈGTU#YGNNOCPCIGF RTQLGEVU6JGCODKVKQPVQUGGMIQQF WTDCPKPɑNNFGXGNQROGPVRTQRQUCNU FGUKIPTGXKGYRTQEGUUQɈGTUNCVKVWFGVQ design outcomes is an equally worthy as developers respond to a growing depart from (often prescriptive) Local pursuit in private sector development. OCTMGVCRRGVKVGHQTFKXGTUGJQWUKPI Government policies in order to deliver choices in established areas. Most Local To provide a mechanism to consider the KORTQXGFRTQLGEVCPFUKVGURGEKɑE Governments are encouraging higher SWCNKV[QHKPɑNNFGXGNQROGPVCPWODGT outcomes. Where senior decision- FGPUKVKGUKPTGURQPUGVQKPɑNNVCTIGVU OCMGTUCTGCDNGVQRCTVKEKRCVGKPFGUKIP 1 of Local Governments have appointed UGVD[ &KTGEVKQPU . These larger TGXKGYUUQNWVKQPUECPDGDTQMGTGF developments - typically mixed-use or multi-disciplinary Design Advisory collaboratively, enabling a smoother OWNVKTGUKFGPVKCNJCXGCUKIPKɑECPV Committees (DACs). These committees approvals phase following endorsement. impact on the public realm, adjacent QɈGTKPFGRGPFGPVGZRGTVCFXKEGQP development and the surrounding VJGFGUKIPSWCNKV[QHRTQRQUCNUVQUVCɈ +PTGURQPUGVQVJGQɈGTQHFGXGNQROGPV community. Elected Members and applicants. incentives and bonuses for good design, UQOGFGXGNQRGTUCTGUGGMKPIQWV It is important that these developments 6JGHQTOGT%KV[QH8KPEGPV/C[QT architects who have previously earned are well designed. Multi-residential Alannah MacTiernan observed that FGXGNQROGPVUOWUVYQTMYGNNHQT support for ambitious and exemplary the State Government’s Residential longer than single houses as common projects. These architects report that Design Codes (R-Codes) and the Building ownership limits the ability to their clients often grant them greater substantially alter or redevelop. The Code of Australia 'allow some very latitude to develop quality proposals, 3 performance demands on apartment poor outcomes.' #EMPQYNGFIKPIVJG sometimes with approaches that depart developments are therefore greater as exemplar NSW State Environment from the developer’s usual practice. 4 they need to be able to accommodate 2NCPPKPI2QNKE[ 5'22 In some cases, once the positive aspects a diverse range of changing occupants mechanism - which has resulted in of the built outcomes from these new over this extended time. tangible improvements in the quality of collaborations are realised, the clients multi-residential design 5 - the City of Good residential design can deliver encourage these approaches in other FYGNNKPIUVJCVCTGOQTGNKXGCDNGɔGZKDNG 8KPEGPVCRRQKPVGFC&#%CPFGODGFFGF jurisdictions where the incentives CFCRVCDNGKPWUGEQUVGɈGEVKXGVQQRGTCVG a design review process, including the don’t apply. The commercial return and maintain, and suitable for a wider 5'22ӑU&GUKIP2TKPEKRNGUKPVQVJGKT CPFTGRWVCVKQPCNDGPGɑVUQHIQQF variety of occupants. development approvals process. design are enough. ɾ

Railway 23, Railway Road, Subiaco, McDonald Jones Architects Image: BINYAN 1 Government of Western Australia, Directions 2031 and Beyond, August 2010 2 Government of Western Australia, Better Places and Spaces: A Policy for the Built Environment in Western Australia, 2013 3 Alannah MacTiernan, Better Design Key to Healthy Urban Living, The West Australian, May 7, 2013, p16 4 New South Wales Government, State Environmental Planning Policy No 65; Design Quality of Residential Flat Development (SEPP65) 5 NSW Department of Planning and Infrastructure, SEPP 65 & Residential Flat Design Code Review, November 2011

- 20 - - 21 - 5MKNNGFCPFGZRGTKGPEGFCTEJKVGEVU regarding the perceived impacts of .CPF%QTRӑU%QEMDWTP%GPVTCN6QYP The Department of Planning’s current CTGPGGFGFHQTKPɑNNFGXGNQROGPVU KPɑNNFGXGNQROGPV'NGEVGF/GODGTU Centre Design Guidelines / Detailed Area Blueprint for Planning Reform 9 proposes which are always complex endeavours CPFRNCPPKPIUVCɈKPXQNXGFKPVJGUG Plan which supports the design review initiatives that have great potential to assist demanding a thoroughly considered design review processes participate in process. VJGYQTMQH&#%U6JGRTQRQUGFPGY5VCVG design response, and to meet the discussions of design quality and some 2NCPPKPI2QNKE[EQWNFFGɑPGCPFEQPɑTO Each Local Government DAC has heightened requirement to respond enthusiastic supporters emerge. the importance of design quality in the built appropriately to the local context. formed independently, so naturally environment, setting consistent parameters Architects are educated, and then 2TQHGUUQT)GQɈTG[.QPFQPHQTOGT the approaches vary. Navigating for all DAC processes and providing practice, in a culture of design review. Western Australian Government VJGFKɈGTGPEGUKPVJGRCTVKEWNCT statutory support to align DAC, DAP and Architects generally welcome and enjoy #TEJKVGEV ȁ CPF8KEVQTKCP requirements of each jurisdiction is SAT evaluations of design quality. It could the iterative process. Design teams Government Architect (2008 - 2014) challenging and time-consuming for CNUQQɈGTCȄDGUVRTCEVKEGӑOQFGNHQT&#% DGPGɑVD[ICKPKPIKPFGRGPFGPVCFXKEG QDUGTXGUKPCPCTVKENGTGɔGEVKPIQPJKU FGXGNQRGTUCPFOCP[CTGUGGMKPIC processes. from a range of design disciplines, GZRGTKGPEGYKVJVJG8KEVQTKCP&GUKIP greater consistency in the approvals #UKPVJGECUGQH5'22VJGRTQEGUUQH early validation of design approaches Review Panel process, that ‘[design process. The review process itself design review would allow the proposed State and certainty during the development review] allows clients, local authorities can vary. Some committees consider Planning Policy to be performance-based and of detailed designs. Some architects CPFQVJGTUVCMGJQNFGTUVQJGCTKPHQTOGF RTQRQUCNURTKXCVGN[CPFQɈGTHGGFDCEM QWVEQOGUHQEWUUGFVQQɈGTFGXGNQRGTUVJG refer to design review processes as discussion about design. It gives design QPN[VQRNCPPKPIUVCɈYJKNUVQVJGTUQɈGT ɔGZKDKNKV[VJG[UGGM(QT.QECN)QXGTPOGPVU ‘collaborations’. intelligence a public airing, allowing the a more generous approach, inviting and other approval authorities it would complexity and rigour of designing to be FGUKIPVGCOUVQRTGUGPVVJGKTYQTM alleviate the need to generate detailed policies For Local Governments, implementing openly discussed and, as a result, better and participate in the consideration of and provisions to guide general design a design review process signals the understood by those outside the design design issues. Written advice generally 6 quality. A net reduction in ‘red tape’ should importance placed on design quality by disciplines.’ follows. Some DACs utilise guiding www.myareeceramics.com.au the Authority. Once familiar with the principles of good design and these form result. +VKUGXKFGPVN[DGPGɑEKCNVJCV&#% 91 Norma Rd, Myaree 08 9330 3611 Local Government area, DAC members the basis for design review. These may 'XKFGPEGQHVJGRQUKVKXGYQTMQH&#%U processes are well supported, not only ECPDTKPIEQORTGJGPUKXGMPQYNGFIG CRRGCTVQFKɈGTDGVYGGPEQOOKVVGGU is slowly emerging through better built D['NGEVGF/GODGTUCPFRNCPPKPIUVCɈ of context, community, history and The City of Fremantle and City of QWVEQOGUJQYGXGTVJGDGPGɑVUCTG[GVVQDG but by statutory means. This ensures future direction. DACs can recommend Subiaco DAC processes use design widely appreciated. In the interim, we only improvements to strategic policy based FWGTGICTFKURCKFVQ&#%ɑPFKPIUKP RTKPEKRNGUDCUGFQPVJG7-%QOOKUUKQP PGGFVQNQQMCVVJGVCPIKDNGKORTQXGOGPVUKP QPDGUVRTCEVKEGMPQYNGFIGCPFEQOOQP Development Assessment Panel (DAP) for Architecture and the Built VJGSWCNKV[QHWTDCPKPɑNNUGGPKP059UKPEG design issues which they have observed. and State Administrative Tribunal Environment (CABE) Seven Principles of VJGKORNGOGPVCVKQPQH5'2210 to see that 7 DACs can support Elected Members (SAT) processes, providing certainty for Good Design. 6JG%KV[QH8KPEGPVCU design review is a worthwhile endeavour. as guardians of the community’s developers. The leading examples are QWVNKPGFCDQXGWVKNKUGUVJG0595'22 ɻ aspirations and expectations. In some the City of Fremantle’s Local Planning 10 Design Principles.8 If we were to instances, DAC design review processes 5EJGOGYJKEJɑTON[GPUJTKPGUVJG scrutinise these provisions we would see have helped ease community concern role and mandate of the DAC; and VJG[CTGUGGMKPIUKOKNCTQWVEQOGU

6 Geoffrey London,Reviewing Design Review, Architecture Australia, January 2014 (Volume 103 No 1) Mary Davies library and 7 http://webarchive.nationalarchives.gov.uk/20110118095356/http:/www.cabe.org.uk/councillors/principles community centre, Baldivis 8 New South Wales Government, State Environmental Planning Policy No 65; Design Quality of Residential Flat Development (SEPP65) Site Architecture 9 Government of Western Australia; Department of Planning, Planning Makes it Happen: Phase two – Blueprint for Planning Reform, August 2014, p19 10 NSW Department of Planning and Infrastructure, SEPP 65 & Residential Flat Design Code Review, November 2011

- 22 - - 23 - perth cultural centre: urban life laboratory Authors Mimi Cho and Frazer Macfarlane

When considering Perth over the last 10 Architect – Phillip Griffiths was a decision not to spend too much years, the Perth Cultural Centre can be Director Griffiths Architects money on the buildings on William seen as a test bed for urban revitalisation 5VTGGVLWUVGPQWIJVQIGVCFKɈGTGPV strategies in Western Australia: a desolate It has been an interesting period. MKPFQHVGPCPVOKZUQOGVJKPIHTGUJ place blighted by the over-scaled ‘build it and The [Perth] Cultural Centre was the idea Liquor licensing refused a very big they will come’ strategies of the 80s and 90s of the City of Perth and was included QɈGTKPIYJKEJJCUIKXGPKORGVWUHQT mall culture. The James Street precinct had in the Metropolitan Region Scheme smaller and more diverse venues. big institutional destinations and heritage VJCVɔQYGFHTQOVJG5VGRJGPUQPCPF So once William Street was rolling along, buildings steeped in history, but nothing to Hepburn Plan of 1955, implemented connect them together. The Metropolitan there was an impetus to do something by the State Government. Early in its Redevelopment Authority1 (MRA), operating in the Cultural Centre itself. A whole development stages there was a Cultural as a well resourced pair of garden shears lot of people got involved in landscape, Centre committee, which was meant to for red tape, rendered the Cultural Centre children’s play, brainstorming for some a ground of architectural experimentation. operate as a bridging mechanism for tiny things. Most of what we were doing Architects, landscape architects, artists, the good of the institutions and their placemakers and events organisers were environment. Although the committee was not meant to be permanent, rather commissioned to ‘revitalise’ the space with consisted of eminent people from the transitional until there’s money to do temporary and short term projects, bringing property industry, the arts, the City UQOGVJKPIOCLQTVQHWNɑNNCPCFQRVGF 2 to mind Rem Koolhaas’ project Exodus, or and statutory bodies, it didn’t have XKUKQP+VJKPMCHVGTVJG0GY/WUGWO Voluntary Prisoners of Architecture by way of any power or resources to implement is done, it will be time to do the Cedric Price’s Fun Palace - a space dedicated its ideas. The last big push from that RGTOCPGPVɑZCPFGPJCPEGVJG to pop culture and mass consumption; the public domain. strut that Robert Hughes found lacking EQOOKVVGGYCUVQKPXKVG&GPVQP%QTMGT in the Modern metropolis.3 Part of this Marshall to come up with some ideas 6JGɑTUVVJKPIVQJCRRGPVQGPJCPEGVJG revitalisation effort was the installation of a about how to improve the public large public screen, and during Architecture domain. The basis of that was recreating public domain was painting colours on Week 2014, ﬁlms made by architects, James Street as a thoroughfare, and the steps. Then Jean-Mic Perrine was classic artists and students from around the world having much more interesting public engaged, an architect and also a builder, were shown as part of the inaugural Urban spaces and better designed urban who designed and manufactured the Screening. spaces. It died a death. concrete pods [which provide minor 0 Ë. Ë .. ËVË8 Ë.#!.Ë :Ë # Ë! Ë#^Ë.0: Ë- !.Ë 0 -! services]. At the same time Josh Byrne Mimi Cho and Frazer Macfarlane, curators Then the MRA was given carriage did the Urban Orchard. All these spaces of the Urban Screening, spoke with Phillip were empty and slightly derelict prior to Griffiths from Griffiths Architects, who of the Cultural Centre in 2004. The was engaged by the MRA in 2011 to provide remit included properties on William the project. The Urban Orchard used to architectural services for the LED Screen, Street, originally acquired for the be a sculpture court [but] Northbridge and Rob Cameron, who had four works Perth Cultural Centre. The MRA is in a was such a poor environment prior to showcased in Urban Screening 2014, about WPKSWGRQUKVKQPQHPQVJCXKPIVQOCMGC VJGYQTMVJCVUEWNRVWTGUYGTGDGKPI changes in Perth over the last 10 years and RTQɑVQWVQHGXGT[VJKPIVQDCNCPEGQWV FCOCIGFCPFVCMGPCYC[6JGPVJG their work. investment in an overall sense. There idea of the screen came up. ɾ smeg.com.au

1 The precinct was initially under the purview of the East Perth Redevelopment Authority, which after restructuring became the MRA in 2011. 2 with others 3 The Shock of the New, British Broadcasting Corporation, 1980 SMEG AUSTRALIA PROUDLY SUPPORTING AIA: WA CHAPTER

VISIT OUR SHOWROOM 59 CARRINGTON- 24 - ST NEDLANDS 9389 8000 - 25 - SMA15707 +VJKPMVJG/4#YCUCRRTQCEJGFVQFQ %WNVWTCN%GPVTG?KUCDKVVCEM[CPF the good times there, while he posted it - they had one down the other end of requires the ongoing commitment videos of the demolition. I didn’t feel James Street in the Northbridge Plaza. to curating it. The MRA was aware of bad about seeing it blow up [in the There was a lot of coordination, because VJCVCVVJGQWVUGV6JG[MPGYKVYQWNF animation] - I was separated from it no one had done one outside of sports be a small amount of money invested (even though I researched and wrote a in hardware and a lot of money in stadia, and this screen was going to be piece on it). Seeing it being demolished seen from all sides. A number of people sustaining it, so there are no surprises is a brutal, violent act; these cranes, had been engaged to do the bits, so there. It’s just a step along the way. We’ll NKMGFKPQUCWTUDKVKPIEJWPMUQWVQH really our problem was, where do we put UGGUQOGVJKPIEQORNGVGN[FKɈGTGPV it. It is a strangely beautiful thing to the screen, how do we service it, where when there’s money again, which isn’t watch it being demolished, almost can we have a control room, how do we going to be for a long while now. The shroud it? It’s pretty functional; fans, JQTK\QPHQTVJKUYCUɑXGVQ[GCTUVQRU sublime. [The middle of the animation VJGUETGGPOQFWNGUCPFUQQPCDTCEMGV but I can see it still being there in 20 where the piece shifts from nostalgia] to hold them on. I couldn’t say there was years now. relates to the violence of urban renewal, 4 anyone in control of the whole idea. éventrement. It’s portrayed as healing Dead Reckoning v2.0 was an opportunity 6JCVKPXQNXGFOCMKPIOQTGQHVJG environment be able to react, and then 9G=)TKɋVJU#TEJKVGEVU?YGTGKPEQPVTQN Interactive Media Artist – Rob Cameron the city. to continue research that I had been data visible. As people were moving, have people interact in a way that they of the screen and the associated parts creator //thedeadpixelproject doing as part of my studies at UWA. the script was drawing the contours of hadn’t been able to previously. that went with it, but there were all these The Final CurtainYCUCRKGEGQHYQTM It’s always a loss to see a part of Perth’s #RCTVQHVJCVTGUGCTEJYCUNQQMKPIKPVQ their motion so you could physically other minor projects happening around I did with [WA artist] Jon Tarry as part identity disappear especially after all computer vision, and how that can be see silhouettes of them moving around, My biggest fear was that people it. We would go there, see new things QHCP#TEJKVGEVWTCN8KUWCNKUCVKQPWPKV VJGUVQTKGUCPFKOCIGU=QPVJG(CEGDQQM used to feed into the design process and at the same time you could see the wouldn’t interact with or ‘get’ it. of buildings. The Urban Screening centre point of each person drawing The most important question about JCRRGPKPICPFVJKPMȄYJQQTICPKUGF I was doing at UWA. He was running a group]. [It was interesting] for me as ICXGOGCPQRRQTVWPKV[VQNQQMCVVJG CVTCKN#PGVYQTMQHRCVJUYQWNFNC[GT VJGYQTMKUȄECP[QWFGUKIPCRKGEGQH VJCV!ӑ9GYGTGVT[KPIVQOCMGɑUVQHKV project on the demolition of the Perth CPQWVUKFGTDGKPICDNGVQNQQMCVVJG more artistic and aesthetic outcomes WRQXGTVJGEQWTUGQHOKPWVGUNKMGC architecture that has a sympathetic ȄJGTGӑUCNNVJGDKVUYJCVECPYGOCMGKV Entertainment Centre and we co- Entertainment Centre without rose- QHVJGYQTM+YCUNGCTPKPICU+YCU spider’s web, but then they would fade response with an individual?’ You need NQQMNKMG!ӑ)GVUQOGQTFGTKPKV directed an animation I produced which tinted glasses, to see it for what it was going. There were a lot of outcomes of away and new information would get that moment of realisation that this explored the nature of the demolition, and see it for how much value it had the script [computer program] which written over the top. So it was more of thing is communicating with you. Once Part of the reason we could do these and of collective memory. It was an as a site of memory rather than as a I didn’t get to explore in detail in my CVGORQTCNGɈGEVDGKPICDNGVQXKUWCNN[ that happens it is a beautiful moment things was that no one thought that the interesting thing for me, because I never piece of architecture. At the same time UVWFKGUCV79#CPFVJKUCFFKVKQPCNYQTM TGRTGUGPVVJGHQTOQHURCVKCNɔQYUOCFG when there is this conversation between existing urban environment had much went to the building - I only saw it from +YCUYQTMKPICV#4/=#UJVQP4CIICVV CNNQYGFOGVQɑPGVWPGCUETKRV+VGUVGF the experience more interesting. the display and the viewer - people value as it was. No one thought the a distance as this abandoned space. In VJGRTGXKQWU[GCTCVVJG/#0; running around trying to draw things public spaces were precious. So that’s VJGCPKOCVKQPVJGTGYCUJKUKPɔWGPEG McDougall] and actively involved in $NQEM2CTV[=1EVQDGT?CPFVJKPM 6JGRTQLGEVKPVJGɑTUVRNCEGYCUCRTQQH or happy watching themselves being what the opportunity was: something a nostalgic view, and my view of an the design of the building which would CDQWVJQY+EQWNFOCMGKVCPKPVGTCEVKXG of concept for the idea of being able to watched. [During the Urban Screening, we can play around with, and it’s not CNKGPVJKPI,QPETGCVGFC(CEGDQQM replace it. It wasn’t the most impressive experience in the urban space, rather VTCEMPQVQPN[RGQRNGYKVJKPCURCEGDWV &GCF4GEMQPKPIX?JCFFKɈGTGPVNKHG forever, so let’s not over-invest in it. page for people to post images of their building in the city but I had a very than just an analytical tool. other information as well, and have the FGRGPFKPIQPVJGFC[QHVJGYGGM Some of what’s been done [in the experiences, to reminisce about all strong appreciation for it in the end. ɾ

4 “Haussmann used the term eventrement ‘disemboweling,’ for his interventions, suggesting the treatment of a pathological disorder” - Michele Lamprakos, ‘The Idea of the Historic City’, in Change Over Time: An International Journal of Conservation and the Built Environment. 4.1 (Spring 2014): page 14.

- 26 - - 27 - + COMMERCIAL PLANTERS + VERTICAL GARDENS + LASER CUT SCREENS + OUTDOOR ORNAMENTATION

If it was really quiet you’d get a solitary the contributors who made their work RGTUQPYCNMKPICNQPIVJG[OKIJVYCXG available for inclusion, the Perth Cultural VJGKTJCPFUCPFMGGRIQKPIQTVJG[UVCTV Centre Screen curatorial and technical performing in the space and suddenly team, the City of Perth, the MRA and the KVӑUNKMGCVCDQQӑUDGGPDTQMGPCPFKVӑU1- staff at the WA Chapter of the Australian HQTGXGT[QPGVQUVCTVOWEMKPICTQWPF Institute of Architects. For the full list of =1PGFC[?VJGTGYGTGUEJQQNMKFUFQKPI works and contributors, please visit the ECTVYJGGNUɔKRUCPFLWORUIQKPICNN project website at www.urbanscreening. over the place - it came alive! org. The Architecture Week Urban Buildings can have a ‘personality’ and Screening will return in 2015, email communicate without the need for [email protected] to register heavy technology but the possibilities your interest. ɻ for social and cultural change are FKɋEWNVVQKIPQTG#TEJKVGEVWTGCUC RTQHGUUKQPJCUDGGPUNQYVQVCMGQP board technologies that are already having major impacts on our experience QHWTDCPURCEGU/[YQTMKUHQEWUGFQP experimenting with and interrogating this emerging techno-social environment.

Urban Screening is an event that explores the possibilities of architectural thought and production from architects, students, artists and filmmakers in the medium of video. It is a public event which sees architectural ideas inhabiting the city, and being made available to the public in a manner which aims to be sophisticated and thought-provoking in its promotion and communication of the importance of architecture’s achievements and possibilities. The curators of Urban Screening 2014 would like to thank all

SPECIALISING IN LARGE SCALE ARCHITECTURAL PLANTERS AND SCREENING FOR EXTERIOR SITUATIONS. CUSTOM DESIGNS AVAILABLE. EXCLUSIVE SUPPLIERS OF THE SERRALUNGA 1825 OUTDOOR COLLECTION.

12-14 DRAKE ST, OSBORNE PARK | P 9443 7993 | OPEN MON – SAT 9-5 | WWW.WATERGARDENWAREHOUSE.COM.AU - 28 - - 29 - essay.

- 30 -- 30 - 31 -- 31 -- office of the government architect

)GQɈ9CTPYCUCRRQKPVGF9GUVGTP#WUVTCNKCP)QXGTPOGPV#TEJKVGEVKP0QXGODGTa I consider that the strategies listed YQTM#VKVUUKORNGUVKVKUVJKUEGPVTCN Projects is the central activity where *GHQNNQYGF5VGXG9QQFNCPFYJQUGTXGFKPVJGTQNGDGVYGGPCPFCPF2TQHGUUQT)GQɈTG[.QPFQPYJQ CDQXGQɈGTCWUGHWNUVCTVKPIRQKPV issue – 'What is the real value of good the OGA provides hands-on guidance was the inaugural appointee when the position was re-established by the Western Australian State Government for establishing the conditions for design?' – that is the greatest challenge to a certain number of Government’s KPa)GQɈTG[5VGXGCPF)GQɈUJCTGVJGKTTGɔGEVKQPUQPVJGKTVKOGȄKPQɋEGӑMG[CEJKGXGOGPVUCPFVJG RTQFWEKPIFGUKIPSWCNKV[1VJGTMG[ in the role of Government Architect. projects (generally the larger, higher architectural and political context of the day. factors that will impinge on design What we as designers feel intuitively RTQɑNGYQTM CPFKUVJGRTCEVKECN quality, and to which a Government needs to be articulated to Government opportunity to illustrate the outcomes #TEJKVGEVECPOCMGCWUGHWN objectively and compellingly. It is not of good design. contribution, include the selected a well or broadly understood notion in method of project procurement, Advocacy is crucial: constant advocacy Geoffrey London This description proved a useful and and a resultant loss of design and build Government and requires constant and VJGFGɑPKVKQPQHVJGDTKGHCPFVJG for the importance of good design and WA Government Architect 2003 - 2009 ɔGZKDNGHTCOGYQTMHQTVJGYQTMVJCV quality in many public buildings. This convincing argument (in the face of establishment of appropriate budgets. the ability to articulate the long term YCUUWDUGSWGPVN[WPFGTVCMGP emerging outcome served to focus RGTEGKXGFɑPCPEKCNPGICVKXGU values (including value for money) that +PCHVGTEQPUKFGTCDNGNQDD[KPI The position was accommodated at the VJKPMKPIQPTGGUVCDNKUJKPICTQNGKP In the end, however, it’s up to the arrive out of sound creative thought. from the local Chapter of the Royal &GRCTVOGPVQH*QWUKPICPF9QTMU Government to provide advocacy and For this reason the very existence of the commissioned architect to produce First and foremost it is advocacy to Australian Institute of Architects, an uncomfortable amalgam of two RTQEGUUGUHQTUGGMKPIDGVVGTSWCNKV[ role of the Government Architect will VJGJKIJSWCNKV[YQTMVJGRKGEG Government itself, but also more the newly created position of previously independent departments. architecture in public buildings. always be inherently fragile. For many, of architecture that meets client broadly to the community. Evidence- Government Architect in Western The former Department of Public the role was seen as elitist and adding expectations, that is sustainable, based design plays a big role here Australia was advertised, having been 9QTMUYJKEJYCUFKUUQNXGFKP As a result of early research and unnecessary expense to a capital budget that contributes positively to the ȁVJGCDKNKV[VQSWCPVKH[DGPGɑVUCPF modelled on the Queensland role had an exemplary tradition of 84 years, study trips, a number of processes always under pressure. It was certainly broader urban setting, and that attributes of good design in a universal created two years earlier. Advice was not only of designing and delivering were implemented by the WA something to which I was sensitive. all the public buildings in Western expands the culture of a place by and meaningful way. In parallel with UQWIJVHTQO/KEJCGN-GPKIGTVJG 1ɋEGQHVJG)QXGTPOGPV#TEJKVGEV 1PVJGDCEMQHVJGUKIPKɑECPVYQTMQH Australia during that period, but also the appropriateness, strength and the sense of the fragility of the role, we inaugural appointee in Queensland, FWTKPIVJGɑTUVɑXG[GCTU )GQɈTG[.QPFQPKPGUVCDNKUJKPIVJG as a crucible, a receptive training resolution of its informing idea. were, and are, also faced with a crucial, and a well-worded ambition for the role, I was very conscious of not letting ground, for young architects. WA position was prepared, forming – Select architects by design- FGɑPKPIRGTKQFKPVJGFKTGEVKQPQHQWT The above is adapted from Geoffrey London’s the role be devalued by Government. To VJGMG[EQORQPGPVQHVJGPCVKQPCN based procedures State and capital. After 1985, successive Governments contribution to the book, Procuring Innovative VJKUGPFYG 1ɋEGQHVJG)QXGTPOGPV advertisement for the job: – Demand evidence of design Architecture (2010) by Leon van Schaik, Geoffrey relied on the private sector to deliver all Architect, OGA) decided to focus on ability in Expressions of Interest London and Beth George, published by Routledge. Western Australia is at a pivotal point VJGKTCTEJKVGEVWTCNYQTM6JKURTQEGUU VJTGGUVTGCOUQHYQTMȁ2QNKE[2TQLGEVU The purpose of the Western and Requests for Proposal on its journey into this century as we was accompanied by the problematic and Advocacy. Australian Government Architect – Pay appropriate fees to architects grapple with our identity as place set issue of how the architectural services is to provide leadership and ȁ 7UGFGUKIPYQTMUJQRUCPF Steve Woodland against our inevitable growth. We are were to be procured. The local Policy is the most enduring strategic advice to Government to design reviews WA Government Architect 2009 – 2013 at the precipice of great change and profession attempted to ensure that mechanism in Government for achieve the objective of improving with that change we have a rare quality-based selection procedures – Recognise and commission As architects and designers we generally embedding the ideas and values of opportunity and responsibility to the design of public buildings were used, but the Government’s need emerging architects act with the intuitive belief that IQQFFGUKIPCPFKPKPɔWGPEKPIVJG shape our growth in a way that and spaces and enhancing the to demonstrate ‘value for money’ from – Research best-practice examples creative thought has great value – that way decisions are made. The Built is meaningful to us as Western quality of the built environment. the appointments became the focus – Facilitate conversations where we produce design excellence it Environment Policy Better Places Australians. And we do this under a for concern as, inevitably, the level of about architecture within and Spaces 4 was the headline piece It is intended that the Government the fee proposed by architects in the the local profession carries positive worth for our society the gaze of the world – we have never QHYQTMKPVJKUTGICTFUWRRQTVGFD[ Architect have a whole of competitive bidding process came to – Foreground lifetime costing and wellbeing. For many of us it is been as visible on the global stage. Government focus and, where be perceived by the profession as the – Champion design across this very belief in the broad value of the development of a raft of Design Our built environment is central to requested, provide advice to the MG[FGVGTOKPCPV#UCTGUWNVHGGUYGTG government agencies design that drives us forward in our 5VCPFCTFUCPF&GUKIP8CNWGFQEWOGPVU this future. The built environment ɾ highest levels of Government. bid at very low levels, threatening a – Explore policies that enable decreased level of professional service or demand good design. 1 http://www.ﬁnance.wa.gov.au/cms/Building_Management_and_Works/Better_Places_and_Spaces.aspx

- 32 - - 33 - is fundamental to our quality of life. or peripheral. Political support and environment policy Better Places and In this respect Melbourne is a popular for investment in apartments. And climate. The local design context is We spend the dominant proportion understanding is always fundamental Spaces which Steve and his team were so DGPEJOCTMHQTKVUCTEJKVGEVWTGCPF QHEQWTUGGɈGEVKXGRWDNKEVTCPURQTVKU pretty thin, which tends to furnish the of our daily lives engaging with the in achieving these things and I was instrumental in bringing to fruition. active urban environment, and pivotal. underwhelming and poorly conceived buildings and places that surround us fortunate to have been listened to RNCPPGTUEQOOQPN[NQQMVQ2QTVNCPF design proposals we too often see at the 5GCVVNG&GPXGTCPF8CPEQWXGTHQT To these ends, the OGA is assisting 1)#6JKUFKOKPKUJGUQWTGɈGEVKXGPGUU and they need to be safe, attractive, and acted upon at many levels. It was This is an important document. functional, productive, sustainable, VJGKTKPVGITCVGFVTCPURQTVPGVYQTMU the State government with planning KPCFXQECVKPIVJGDGPGɑVUQHCTEJKVGEVU a great privilege for me to be in the A Government-endorsed policy is GɋEKGPVCPFKPURKTKPI role and I have fond memories of my that function alongside relatively reform. We have also been investigating and design. a very useful tool, and the extent four or so years. Most importantly I high levels of car ownership. If we are the mechanics of NSW’s residential to which government agencies are Our urban and regional centres are was surrounded by an OGA team of honest though, Los Angeles probably RNCPPKPIRTQXKUKQPUMPQYPCU5'22 While commercial imperatives willing to embrace Better Places and currently facing a number of challenges dedicated, passionate people for whom remains for Perth the model that The results from a comprehensive dominate this era, and the traditional – international economic uncertainty, the high order importance of design was Spaces is encouraging. As this interest KUKPITCKPGFOQUVɑTON[KPVQVJG TGXKGYQHVJG2QNKE[ӑUɑTUVFGECFGQHWUG status of architects has changed, many population growth, environmental RCTCOQWPVCPFYJQYQTMGFEQPUVCPVN[ signals some appreciation of design’s replete mechanisms woven into our are impressive and encouraging. in our profession could do better. pressures and social inequality. This for its improvement. contribution to the development of the OCVTKZQHEKV[OCMKPI9JKNGVJG 9GCTGCNUQYQTMKPIYKVJVJG%KV[ We should not lose sight of the fact means that achieving good design 5VCVGYGCTGMGGPVQCUUKUVIQXGTPOGPV FGVTKOGPVCNGɈGEVUQHURTCYNCTGYKFGN[ of Perth for more coordinated that architects, planners and designers in our built environment is more agencies to accomplish good results CEMPQYNGFIGFVJGU[UVGOKEEJCPIG infrastructure delivery and better are at the forefront of astounding VTCPUHQTOCVKQPCPFYGCTGNWEM[VQ important than ever to ensure that Geoff Warn with their projects. A more informed needed for a less car-dominated city is built outcomes. not so easy. be able to contribute. It also seems these challenges are addressed in a WA Government Architect 2013 - appreciation of design quality and the Public art is another area of interest. to me that architecture is enjoying considered, strategic and holistic way OGCPUD[YJKEJKVUDGPGɑVUECPDG Over the past decade or more my 9KVJEKVKGUCUNKXKPICPFYQTMKPIRNCEGU Most of the projects involving the OGA immense popular appeal. So, under and so as to maximise the long-term CEJKGXGFCTGMG[RTGQEEWRCVKQPUHQT DGPGɑVUVJCVTQDWUVFGUKIPECPDTKPI predecessors have done much to EQOGCRCTVOGPVU#ICKPWPNKMGOQUV JCXGCUKIPKɑECPVRWDNKECTVEQORQPGPV these conditions, what type of place the OGA. position the OGA well in this State, big cities, we are learning how to live in The quantity and nature of public art do we want to leave for future Our capital city is undergoing its biggest and they remain enthusiastic apartments, or near them. The quality CTGDGIKPPKPIVQJCXGCFGɑPKPITQNG generations? What will be the legacy change in a century. Re-acquainting CFXQECVGUHQTVJGXCNWGQHVJG1ɋEG #UGZRGEVGFOWEJQHQWTYQTMKU of apartment design is therefore crucial in the image of Perth and consequently from our time in the sun? ɻ QWTUGNXGUYKVJVJGTKXGTDTGCMKPIFQYP On accepting the appointment I was focused on the city. The relationship to an appealing urban environment. the role of art in the built environment Perth City and its suburbs are absorbing KUCVQRKEQHITGCVKPVGTGUV.QQMKPIHQT the great divides of roads and rail, and immediately invited onto the between architecture and urban life is apartment buildings, many in the form ways to solicit excellent urban art from understanding Perth as a big picture evaluation team of the new Perth globally topical as many of the world’s EQOOQPN[TGHGTTGFVQCU KPɑNN RTQLGEVU this unprecedented opportunity is an capital whose extent is much more than 5VCFKWOCPFVJG1ɋEGVJTQWIJ cities are expanding rapidly and facing To curb sprawl - ahead of our State’s ongoing investigation. LWUVC%$&#VVJGɑPGITCKPDTGCVJKPI Strategic Projects, continues to be the pressures and pleasures of growth. steadily increasing population - the daily life and richness into the streets closely involved in this multifaceted So, understandably, urbanisation IQXGTPOGPVJCUUGV KPɑNN VCTIGVUDWV +COKPVJGɑTUVSWCTVGTQHO[ and spaces of the city means reopening WPFGTVCMKPI'NK\CDGVJ3WC[KUCP commands the attention and these are not being met. Greater variety UGEQPF[GCTQHCɑXG[GCTVGTOCPF our capital to the community. Good GSWCNN[UKIPKɑECPVEQOOKVOGPV motivations of industry, academia and and better standards of apartments NQQMKPIHQTYCTFVJGTGKUOWEJVQFQ design does not happen by accident, YQTMKPIYKVJ/4#KPJGNRKPIUJCRG government, and Perth is no exception. with more attention given to urban Our team is small and in the however. It needs to be articulated from the public realm and the commercial $WVQWTEQPFKVKQPFKɈGTUUQOGYJCV amenity and the public realm can only EWTTGPVɑPCPEKCNENKOCVGVJG1)# VJGQWVUGVQHCRTQLGEVCUCMG[QDLGEVKXG developments that are imminent. from those of the great cities of Asia, help raise community acceptance of will remain constrained by funding and then embedded throughout the In addition, the OGA is active across 'WTQRGCPFVJG#OGTKECU9GUGGMVQ denser environments. Changes to UQQWTGɈQTVUPGGFVQDGRTKQTKVKUGF planning, design and procurement the full spectrum of the Projects, rental conditions would also help, as Ideally the OGA should be hosting stages of project delivery. Policy and Advocacy structure reconcile the values and expectations will a focal shift away from the emphasis events to stimulate design dialogues, established during Steve Woodlands’ that underpin the comforts and QPUCNGUOCTMGVKPIVJCVEQOOQFKVKUGU YKVJURGCMGTUHTQOJGTGCPFGNUGYJGTG tenure. We continue to guide convenience of suburban living with This is where the OGA is at its most housing to the authenticities of displays, exhibitions and exchanges conditions synonymous with urban potent and crucial – ensuring that government agencies in their everyday life as the principal criterion to help promote a more creative the process of design is not accidental implementation of the built density and life in city neighbourhoods.

- 34 - - 35 - perth city 2005-2015 (r)evolution Author Adrian Iredale

By world standards ten years is a short an endless combination destined to former East and West becoming the time in the evolution of a city; however intrigue and excite. Much debate has responsibility of a few commercial for a young and emerging city ten focused on the scale of private buildings, companies. years can position the city into the VJGPGEGUUCT[GXKNVQɑPCPEKCNN[ long-term future. The people of Perth subsidise the development and public The private companies approached CTGMPQYPHQTVJGKTRCVKGPEG9GJCXG spaces. While it is premature to assess many of the world’s best architects to waited over 100 years since the Principal VJGUWEEGUUQH'NK\CDGVJ3WC[KVQɈGTU produce designs. The architectural State Architect at the time, George an entry and departure point to our outcome from this process has been Temple-Poole, proposed relocating City, a place of local and international heavily debated, with the majority Perth Central Railway Station further UKIPKɑECPEGKPVGTGUVCPFCUUQEKCVKQP (including myself) unconvinced by north, creating a sequence of civic CɑTUVRNCEGQHKORTGUUKQPɑNNGFYKVJ all the major buildings. At the time of DWKNFKPIUCPFUSWCTGUVQNKPM2GTVJCPF dynamic spaces scaled to the individual Alannah’s statement I questioned what Northbridge. We have waited almost 25 and the masses. We should place faith is better, the world’s best architects years since the 1991 Perth Foreshore in the outcome of this public space and RTQFWEKPIUQOGQHVJGKTYQTUVYQTMQT International Design Competition collectively maintain pressure on the (hopefully) Perth’s architects producing aimed to engage the city with the river. processes that will guide the privately VJGKTDGUVYQTM!9GDGNKGXGKPVJG We are now at a point where some of the owned buildings into quality designs. investment and cultivation of our local major government city projects will be design scene as evidenced in the post completed, are under construction or In 2007 the then Minister for Planning Franco Barcelona renaissance during George Temple-Poole: Perth as it should be about to commence. and Infrastructure Alannah MacTiernan the 1980s and Melbourne during the announced an ambitious government 1990s under the guidance of Professor The public spaces of Elizabeth Quay RTQLGEVVQUKPMVJGEGPVTCNTCKNYC[NKPGU .GQPXCP5EJCKM CPFQVJGTU designed by Ashton Raggatt McDougall NKPMKPI2GTVJVQ0QTVJDTKFIGYKVJVJG (ARM) and Taylor Cullity Lethlean VGTOȄ6CMKPIFQYPQWT$GTNKP9CNNCPF Whilst many consider Potsdamer are expected to open in November building Perth’s own answer to the Platz a poor architectural outcome this year. After considerable public Potsdamer Platz’. Having lived in Berlin it has been commercially successful debate the project has evolved into a during the period of master planning at least at ground level with major UKIPKɑECPVUGSWGPEGQHIGPGTQWURWDNKE competitions and construction of the department stores, restaurants, IMAX spaces animated at the City edges by new centre city with subsequent visits CPFCUKIPKɑECPVECUKPQIWCTCPVGGKPI privately owned buildings, hotels and VQCUUGUUVJGQWVEQOG+MPQYVJCVVJKU such success. The public spaces are QɋEGUYKVJTGUVCWTCPVUCPFECHGU statement contains much truth and IGPGTCNN[KPUKIPKɑECPVNGHVQXGTRTKXCVG Interwoven into the public space will QɈGTUCHGYECWVKQPCT[VCNGU spaces massaged to accommodate be a constellation of food and beverage alfresco eating. Inhabited mostly by MKQUMUCPFTGUVCWTCPVUFGUKIPGFD[#4/ Following an international competition tourists, the long-term viability is and local practices CODA, Matthews the Berlin Senate subdivided the land fragile with most locals angered by the 5ECXCNNKCPFKTGFCNGRGFGTUGPJQQM and sold it to major private companies commercialisation that has resulted These hospitality outlets will support at subsidised prices. At the time this in spaces unfamiliar and alienating to a range of ongoing Metropolitan was highly criticised by the public, Berliners, compromising the original Redevelopment Authority (MRA) concerned with the future of their intention of re-unifying the former events including festivals, pop-ups and EKV[CPFVJGȄU[ODQNKEӑNKPMKPIQHVJG East and West. ɾ

- 36 - - 37 - Developments of this scale necessitate and animated setting created by a new spaces with arcades and open spaces a complex association of relationships typology that sits between architecture, that will continue to improve as the City between parties that are entrusted landscape and art, and the intense .KPMGOGTIGU6JG-GTT[*KNNFGUKIPGF with achieving the delicate balance program of events managed by the State Theatre is perfectly positioned between the commercial desire for MRA. Perth will no longer be limited to VQɑIWTGJGCFVJGEQPPGEVKQPQH RTQɑVCDKNKV[CPFVJGRWDNKEӑUFGUKTGHQT the International Art Festival or Fringe Northbridge and the City centre and the IGPGTQWURWDNKEQRGPURCEG8KUKQP Festival, it will become a non-stop MRA cultural centre events continue to holders, Design Assessment Panels, place of cultural events. This space will excite pedestrians and visitors. State Government and Development challenge the concept that Perth’s only Authorities share responsibility for the democratic place is the beach.1 While these projects dominated the process and ongoing assessment to OGFKCKPVJGDCEMITQWPFJCUDGGPVJG ensure high quality outcomes. The evolution towards these current ɑIJVVQGXQNXGVJGUOCNNUECNGRTQLGEVU As with Potsdamer Platz, the critical projects began with investment by laneways and generally forgotten or public open space for the new City State and local authorities and the QXGTNQQMGFURCEGU9KVJ/GNDQWTPG .KPMYKNNDGHQTOGFDGVYGGPPGY reinstatement of the State Government laneways as a reference point, the buildings and existing public transport Architect position. It continued with the battle and eventual transformation of KPHTCUVTWEVWTG6JGUGURCEGUQɈGTVJG election of a progressive City of Perth our liquor licence laws has empowered HTGGFQOVQTGVJKPMVJGTQNGQHȄEKV[ Mayor, the subsequent engagement of small-scale operators to collectively EGPVTGӑ+P$GTNKPKVKUCNCTIGITCUUGFɑGNF the City Architect and the evolution re-invent our at-ground city and in- (or void), in Perth it will be held in the of the East Perth Redevelopment between spaces. This realm has been arms of the horseshoe bridge. Yagan Authority into the MRA. Collectively, SWKEMVQECRKVCNKUGQPYJCVKUQɈGTGF Square designed by Lyons Architecture VJGUGDQFKGUJCXGVJGUMKNNDCUGTGSWKTGF by these recent developments. Savvy YKVJKTGFCNGRGFGTUGPJQQMCPF#URGEV to implement major projects and have operators have already invested in Studios intends a place of inclusivity, been responsible for award-winning and under-utilised, forgotten or abandoned a public meeting place shared by the highly revered public and government URCEGUCPFCTGTGCF[HQTVJGDGPGɑVU many cultures that inhabit this city, a buildings. The ARM-designed Perth that these remaining major projects place that optimistically engages with Arena completes the western end of RTQOKUG*QVGNQRGTCVQTUMGGPVQ and interprets traditional owner culture VJGGOGTIKPI%KV[.KPM9KNNKCO locate in emerging areas and the City (ancient culture) and the diversity of Street, designed by Hassell Architects, .KPMRGTKRJGT[HQNNQYENQUGN[*QVGN current cultures. It will be a vibrant ECTGHWNN[MPKVUVQIGVJGTQPEGFKURCTCVG Alex by Spaceagency is one of many ɾ

Yagan Square: Lyons Architects, iredale pedersen hook architects and Aspect Studios Image: design team

1 Quoted by Prof. Martyn Hook, director iredale pedersen hook architects and Dean School of Media and Communication RMIT University.

- 38 - - 39 - boutique operations planned for the In 2008 the Perth International Arts 2 The deﬁnitive text for this project then quoted T.S.Elliot’s Burnt Norton City, re-engaging with Northbridge and Festival invited four architects and one “time present and time past TGURQPFKPIVQCOCTMGVVJCVKUEWTTGPVN[ artist to design their fantasy building are both perhaps present in time future, under-represented. for a site within Perth’s city area (to be and time future contained in time past. If all time is eternally present all time is displayed on a billboard). Titled ‘The unredeemable. 5KPEGVJGHQTOKFCDNGCPF Merry-Go-Round of Dreams and Ghosts’ What might have been is an abstraction KPURKTCVKQPCNPQPRTQɑV(14/CPF we created a circular public space, a remaining a perpetual possibility only in a world of speculation. Linda Dorrington have encouraged democratic space that revealed the What might have been and what has been private enterprise and empowered the shared speculation for this city and point to one end, which is always present. individual to invest in public spaces, stated, ‘the city we inhabit is a product Footfalls echo in the memory down the passage which we did not take art, symposiums and the creative of the city we choose not to create towards the door we never opened development of our City (and region). and the city we choose to demolish, into the rose-garden. My words echo Developed with a sense of shared our fantasy city is the city imagined thus, in your mind….” TGURQPUKDKNKV[2GTVJKUPQYCPGVYQTM by Perth architects for almost 100 of spaces waiting to be discovered and years that remains un-built and the enjoyed. collection of buildings that were built but should never have been demolished The Perth identity crisis seems to have … a collation of the most memorable been replaced with a new optimism. projects that if built or retained would We no longer compare ourselves JCXGTGUWNVGFKPCEKV[XGT[FKɈGTGPV inappropriately to cities that are to what we currently experience’. 2 iph UKIPKɑECPVN[NCTIGTOQTGEGPVTCNQT architects’ merry-go-round on the lawn much older. We are no longer toddlers reminds us of these past proposals ɑPFKPIQWTRNCEGKPVJGYQTNFYG and existences as an opportunity to understand that the city is a collective TGɔGEVQPQWTEWTTGPVGPXKTQPOGPVCPF and shared responsibility. With this contemplate what was, what could have EQPɑFGPEGEQOGUVJGTGCNKUCVKQPVJCV been and most importantly, what can this is a fragile moment in time. With still be. ɻ a slowing economy and less public Merry-Go-Round of Dreams and Ghosts Image: iph architects funding available, where and how do we progress into the next 10 years?

- 40 - - 41 - realising the arena Author Tanya Trevisan

6JGPGY2GTVJ#TGPCQYPGFD[VJG5VCVG)QXGTPOGPVQH9GUVGTP#WUVTCNKCYCUQɋEKCNN[QRGPGFVQVJG Western Australian public on 10th November 2012 and has been featured in numerous articles and media reports since the ’Multipurpose Indoor Entertainment & Sports Stadium’ Request for Proposal (RFP) was issued by the State Government in 2005.

Its seven year journey from RFP to The selection process for the architect 5VGRJGPCPF&QOKPKEYGTGKPGɈGEVVJG construction completion was marred by UVKRWNCVGFVJCVKHCɑTOYCUPQVTGUKFGPV joint managing directors of the joint signiﬁcant public criticism, related primarily in WA then it needed to provide a XGPVWTGCPCTTCPIGOGPVYJKEJYQTMGF to the façade during construction, and to local component to its bid. Once ARM extremely well for the duration of the JCFEQPɑTOGFKVUKPVGTGUVKPDKFFKPI perceived construction cost and program project. Howard Raggatt was the Design HQTVJGRTQLGEVYGNQQMGFHQTCNQECN Director, assisted by Andrew Lilleyman over-runs. The completed building and partner who was interested and capable CPF,GTGO[5VGYCTV2GVGT-GNGOCP subsequent loyal adoption by the Western of bidding jointly with us. We sought and Stephen Davies were the joint Australian community bears witness to advice from industry colleagues on the Project Architects up to the completion a polar transformation of public opinion, DGUVRGQRNGKP2GTVJCPFYGFKFVCNM of documentation. As construction and the building has quickly become one VQCEQWRNGQHQVJGTɑTOUDWVQPEG proceeded, Peter became the Project of Perth’s most recognisable and awarded we met with CCN it became clear that Architect, assisted by Steve Christie and it would be a very good partnership, public buildings. Numerous articles have a dedicated site team. CPFVJCVDQVJɑTOUYQWNFJCXGUKOKNCT critiqued the design of the Perth Arena - objectives, strategies and ethics in Did it work well for both parties? at planning, construction and completion. bidding for the project . What were the unexpected pitfalls and Here, Stephen Ashton (Director Ashton bonuses? Raggatt McDougall Architecture), Dominic How was the partnership initiated, and $QVJɑTOUCTGGZVTGOGN[RTQWFQH Snellgrove (Managing Director Cameron subsequently structured, in terms of input and outcome? the outcome, and of the fact that we Chisholm Nicol) and Peter Keleman (Director OCPCIGFVQUVKEMYKVJVJGRTQLGEVCPF The partnership was initiated through Cameron Chisholm Nicol) collectively share discussions between directors of both all its twists and turns, to be there at the their experiences of the realisation of this ɑTOURTKOCTKN[5VGRJGP#UJVQP end with the design integrity complete signiﬁcant project; providing joint insights and Dominic Snellgrove. It was and with a facility which has more than into the ideas, background and process that an unincorporated joint venture met the Government’s brief. By the time brought it into being. with a simple management and the project was complete, the architects ɑPCPEKCNUVTWEVWTGKPGUUGPEGC were amongst the only core team members that had been there since Obviously Ashton Raggatt McDougall 50/50 partnership. As is normal in geographically split joint ventures, ARM the start some seven years prior, which (ARM) and Cameron Chisholm Nicol (CCN) input tended to be greater in the design YGVJKPMUJQYUCTGCNRGTUKUVGPEGCPF decided to jointly enter the competition phases and less in the construction CPCDKNKV[VQYQTMYKVJKPVJGUJKHVKPI for the Perth Arena. Can you tell us about phases, and vice versa for CCN, mainly political and contractual environment the beginning of the process? for reasons of logistics and economics. of the project. ɾ

- 42 - - 43 - Image: John Gollings Quite apart from the fact that the come from, ie what inspired you and was 9GHQWPFVJKUXGT[PKEGEQPɔWGPEG partnership made winning the there a ‘light bulb’ moment’? between the 12 sided plan of Fremantle’s commission possible, there were 6JGTGYCUPӑVTGCNN[C'WTGMCOQOGPV Round House and the 12 sided shape of DGPGɑVUDQVJYC[U(TQO#4/ӑU rather a drawing together of a number %JTKUVQRJGT/QPEMVQPӑU'VGTPKV[2W\\NG perspective, we gained a trusted QHFKɈGTGPVUVTCPFUQHVJQWIJVYJKEJ By carefully studying the component NQECNEQNNGCIWGYJQMPGYVJG2GTVJ seemed to show promise for delivering parts of the puzzle, we were able to construction environment intimately, the design aspirations of the brief. These FGTKXGUQOGUJCRGUYJKEJYGPVVQOCMG and who could guide us through the included a desire to investigate a new up the main components of the Arena’s Image: Greg Hocking sometimes unusual and occasionally way to design an urban stadium that exterior. This idea of assembling the surprising local ways of doing things. TGɔGEVGFKVUKPPGTEKV[NQECVKQP6JKU Arena from components rather than And obviously the joint resourcing led to design research which showed a singular gesture gave it the urbanity of the project made dealing with the that most arenas and stadiums were CPFTKEJPGUUVJCVVJGDTKGHYCUUGGMKPI vicissitudes of the project program treated as singular objects, which was The main shapes of the facade could be OQTGɔGZKDNGCPFVJGTGHQTGRWVNGUU often quite anti-urban. We resolved to reinterpreted as swans, earthmovers, pressure on us than may have NQQMHQTCUGVQHKFGCUYJKEJJCFOQTG and other local references. The next otherwise been the case. WTDCPSWCNKVKGU9GYGTGCNUQMGGPVQ layer of design came after that as the ɑPFCU[ODQNKEEQPPGEVKQPYKVJ9#ӑU detail increased. BEMP WA Built The fact that there was a very good rich history of public architecture, while Environment GROWING WA | ENSURING PROSPERITY YQTMKPICPFVTWUVTGNCVKQPUJKRCV remaining as contemporary as the brief Can you give us some background to the Meets AND DIVERSITY THROUGH GOOD PLANNING Director level meant that we were required. Our inspiration for this new 2005 competition? Parliament very happy to be represented by CCN Arena began at the Round House in It was not really a competition, but a AND DESIGN at important meetings when it was (TGOCPVNG #QPGVKOGRTKUQPDWV OQFKɑGFSWCNKɑECVKQPDCUGFUGNGEVKQP Join our panel of political and industry leaders in a Q&A format NQIKUVKECNN[FKɋEWNVHQTCP#4/RGTUQP now iconic attraction, the twelve sided process, with an esquisse component exploring critical economic, social, environmental and governance to be there (eg short notice). And there Round House reminded the design team included. A shortlist was established, issues that will shape WA’s prosperity. are always things to be learned from of historic Ideal City diagrams from the based on capability through an RFP How will we capitalise on Western Australia’s uniqueness, meet YQTMKPIYKVJCHTGUJITQWRQHHGNNQY walled gardens of the early Middle Ages process, and these respondents were infrastructure demands and design liveable, affordable communities? RTQHGUUKQPCNUHTQOFKɈGTGPVCRRTQCEJGU to the high point in the Renaissance. VJGPCUMGFVQRTQXKFGCPKPKVKCNTGURQPUG CPFFKɈGTGPVGZRGTKGPEG And then for us the Eternity Puzzle to the project brief; not a design, but Wednesday 22 July 2015 at Fraser’s, Kings Park as another amazing 12 sided icon, as a submission which illustrated the 3:30-5:30 followed by drinks and networking .KMGYKUGHTQOC%COGTQP%JKUJQNO though also suggesting a city. Almost VGCOӑUCRRTQCEJVQVJGMG[KUUWGUQHVJG Nicol perspective we not only learnt impossible to solve, this puzzle has an project. More information and registrations: bempwa.com.au from ARM’s renowned design approach estimated 21095EQPɑIWTCVKQPU and systems, but were also exposed The project was awarded to ARM and VQPGYVGEJPQNQI[UWEJCU4JKPQ& Critiques talk about the Eternity Puzzle, CCN in October 2005. OQFGNKPICPF0CXKUYQTMU&XKGYKPI what is that and why is it relevant? The particular conceptual solution grew What in essence was the brief, and do you The design was initially so controversial out of ARM’s long standing interest believe that the constructed Perth Arena with the Perth public, and now I think in puzzles (there is a whole chapter of resembles the competition entry in spirit? HOST ORGANISATIONS SUPPORTING PARTNERS it’s fair to say locals have completely VJGPGY#4/DQQMVQDGTGNGCUGFKP Or did it evolve to become something embraced it. Where did the initial idea April Mongrel Rapture on puzzling). different? ɾ

- 44 - - 45 - Image: Greg Hocking Image: Greg Hocking

6JG4(2KPENWFGFUQOGMG[RTKPEKRNGU we now get on all the functional KPRWVHTQO4QP6WTPGTHTQO46-. DWORQWVGɋEKGPEKGUETKVKECNVQVJG I witnessed public opinion being strongly fear was that public criticism might which the design needed to satisfy; that RGTHQTOCPEGETKVGTKCCPFVJGɑPCPEKCN in Los Angeles, (now at Gensler). entertainment industry. critical of the design prior to the Arena’s unnerve the State and cause it to react the design concept is intellectually operating performance meet or, in the His experience designing stadia and completion; it was for a period there politically to a design matter, which rich and fully realised; that through ECUGQHVJGɑPCPEKCNTGVWTPUKIPKɑECPVN[ arenas, mostly in the USA, was a great Did you visit any particularly notable reasonably unrelenting and also covered never ends well. However, this was not design decisions, costs over the life of exceed the State’s original business CUUGVVQVJGVGCOCNVJQWIJYGSWKEMN[ venues that you believe assisted your in the media. That must have been the case - the State remained quite the building are reduced; that the users’ case. From the strategic viewpoint, discovered that the American arena approach with the functionality, design or challenging for the team. I’m really keen resolute on design matters once the needs are fully met; and that the Arena the State was determined to build an model was not entirely appropriate other aspects good and bad? to hear about that experience and how contract had been signed, and the contributes positively to its place in the CTGPCQHVJKUUK\GCPFɔGZKDKNKV[VQOGGV to Australia. The design of American Three Australian venues were probably it manifested itself, how it affected the design was really very well protected public realm. what was perceived to be a large gap CTGPCUKUJGCXKN[KPɔWGPEGFD[VJGKT most informative regarding the Perth process or you personally. What are your throughout the process, something of in Western Australia’s ability to attract strong sports franchises given the Arena design; they each informed views on this and the critics? YJKEJVJGUGPKQTOCPCIGTUCPFVJGMG[ 6JGMG[FGNKXGTCDNGHQTVJGTGURQPUG VJGMKPFQHKPVGTPCVKQPCNCPFPCVKQPCN RQRWNCTKV[QHDCUMGVDCNNCPFKEGJQEMG[ MG[CURGEVUQHVJGHWPEVKQPCNFGUKIP The public comments were at times politicians should now be very proud. was to demonstrate an approach rather acts that were bypassing Perth due to so the entertainment component must of Perth Arena. Firstly Rod Laver amusing and at times disheartening to Of course, the whole question of the than a conceptual design. We believe KVUNCEMQHHCEKNKVKGU6JKUUVTCVGIKECKO coexist with sport. Australian arenas Arena for its retractable roof, given the team. In the end we just got on with FGUKIPDGECOGRWDNKEN[EQPɔCVGFYKVJ that our response best demonstrated JCUCNUQDGGPEQORNGVGN[HWNɑNNGF(TQO however are much more weighted the brief requirement for the Perth VJGLQDEQPɑFGPVVJCVUKOKNCTVQQVJGT the question of cost and time increases. Arena to host the Hopman Cup tennis controversial architectural projects 9GYGTGEQPɑFGPVVJCVQPEGVJGFGUKIP an approach that did not pre-conceive an architectural design viewpoint, the towards entertainment and this tournament and to emulate conditions HTQOVJG'KɈGN6QYGTVQVJG5[FPG[ fully emerged it would be accepted if not a solution. We demonstrated a range design concept came quite early in the KPHQTOGFUGXGTCNMG[FGUKIPHGCVWTGU at the Australian Open. Secondly the Opera House and Federation Square, by all, then hopefully a majority. of conceptual approaches that could design process proper, and really has that has put Perth Arena at the forefront just-completed Members Stand at the project would be embraced by the be pursued pending more detailed simply developed from there. of arena design globally. These include the MCG which featured the highest RWDNKEQPEGEQORNGVG6JGɑTUVVKOGVJKU However we would have to say that even investigations. None of these conceptual the horse-shoe shaped seating bowl NGXGNQHɑPKUJGU[GVUGGPCVCURQTVKPI was demonstrated to us was at the Open we have been surprised by the strength CRRTQCEJGUCEVWCNN[TGUGODNGFVJGɑPCN The design team went on a national with retractable end stage seating, venue in Australia. Lastly Adelaide House event just prior to the building of the acceptance since completion, design concept literally, however in and international study trip to look at the location of the corporate suites Entertainment Centre for its highly being completed, when some 25,000 CPFJQYYGNNVJGHCEKNKV[JCUYQTMGFKP RTKPEKRNG[GUVJGɑPCNQWVEQOGYCUVTWG other venues, was this worthwhile? FQWDNGUVCEMGFOKFVKGTCVVJGTGCTQH GɋEKGPVTQQHTKIIKPIU[UVGOYKVJC RGQRNGXKUKVGFVJGXGPWG6JGHGGFDCEM every respect. The early successes of the to that conceptual approach. The national and international the bowl to optimise their commercial VTCɋECDNGOGUJEGKNKPIIKXKPIEQPEGTV was overwhelmingly positive. Wildcats home games generated huge DGPEJOCTMKPIGZGTEKUGYCUETWEKCNVQ value without compromising general TKIIGTUOCZKOWOɔGZKDKNKV[VQTKI We were really never personally momentum. Performers and audiences 9GCTGEQORNGVGN[EQPɑFGPVVJCVVJG better understanding arena building admission amenity, and also various NKIJVKPICPFQVJGTGɈGEVUVJCVUGGOVQ concerned by the criticism, except loved the acoustics and the experience, ɑPKUJGF#TGPCTGRTGUGPVUXGT[OWEJ typologies. Also critical during the DCEMQHJQWUGNQCFKPIFQEMCPFTKIIKPI grow in complexity year on year. where it was simply wrong. Our main and the whole project seems to have ɾ YJCVVJG5VCVGYCPVGF6JGHGGFDCEM initial investigative period was the features to achieve high bump-in and

- 46 - - 47 - instilled a sense of pride in Western OWNVKNGXGNECTRCTMQXGTVJGTCKNNKPGU it too much at that stage because we Australians that they can host such adjacent to the Arena, during the tender MPGYKVYQWNFCNNEJCPIG#UCDTQCFGT world class events. negotiations the preferred contractor’s RQKPVOQUVCTEJKVGEVUMPQYPQVVQ QɈGTVQEQPUVTWEVCECTRCTMWPFGT comment on buildings until they are One of the talking points related to the the Arena was agreed. This required ɑPKUJGFKVKUUKORN[RQKPVNGUUVQJCXGC late inclusion of the underground carpark CUKIPKɑECPVTGFGUKIPQHVJGCTGPC running commentary on things under (which added considerable cost to the structure and had quite an impact on construction. construction). What was the argument to the construction program and the just- justify not providing any parking? If you EQORNGVGFHQTYCTFYQTMUTGOGFKCVKQP The sustainability story is one which isn’t revisited this aspect would you do things *QYGXGTVJKUYCURQVGPVKCNN[QɈUGVD[ generally publicised, yet I believe that the differently, presumably having seen how CXQKFKPIVJGTKUMUQHEQPUVTWEVKQPQXGT Perth Arena design incorporates several the venue is used and accessed? live, operational rail lines. ESD initiatives. Can you highlight these One of the initial drivers for the and tell us about your intentions and government to locate the Perth Arena +PVJGGPF+VJKPMVJGWPFGTITQWPF approach? DCEMKPVQVJGJGCTVQHVJG%$&YCUKVU ECTRCTMYCUVJGTKIJVFGEKUKQP Our approach to achieving global best proximity to Perth’s major train station Although more costly to construct than practice sustainable design solutions and bus hubs. The government was very anticipated due to the high groundwater for the Arena commenced with the MGGPVQRTQOQVGRWDNKEVTCPURQTVCUVJG EQPFKVKQPU GɈGEVKXGN[TGSWKTKPI engagement of one of Australia’s preferred means of accessing the Arena the basement to be constructed as a pioneers of sustainable design in both from the perspective of broad waterproof inverse swimming pool), it Australia, engineer Che Wall. We sustainability principles and practically QɈGTUVJGJKIJGUVNGXGNQHCOGPKV[VQ commenced a process of engaging to reduce CBD congestion. This was patrons including those with universal YKVJCNNMG[UVCMGJQNFGTUKPXQNXGF DCEMGFWRD[ECTRCTMKPICPCN[UKU access needs, who can utilise the main in the Arena project by initiating a WPFGTVCMGPD[VJGVTCɋEEQPUWNVCPVU lift core to directly access all concourse UWUVCKPCDKNKV[YQTMUJQRCVVGPFGFD[ which demonstrated that Perth has levels from the basement. everyone from Government Ministers, CFGSWCVG%$&ECTRCTMKPIECRCEKV[ the Government Architect Professor YKVJKPCOKPWVGYCNMKPITCFKWUQH Considering the facade, initially when )GQɈTG[.QPFQPCPF2TQLGEV&KTGEVQT the Arena which was generally going only the skin of sheets of randomly multi Steven Luce to various event industry to be available at times of events, being coloured metal were visible and this was representatives and the entire EQWPVGTE[ENKECNVQVJG%$&YQTMKPI often featured amidst controversy in the consultant team. hours. media, the Perth public was outraged with the Arena’s ‘crushed beer can’ #VVJKUYQTMUJQRCDTQCFTCPIGQH *QYGXGTNQDD[KPID[RQVGPVKCNMG[ appearance. We all now know that wasn’t potential initiatives were assessed and users of the facility in the sports and the ﬁnal cladding, but what was that? a strategy was agreed by consensus. entertainment industry pointed out To use a metaphor, what the public were 1DVCKPKPIVJGȄDW[KPӑQHMG[FGEKUKQP that the value of the corporate suite reacting to was seeing the building in OCMGTUYCUETWEKCNDGECWUGKVOGCPV product would be greatly enhanced its underwear prior to being clothed. that the sustainability initiatives and D[KPEQTRQTCVKPIRCTMKPIYKVJKPQT 6JGOWNVKEQNQWTGF-CN\KROGVCNUJGGVU VJGKTDGPGɑVUYGTGYGNNWPFGTUVQQFCPF adjacent to the Arena. Initial studies YGTGCYCVGTRTQQɑPIUMKPVJCVYCU became committed design objectives. included various options and, whilst always going to be covered up by the -G[KPKVKCVKXGUVJCVKHPQVWPKSWGVQ the government initially settled on a ɑPCNHCECFG9GPGXGTYQTTKGFCDQWV arena design were certainly never before ɾ Image: John Gollings

- 48 - - 49 - Image: ARM/CCN solar Evacuated Tube Solar Hot Water

Gas and Electric boost option Duplex Stainless Steel Tank Anodic Protection suitable for Hard water New 360° passive tracking collector Pool & Heating Integration options Image: John Gollings

included in the one venue, included Arena have resulted in one of the most We call it the ‘sweet spot’ where you displacement air-conditioning to the GPGTI[GɋEKGPVUWUVCKPCDNGDWKNFKPIUQH ECPUGGVJCVVJGHTCOGYQTMQHVJG bowl seating which delivers conditioned its genre. main entry canopy is actually directly air directly to the patron seating derived from the facade shapes behind positions from under the seats, mixed Functionally, having experienced the KV+VOCMGUUGPUGQHVJGUGGOKPIN[ mode conditioning to the concourses rapid post-concert exit from the Arena, LWODNGFECPQR[UVGGNYQTMD[CNKIPKPI (ie partly naturally ventilated), T5 I am interested to know how this came VJGUVGGNYQTMYKVJVJGDWKNFKPI FKOOCDNGɔWQTGUEGPVJQWUGNKIJVKPIVQ about. IGQOGVT[DGJKPFa9GOCTMGFVJG the bowl, waterless urinals, cold water You are correct that patrons are able spot in the paving, however it’s not hand washing to general admission VQGZKVXGT[SWKEMN[CHVGTGXGPVU6JG widely publicised and so it is relatively COGPKVKGUCMYRJQVQXQNVCKETQQH Building Code of Australia does not WPMPQYP+VӑUPKEGVQNGCXGCDWKNFKPI mounted array providing most base- TGCNN[URGEKɑECNN[CFFTGUUGITGUU with a few secrets. NQCFRQYGTHQTVJGECTRCTMNKIJVKPI from venues such as Perth Arena CPFUWUVCKPCDNGOCVGTKCNCPFɑPKUJGU UQVJG7-)WKFGVQ5CHGV[CV5RQTVU The Perth Arena received the 2013 AIA selections. All the initiatives that were )TQWPFU MPQYPCUVJG)TGGP)WKFG Sir Zelman Cowan National Award for KPEQTRQTCVGFJCFTGCUQPCDNGRC[DCEM was utilised as the basis for safety and Public Architecture, the 2013 AIA Emil periods, meaning any cost imposts were egress standards, given it guides stadia Soderston National Award for Interior balanced against recurrent cost savings and arena designs in many countries. Architecture, the 2013 AIA (WA) George in a short period of time. Detailed predictive egress modelling Temple Poole Award, the 2013 AIA UQHVYCTGMPQYPCUȄ5VGRUӑYCUWUGFVQ (WA) Jeffrey Howlett Award for Public Modelling demonstrated that the TGɑPGVJGFGUKIPQHVJGCTGPCHQTUCHG Architecture, the 2013 AIA (WA) Colorbond displacement air conditioning system CPFGɋEKGPVGITGUUVJCVGZEGGFGFVJG Award for Steel Architecture, and the 2013 should reduce greenhouse gas emission guidance standards. AIA (WA) Architecture Award for Interior D[EQORCTGFVQEQPXGPVKQPCN Architecture. Last of all, what I call the ‘magic spot’, top-down, ducted systems; whilst not widely known and personally I love the photovoltaic array would save it. Can you tell us what this is about and The interviewer declares her interest, approximately 150 tonnes of carbon why? How hard was it to achieve in built having lived through the Arena story in Authorised Reseller dioxide per annum. Ambitious form? Why is it kept quiet? (I like to tell real time as the patient wife of one of the (08) 9433 5588 | www.supremeheatingwa.com.au

sustainability objectives for the Perth everyone!) interviewees.

ɻ S

A T

I N N

15 20 A C L O YEAR Y E YEAR R L T S R L N S A - 50 - - 51 - E A S W 1300 880 154 | www.edson.com.au C R T K TOR WAR EEL TAN ten from ten

9GCUMGFVGPRWDNKEɑIWTGUCPFCTEJKVGEVUKPXQNXGFKP2GTVJӑUFGXGNQROGPVCPFRWDNKEFKUEQWTUG ALANNAH MACTIERNAN surrounding issues of architecture, urban design and planning to share their responses to Federal Member for Perth, Former State Minister for Planning and Infrastructure ten questions on PERTH 2005 – 2015.

What do you believe has been Perth’s Hill’s State Theatre – I love the subtle, greatest success in the past decade? classical, Asian aesthetic that is a perfect The mining boom brought new energy, UVCVGOGPVHQT2GTVJKPVJGUVaEGPVWT[ LISA SCAFFIDI money and people into the city. It gave Right Honourable Lord Mayor, Perth us the impetus to get serious about Does regulation aid or impede growth? intensifying development to create a 9GPGGFTGIWNCVKQPVJGOCTMGV EKV[YKVJOQTGNKHGa#UOQDKNKV[KUVJGNKHG unregulated leads to a race to the What do you believe has been Perth’s streetscapes, venues, retail attractions Does regulation aid or impede growth? blood of a city, the thing that enables us bottom. greatest success in the past decade? CPFQVJGTQɈGTKPIU+UVCTVGFVQQDUGTXG #DUQNWVGN[PQVa4GIWNCVKQPKUCP VQVCMGCFXCPVCIGQHVJGCIINQOGTCVKQP A collective and growing appreciation a commensurate positive change in appropriate measure and process that QHFKɈGTGPVUMKNNUGVU+VJKPMFQWDNKPI Elizabeth Quay, how will you measure and commitment to realising Perth’s full attitude and the mindset of many CKFUUOCTVITQYVJa VJGUK\GQHVJGWTDCPTCKNPGVYQTMYQWNF its success? potential, along with more appreciation EKVK\GPUCPFUVCMGJQNFGTUa be up there. %GTVCKPN[PQVD[KVUPCOGa6JGEQPEGRV QHVJGDGPGɑVUUVTQPIGPICIGOGPVYKVJ Elizabeth Quay, how will you measure of the Perth Waterfront was to have a the cultural, arts and other creative Which urban, architectural or its success? What do you believe has been Perth’s high energy space with a truly big city sectors can bring to our city. technological trend do you believe has The overall success of this major greatest missed opportunity in the HGGNa+VUJQWNFDGLWFIGFQPYJGVJGTKV influenced the most change in Perth RTGEKPEVYKNNKPKVKCNN[DGUGGPKPVJGVCMG past decade? has been able to create a new dimension What do you believe has been Perth’s 2005 - 2015? WRQHTGVCKNCPFTGUKFGPVKCNQɋEGURCEG In recent times the focus is almost rather than just being more of the same. greatest missed opportunity in the I would say internet technology The longer term success will be seen via exclusively on the CBD. Much more past decade? given people are so 'attached' to their people truly engaging with the space planning and development focus What should Perth’s architecture and I worry the most about how we best smartphones. The provision of city wide and enjoying it so much they will return needs to be on building the urbanity urban design aim for over the next 10 years? sell 'brand Perth' to the world. It is a YKɑJCUDGGPPCVKQPNGCFKPICPFJCU again and again as it will provide them QHPQP%$&VQYPEGPVTGUa9GPGGFC My biggest concern is that we paying EQORGVKVKXGINQDCNOCTMGVRNCEGCPF MGRVWUEWTTGPVCPFOCMGUNKHGGCUKGTHQT with the connection to the river and the PGVYQTMGFEKV[9GCNUQJCXGVQMGGR only lip service to sustainability, both YJKNGYGTCPMKPVJGVQRVGPQHVJG CNNYJQXKUKVQWTEKV[a#FFKVKQPCNN[VJG EKV[VJG[JCXGUQWIJVa GZRCPFKPIRWDNKEVTCPURQTVVQMGGRVJG for individual structures and the city world's most liveable cities, and while we move by more people to inner city living city moving. CUCYJQNGa9GTGCNN[PGGFVQTGIWNCVG NCEMCPȄKEQPӑTGEQIPKVKQPHCEVQTNKMGVJG is bringing greater vitality to our city What should Perth’s architecture and JKIJGTUVCPFCTFUQHGPGTI[GɋEKGPE[ Sydney Harbour Bridge or Opera House, and this is enhancing viability for the urban design aim for over the next 10 In what way do you think Perth has ETQUUXGPVKNCVKQPCPFITGGPKPIa9G it is a little harder to create awareness small businesses choosing to once again years? changed the most significantly over the are blithely ignoring the destruction and sell Perth to many who don’t have have a presence in our city. Ideally design excellence and good last 10 years? of canopy as we are intensifying the the appreciation of just how amazing sustainability principles should be the Urban or street culture has grown growth of the city with little regard for this city is without the right initial What do you enjoy most about what priority. Good municipal management enormously, not just in the inner VJGKORCEVQPVJGJGCVKUNCPFGɈGEV CVVTCEVQTa you do? UJQWNFEQPVKPWCNN[CKOVQMGGRCIQQF suburbs. There is a much greater move which will compound the warming 'XGT[FC[KUFKɈGTGPVKPO[TQNGCPF+ G[GQPEJCPIKPIaRCVVGTPUCPFɔQYU to eating out, doing the café strip problem Perth is experiencing from In what way do you think Perth has enjoy that diversity and the connection thing, going to festivals. We are more INQDCNENKOCVGEJCPIGa9JKNGYGJCXG changed the most significantly over the to so many people across so many Perth 2005 - 2015 - delighted or outraged? GPVJWUKCUVKECDQWVEKV[NKHGaa some improvements with greening the last 10 years? KPFWUVT[UGEVQTUCPFYCNMUQHNKHGaa +VJKPMYGFQPӑVGXGPPGGFVQIWGUUVJCV public realm, the rapid loss of green, In my observations, the changes CPUYGTa.GVOGEQTTGEVVJGCPUYGTȁ Which urban, architectural or growing things in private space will we have brought upon the central What is the biggest lesson you have learnt 'Totally delighted' and add even more technological trend do you believe has OCMGQWTEKV[OWEJNGUUNKXGCDNGa9G city area have delivered a greater in the last 10 years? KORQTVCPVN[YGCTGXGT[RTQWFa.QQM influenced the most change in Perth need to better understand biophilia. sophistication to our city’s urban fabric. I am an advocate for our city but the how far we have come and yet how 2005 - 2015? 6JGTGYCUUQOGUEGRVKEKUOCVɑTUV greatest lesson is appreciating the value OWEJOQTGYGECPUVKNNCEJKGXGaa The quality of built form is very uneven Perth 2005 - 2015 - delighted or outraged? DWVCUQWT8KUKQPWPHQNFGFCPF and strength of timely, clear and well – some beauties, but a lot that is very 2GTVJȁ+NQXGVJKUEKV[a1HEQWTUGYGECP people started appreciating the new CTVKEWNCVGFEQOOWPKECVKQPaaa CXGTCIGa1PGQHO[HCXQWTKVGUKU-GTT[ do better – that’s life. ɾ

- 52 - - 53 - BRAD PETTITT MARION FULKER MARION FULKER LINLEY LUTTON Mayor, Fremantle CEO Committee for Perth CEO Committee for Perth City Gatekeepers

What do you believe has been Perth’s What is the biggest lesson you have learnt What do you believe has been Perth’s What is the biggest lesson you have learnt What do you believe has been Perth’s greatest success in the past decade? in the last 10 years? greatest success in the past decade? in the last 10 years? greatest success in the past decade? a4GGPNKXGPKPIVJG2GTVJ%$&CUCHWPM[ Change is slower to get going than That there is more focus on the future Not everyone wants Perth to ‘grow up’; The decade’s best, for me, is the and interesting day and night economy. +ӑFaGXGTaKOCIKPGFDWVa+ӑXGCNUQNGCTPV and with that has brought more there are some that want the place Perth Arena whose dominating yet VJCVQPEGaDKIEJCPIGUUVCTVVJG[ EQQTFKPCVGFGɈQTVD[CNNYJQJCXGCTQNG to be a big country town but with the unpredictable and complex form What do you believe has been Perth’s YKNNaICVJGTCOQOGPVWOQHVJGKTQYP in that future. population growth we have experienced successfully provides an engaging greatest missed opportunity in the CPFMGGRaJCXKPICPKORCEVHQT[GCTUCPF a that is simply not possible. NCPFOCTMFGɑPKPIVJGYGUVGTPGPVT[VQ past decade? decades to come. What do you believe has been Perth’s a the city. To deal with its out of control urban greatest missed opportunity in the Does regulation aid or impede growth? URTCYNCPFKVUNCEMQHaJQWUKPIa Does regulation aid or impede growth? past decade? It does provide a degree of certainty What do you believe has been Perth’s CɈQTFCDKNKV[.GUUVJCPQHPGY +VaPGEGUUCTKN[aKORGFGUCUKVaUGGMU +H+JCXGVJGNKDGTV[QHIQKPIDCEMLWUV but with that comes constraint which greatest missed opportunity in the FYGNNKPIUCTGaDWKNVaYKVJKPVJGEWTTGPV VQaUJCRGUaVJGPCVWTGQHVJGaITQYVJ6JCV slightly more than a decade, I would impedes innovation. past decade? OGVTQRQNKVCPaHQQVRTKPVaCPFVQQHGYCTG said, regulation done well can get better say the Bell Tower. It should have been a 6JG%KV[.KPMRTQLGEVOKUUGFVJGQPEG CɈQTFCDNGVQRGQRNGQPCXGTCIGUCNCTKGU outcomes but must be used sparingly. bigger and more iconic. Shame on the Elizabeth Quay, how will you measure in-a-lifetime opportunity to introduce naysayers at the time for compromising its success? a colourful and lively residential In what way do you think Perth has Elizabeth Quay, how will you measure what was an ambitious vision. +VQQMCNQVQHɔCMHQTDGKPICXQECN quarter right in the heart of a rather changed the most significantly over the its success? a UWRRQTVGTQHVJGRTQLGEVUQ+YKNNMPQY monotonous city. last 10 years? By whether it is a place that people will In what way do you think Perth has it is a success when it is brimming with 4CRKFRQRWNCVKQPITQYVJJCUVCMGP want to come to not for just events but changed the most significantly over the RGQRNGHTQOCNNYCNMUQHNKHGGXGPVJQUG In what way do you think Perth has 2GTVJHTQOCRNCEGVJCVHGNVNKMG UKORN[VQNKPIGTCICKPCPFCICKPa last 10 years? that objected to it. changed the most significantly over the DKIaEQWPVT[aVQYPVQCRTQRGTITQYPWR 9GCTGOQTGEQPɑFGPVCUCTGIKQPOQTG a last 10 years? city of 2 million people. What should Perth’s architecture and sure of our place in the nation and the What should Perth’s architecture and I will remember the decade mostly as a urban design aim for over the next 10 globe. urban design aim for over the next 10 period when high land values coupled Which urban, architectural or years? a years? with the relaxation of density limits drove technological trend do you believe has To raise the bar from 'not bad for Which urban, architectural or Incorporate more of our local materials a massive increase in apartment living. influenced the most change in Perth Perth' to high quality buildings that technological trend do you believe has and colour pallet into our built form. 2005 - 2015? address the major sustainability and influenced the most change in Perth a Which urban, architectural or The rediscovery of the importance of FGOQITCRJKEEJCNNGPIGU2GTVJaHCEGUKP 2005 - 2015? Perth 2005 - 2015 - delighted or outraged? technological trend do you believe has authenticity and grit – be it industrial a creative way. Smart Growth drove the notion that I’m delighted with Perth’s influenced the most change in Perth FGUKIPITCɋVKEQXGTGFNCPGYC[UaQT EKVKGUEQWNFMGGRURTCYNKPIKPCȄUGPUKDNG transformation over this past decade. 2005 - 2015? DTQYPɑGNFTGFGXGNQROGPVUVJCV Perth 2005 - 2015 - delighted or outraged? way’, I am not sure that has served Perth The state government’s ideological EGNGDTCVGVJGKTYQTMKPIJGTKVCIGa A little of both. Delighted with our small well. RWTUWKVQHTCPFQOFGPUKɑECVKQPJCU wins but a bit outraged that given what a clearly changed the city’s morphology What do you enjoy most about what we’ve got we should be doing a whole lot What do you enjoy most about what – approving a sixteen storey tower in you do? better. you do? central Subiaco is a prime example. 6JGFKXGTUGEJCNNGPIGQHaDTGCVJKPI I have the best job in Perth! life into a city centre that was in 4GUGCTEJKPIVJKPMKPICPFCFXQECVKPI What do you enjoy most about what steady decline and creating a liveable, for a vibrant, sustainable and you do? UWUVCKPCDNGXKDTCPVaEKV[YJKEJUQOGJQY prosperous future – what better job My greatest professional joy comes UVKNNMGGRUKVUSWKTMUCPFWPKSWGPGUU could there be. from teaching my young UWA planning a students as we explore ways to satisfy human needs through good urban planning. ɾ

- 54 - - 55 - MARION FULKER JOERG BAUMEISTER GEOFF WARN CEO Committee for Perth Director Australian Urban Design Research Centre WA Government Architect

What is the biggest lesson you have learnt What do you believe has been Perth’s What is the biggest lesson you have learnt What do you believe has been Perth’s contemplate density and apartment in the last 10 years? greatest success in the past decade? in the last 10 years? greatest success in the past decade? NKXKPI6JGUGCTGUKIPKɑECPVEJCPIGUHQT A big eye-opener for me, learnt The public train system as an 1PN[VJKPMKPIKPU[UVGOUECPOCPCIG The commitment to developing Perth, which is essentially a suburban FWTKPIQWTɑIJVHQTCDGVVGT2GTVJ opportunity for a more diverse and urban future and its complexity. Elizabeth Quay and reuniting the environment. Our challenge is how to Waterfront plan, is how wilfully the therefore safer future for Perth. city and the river is an important become positively and uniquely urban broad community is disempowered by Does regulation aid or impede growth? achievement. Also the City of Perth’s and metropolitan. Government in important planning What do you believe has been Perth’s Regulation is needed to balance public urban infrastructure improvements matters. greatest missed opportunity in the and individual interests including their CPFKVUPGY.KDTCT[VJG%KV[ӑUɑTUV Which urban, architectural or past decade? FKɈGTGPVFGɑPKVKQPUQHITQYVJ commissioned project in nearly 40 years technological trend do you believe has Does regulation aid or impede growth? To lobby harder for public transport is notable. The Library and Cathedral influenced the most change in Perth Ancient Rome, with few planning – the more participants, the better it Elizabeth Quay, how will you measure Square promise to be a catalyst for 2005 - 2015? regulations, grew into a dysfunctional YQTMU its success? overdue regeneration of the eastern There are many. The biggest agent city while most late medieval and It will be successful if it creates a end of the CBD. In architectural of change has been the money and EQNQPKCNEKVKGUITGYGɈGEVKXGN[WUKPI In what way do you think Perth has DGPGɑVHQTVJGRWDNKEHQT2GTVJCPFVJG terms, the State Theatre Centre and the the migration that has come from locally-focused regulatory planning changed the most significantly over the riverside. 2GTVJ#TGPCCTGUKIPKɑECPVUWEEGUUGU the resources boom. The population HTCOGYQTMU last 10 years? KPUGVVKPICPGYDGPEJOCTMHQTEKXKE increase (and the variety of people) The transformation of urban quarters What should Perth’s architecture and buildings in Perth. Are these isolated and the heightened economic activity Elizabeth Quay, how will you measure its NKMG0QTVJDTKFIGQT(TGOCPVNGYJKEJ urban design aim for over the next 10 cases or are we reaching a condition have required more buildings and success? demonstrate the advantages of an urban years? where we expect a better standard infrastructure. The expanded role The Esplanade Reserve, constructed in lifestyle. #HQNNQYWROQFGNYKVJFKXGTUGKPɑNN of architecture and design, a better and jurisdiction of the Metropolitan the 1890s, was a place for community developments for a highly attractive environment? As a capital City in a Redevelopment Authority has wrought recreation and assembly so Elizabeth Which urban, architectural or urban and ecological lifestyle. INQDCNN[UKIPKɑECPVTGIKQPYGUJQWNF UKIPKɑECPVEJCPIGQPVJGHCDTKEQHVJG Quay’s success, to me, will be measured technological trend do you believe has aim for this. city and widened its appeal to people. by its continued community use. influenced the most change in Perth Perth 2005 - 2015 - delighted or outraged? The City of Perth and several other local 2005 - 2015? .KXKPIKP2GTVJȁFGNKIJVGFMPQYKPI What do you believe has been Perth’s authorities have also responded well. What should Perth’s architecture and 6JCPMUHQTVJGHCPVCUVKE(TKPIGCPF some of Perth’s vulnerabilities in greatest missed opportunity in the Liquor licensing reforms have led to an urban design aim for over the next 10 #TVUHGUVKXCNUVJCPMUHQTQWVUVCPFKPI upcoming crises – outraged. past decade? increase in the number of small bars. years? concerts (ACO!), for excellent Despite the large quantity of new This has brought a welcome change in Perth is on a self-induced unsustainable GZJKDKVKQPUCPFVJCPMUHQTCPKPETGCUKPI construction across the greater City character and activity across the city. trajectory so for the next 10 years we PKIJVNKHG6JCPMU2GTVJHQTVJGUG region over this period, we’ve so far Our food culture has also improved all need to start the big conversations, changes that will hopefully continue in missed the opportunity to consolidate (as has the service!). The resources together, and devise the best ways the future and won’t be just a trend! a strong local design culture. Housing boom has introduced a more diverse forward. XCTKGV[CPFCɈQTFCDKNKV[UVKNNTGOCKP cross section of tourists, visitors and What do you enjoy most about what unresolved issues. YQTMKPIRTQHGUUKQPCNUVQ2GTVJYJKEJ Perth 2005 - 2015 - delighted or outraged? you do? JCUKPURKTGFCPGYNGXGNQHEQPɑFGPEG 6YQPGYNCTIGDNCPMECPXCUGUGOGTIGF 9QTMKPICUTGUGCTEJGTGFWECVQT In what way do you think Perth has and perhaps brought with it a tinge in the CBD in the last decade and sadly and explorer in an excellent, changed the most significantly over the of cosmopolitanism. We must also each production has been shamefully multidisciplinary team on driving last 10 years? recognise the other side of the coin; the mediocre. problems of the world: the evolution of The increased level of interest and EQOOQFKɑECVKQPQHCNOQUVGXGT[VJKPI cities which are connecting both human investment in the City, transforming KPENWFKPIVJGRWDNKETGCNOKPɔCVKQP interests and natural environments. it to be more than a central business and its associated costs of living; high district, and a willingness to expectations; and a sense of anxiety ɾ

- 56 - - 57 - MARION FULKER EMMA WILLIAMSON CEO Committee for Perth Practice Director CODA towards an uncertain and unstable KV2QNKE[ECPDGTKIKFQTɔGZKDNG KPFWUVT[ɑPCPEKGTUOGFKCCPF What do you believe has been Perth’s VJGKTQYPKFGPVKV[CɈQTFGFD[UOCNN future. And we must be diligent in approached proactively or defensively. government. The educating institutions greatest success in the past decade? businesses that can be supported by the monitoring our everyday practices to It’s always better to incentivise good are essential players in setting agendas +NQXGVJCVYGPQYJCXGRQEMGVUQH increased resident population. ensure they concur with sustainability outcomes than simply to limit the worst for research and design. And the OGA activity and intensity around the high objectives and targets. These are ones through regulation. and the Institute of Architects can assist streets of inner ring suburbs. These What do you enjoy most about what very complex issues that creativity in aligning government, industry and RQEMGVUJCXGDGPGɑVUVJCVYGECPCNN you do? and design can help to ameliorate, Elizabeth Quay, how will you measure VJGCECFGOKGUJGNRKPIVQNKPMRTCEVKEG enjoy and have helped to create strong a6CMKPIQPPGYRTQLGEVUCPFaVJTQWIJ if allowed. its success? and theory to policy. and connected communities. QWTaEQPXGTUCVKQPUYKVJENKGPVUCPF The EQ project in its totality will be the a UVCMGJQNFGTUaNGCTPKPIVJGEQORNGZ What do you enjoy most about what TGUWNVQHEQPUKFGTCDNGHQEWUGFGɈQTV Although this view sounds idealistic and What do you believe has been Perth’s variables that create the need for our you do? from government, the private sector somewhat utopian many other places greatest missed opportunity in the UGTXKEGUa+aNQXGVJGEJCNNGPIGQHɑPFKPI It is reassuring to witness the impact and the community, operating at many achieve it. Improvement will come from past decade? YC[URTQDNGOUECPDGVWTPGFaCTQWPFaVQ that the OGA is having within levels. The completed project will, setting a higher bar and fostering the Failing to address the need for better become opportunities. Government. The receptiveness and therefore, represent the sum of our determination to jump it. RWDNKEVTCPURQTVa$[OKUUKPIVJKU enthusiasm that government agencies capabilities at a point in time. It will opportunity our city continues to sprawl What is the biggest lesson you have learnt have shown to my role as Government TGɔGEVQWTEWNVWTCNOCVWTKV[CPFVJCV Perth 2005 - 2015 - delighted or outraged? along the coastline leaving people in the last 10 years? Architect has been far greater than I could be telling! Neither. But I’m optimistic about the KUQNCVGFCPFFKUEQPPGEVGFa6JKUNCEM #TEJKVGEVUPGGFVQNKUVGPCPFCUM anticipated. In advocating design and future. of intensity comes at a high price to SWGUVKQPUa+VӑUQPN[YJGPYGJCXGCHWNN JGNRKPIUJCRGEWTTGPVVJKPMKPICDQWV +ӑONQQMKPIHQTYCTFVQ VJGQRGPKPI the environment and people’s mental understanding of the complex layers the City and its suburbs, the OGA has and the initial responses, although health! of issues that come to each project that an important role. But despite good '3YKNNVCMGSWKVGCHGY[GCTUOQTGVQ a YGECPUVCTVVQQɈGTUQNWVKQPUVJCVYKNN intentions, ingrained processes are complete and settle into our collective In what way do you think Perth has support our clients well into the future. FKɋEWNVVQEJCPIGSWKEMN[UQRCVKGPEG consciousness. Reconnecting the city to changed the most significantly over the a is necessary. In this context our built its water has been a very big step for us. last 10 years? Does regulation aid or impede growth? environment policy 'Better Places +VJKPMVJGTGJCUDGGPCITCFWCNUJKHV ;KMGUȁ+ӑOVQTPa+PUQOGTGURGEVU and Spaces KUXGT[JGNRHWNKPMGGRKPI What should Perth’s architecture and VQYCTFVJKPMKPIQHQWTUGNXGUCUCEKV[ +HGGNKVKORGFGUITQYVJa6JGOQTG agencies and individuals focused. urban design aim for over the next 10 TCVJGTVJCPCVQYPa.QPIVGTORNCPU bureaucracy the more barriers seem years? for areas around railway infrastructure to come between a good idea and its What is the biggest lesson you have learnt To improve, to achieve higher standards. mean we will continue to see these GZGEWVKQPa6JCVUCKF+YQWNFCFXQECVG in the last 10 years? We should aim for a distinctive design RQEMGVUFGXGNQRVJGKTQYPKFGPVKV[ for higher standards of design, Conservative forces are very powerful. language and character that promotes ETGCVKPICFKXGTUGEKV[a5KPMKPIVJG increasing the role and power of Design Architecture is not at all well good design that is unique to WA railway in the city and investing in some 4GXKGY2CPGNUCPFVJG1ɋEGQHVJG WPFGTUVQQFKP9#KPHCEV+VJKPM and appealing beyond our shores. large public projects that value culture Government Architect in projects, and TGNCVKXGN[URGCMKPIVJKUKURTQDCDN[ A distinct local style will only come are public signals that we are on the that would increase regulation in that VJGOQUVFKɋEWNVOCLQTEKV[KPVJG from a local base of committed design- move. area. developed world to be an architect. focused practitioners. Although it has a a And I am sure, from a broad perspective, waned, Perth architecture has on a Which urban, architectural or Elizabeth Quay, how will you measure YGECPCNNDGPGɑVHTQODGVVGT few occasions achieved this. A healthy technological trend do you believe has its success? architecture and design. design culture needs an enabling influenced the most change in Perth +VJKPM'NK\CDGVJ3WC[YKNNDGNKMG context and this is what is missing. 2005 - 2015? all new projects – it will need time to Does regulation aid or impede growth? The context needs design-based values The focus on Transit Oriented grow into itself and create an identity. It can do both. Regulation can be and aspirations to be loosely shared by Developments means we now have Ultimately the success needs to be helpful, depending on how you use developers, regulators, construction diverse suburbs that are creating measured by the government’s own ɾ

- 58 - - 59 - MARION FULKER PHIL GRESLEY MARION FULKER NIC BRUNSDON CEO Committee for Perth Director Gresley Abas CEO Committee for Perth Director Post- Architecture criteria: connecting people to the What do you believe has been Perth’s Perth. Stopping short of supporting in measuring success might be how What do you believe has been Perth’s quality, amenity and procurement TKXGTa+PO[XKGYVQDGUWEEGUUHWN greatest success in the past decade? the implementation of faux historical the government manages empty greatest success in the past decade? hygiene; and an impediment by its it needs to engage with the local 6QJCXGITQYPWR2GTVJJCUFGɑPKVGN[ architectural styles, WAPC’s Directions development sites over the coming Brave, good people in positions of XGT[FGɑPKVKQP population and not the transient tourist come of age over the last 10 years. UGGMUVQDTKPIOCP[QHVJGOQTG years. KPɔWGPEGUGPUKPIVJGOQOGPVCPF RQRWNCVKQPa+H+EQOGVQYQTMQPC We have absolutely given our leaders successful, people-oriented principles crafting a long-view, most often to Elizabeth Quay, how will you measure Monday and three people I interact with RGTOKUUKQPVQOCMGUQOGDKIFGEKUKQPU of New Urbanism to life. This is What should Perth’s architecture and the detriment of their own immediate its success? If I want to go. JCXGDGGPVQ'3QPVJGYGGMGPFHQT about the future of our city, and they increasingly manifest in mixed-use urban design aim for over the next 10 personal popularity (Brad Pettitt, FKɈGTGPVTGCUQPU+YKNNVJKPMKVJCUDGGP JCXGɑPCNN[FQPGUQ activity corridors and public transport years? 5EQVV.WFNCO.KUC5ECɋFK,QJP%CTG[ What should Perth’s architecture and a success. oriented developments. +PVJGQPIQKPIGɈQTVVQTGFWEG /CTKQP(WNMGT OQTG OQTG OQTG urban design aim for over the next 10 a What do you believe has been Perth’s suburban sprawl, we need to provide years? For global renown. What should Perth’s architecture and greatest missed opportunity in the What do you enjoy most about what better amenity for residents of medium What do you believe has been Perth’s urban design aim for over the next 10 past decade? you do? density (~ R40) suburban development. greatest missed opportunity in the Perth 2005 - 2015 - delighted or outraged? years? 0QVVCMKPICFXCPVCIGQHQWTWPWUGFCPF 9QTMKPIYKVJITGCVRGQRNGVQTGCNKUG Through more innovative housing past decade? Yesterday. ɻ We should continue to focus on density vacant upper level spaces in historical their hopes and dreams. V[RQNQIKGUCTEJKVGEVUECPGɈGEVRQUKVKXG Not a question for me, I’m terrible at and public transport in the urban KPPGTEKV[DWKNFKPIUaa+VӑUCITGCVUJCOG change in this rapidly growing style of NQQMKPIDCEM TGCNOa2GTVJӑUCTEJKVGEVWTGPGGFUVQ that as a city we have not managed a What is the biggest lesson you have learnt housing, which is currently the remit of continue to develop a dialogue with ɑPFYC[VQRTQOQVGKPPQXCVKQPETGCVG in the last 10 years? DWKNFKPIVGEJPKEKCPUYJQOQUVN[NCEM In what way do you think Perth has VJGRTQHGUUKQPCPFVJGRWDNKEVJCVVCNMU KPEGPVKXGUHQTQYPGTUCPFɑPFEQOOQP Change for the better can actually a design education and sophistication. changed the most significantly over the about the value of good design. sense solutions to regulation that would JCRRGPaa+VFGOCPFUYQTMKPIJCTFCPF Also – getting Activity Centres right! last 10 years? a GPCDNGVJGUGURCEGUVQDGKPJCDKVGFaa consistently on what you believe and Generational change, so, time passing Perth 2005 - 2015 - delighted or outraged? ɑPFKPINKMGOKPFGFEQNNCDQTCVQTU Perth 2005 - 2015 - delighted or outraged? principally. I am neither delighted nor outraged In what way do you think Perth has Absolutely delighted! YJGP+VJKPMDTQCFN[CDQWVVJKUVQRKEa changed the most significantly over the Does regulation aid or impede growth? Which urban, architectural or +COQWVTCIGFD[URGEKɑEKPUVCPEGU last 10 years? To me, it’s the quality of any ‘growth’ technological trend do you believe has where we see poor design outcomes +VӑUPQYɑNNGFYKVJRGQRNG[GCTU that counts. If de-regulation turns on influenced the most change in Perth (especially when they are done by CIQQPCa(TKFC[aGXGPKPI2GTVJ%$&JCF the growth tap, what happens if only 2005 - 2015? CTEJKVGEVU QTOKUUGFQRRQTVWPKVKGUa NKVVNGVQQɈGT0QYVJGTGCTGRGQRNG rubbish comes out? A move towards a 7-day diurnal city. At other times I am delighted by small inhabiting all sorts of spaces and places When was the last time you heard the and delicate moments that you more - permanent and temporary, shiny and Elizabeth Quay, how will you measure tedious slogans ‘brain-drain’, ‘Wait QHVGPUVWODNGWRQPVJCPUGGMQWVa gritty, formal and casual – it’s all there. its success? Awhile’ or ‘dullsville’? … A victory. I maintain an optimism that these Thousands of people inhabiting small +VӑUCUWEEGUUKHKVӑUCXKDTCPVRNCEGɑNNGF small moments of delight will build DCTUECHªUJCYMGTUOCTMGVUCEVKXG with a diverse range of people doing a What do you enjoy most about what up a critical mass and in ten years time I public spaces, and a revitalised cultural diverse range of activities. It’s a success you do? YQPӑVDGCDNGVQYKRGVJGUOKNGQɈ EGPVTGCDUQNWVGN[ɑNNGFYKVJNKHGaa if it’s a genuine destination and a place All of it. I love being an Architect. my face. EKV[FYGNNGTUYKNNVQWEJYGGMN[QTGXGP In Perth. Now. Which urban, architectural or daily. I believe the public realm will be technological trend do you believe has of the highest quality but success will What is the biggest lesson you have learnt influenced the most change in Perth also be measured by the design quality in the last 10 years? 2005 - 2015? of the private developments and how 6CMGTKUMUCPFOCMGDKIOKUVCMGUKP The New Urbanism movement has had they contribute to this public realm. your 20s. CUKIPKɑECPVKORCEVQPVJGRNCPPKPI Conversely, with the current local urban design, and architecture of GEQPQOKEUNQYFQYPCMG[EQPUKFGTCVKQP Does regulation aid or impede growth? Both. An aid in protecting design

- 60 - - 61 -

STONE FLOOR or BATHROOM ? scouring the thin city Author Beth George (QTJGT&QEVQTCN6JGUKU 4/+6 $GVJ)GQTIGWPFGTVQQMCPKPXGUVKICVKQPKPVQ2GTVJ VJTQWIJVJGOGFKWOQHOCRRKPI#PGZEGTRVHTQOVJKUYQTMKURTGUGPVGF milano Abstract The mechanism for directing this the city’s delirium, its peculiarity, its Perth, Western Australia – a city become interpretive view of the city is the distinctiveness. TGIKQPQPGJWPFTGFMKNQOGVTGUKP process of mapping. Each narrative length and expanding yet – is a place thread has been explored through the Private city ͻ Select your stone today variously adored and scorned; one noted formulation of a set of maps as a visual The private city concerns an idea that widely for its landscape and its horizon, VGZV6JTQWIJVJGRCKTGFYQTMKPIU public space is not a quintessential and relatively rarely for its architecture. of the narratives and the mappings, aspect of habitation in Perth. The vast ͻInstalled in four weeks Young, low lying, and sparsely lined with opportune conditions and operations majority of Perth’s development has built form, Perth might be described as are uncovered within the thin city, VCMGPRNCEGUKPEGVJGKPVTQFWEVKQPQH a thin city. complexities that belie the ubiquity of private transportation. As in many the city’s surface. modern cities, the car has been held ͻGuaranteed for life responsible for dispersing the city’s The intent of this research is to Mappings shift in scope from the scale development pattern and dissolving entreat an optimistic and inquisitive of the region to a site of richness at its with it notions of propinquity and reading of the city of Perth through the core, sampling out entities, structures collective space. Occupying conceptualisation of a set of narrative CPFRGTHQTOCVKXGRTQEGUUGUCVYQTM an expansive plain, the footprint of VJTGCFU5KZɑEVKXGKPVGTRTGVCVKQPU in the city’s plan, distilling opportune the city is large and sparse; made for of Perth, each denoting qualities of sites that are then explored via the the most part of private houses on thinness, are cast toward the factual architectural project. At once analytical EQORCTCVKXGN[NCTIGDNQEMUQHNCPFKVU EKV[KPXKVKPIDQVJEQPɑTOCVKQPCPF and synthetic, mappings identify expansiveness permitted by the private opposition to their themes. They are: existing points of intrigue in the vehicle. Strung out along the edges private city, wide city, even city, city city’s plan and simultaneously invite of the ocean and the river, the urban STONE FOR LIFE of the immediate future, reserve city their extrapolation. With the thin city footprint is a linear one that attaches CPFEKV[QHHQTOɑZCVKQP6JGRTQEGUU narratives driving the content of the to geographical edges rather than of elucidating and questioning the maps and forming the basis for their gathering itself around the city’s core. presence of these narratives allows for projectual exploration, this research 6JGRCTMUVJCVNKPGVJGUGYCVGTHTQPVCIGU VJKEMPGUUGUVQGOGTIGHTQOVJGEKV[ UGGMUVQGPICIGYKVJVJGPCUEGPVEKV[ might be a better approximation of region; latencies with which the city can CPFQɈGTVQKVCPCTOCVWTGHQTKVU public space than any town square in be redressed. CORNKɑECVKQPVJCVQRGTCVGUYKVJKP the central business district. ɾ

70 Bay View Terrace Claremont W.A. 93835933 www.milanostone.com.au

- 62 - - 63 - Wide city to govern the city’s built scape, overturning of multiple unbuilt sites The wide city is about the spatial IGPGTCVGFD[CNCEMQHFKɈGTGPVKCVKQPKP of varying roles, all called reserves. openness of Perth and the visual scale, density and hierarchy in its urban 2CTMUURQTVKPIɑGNFUITGGPUGVDCEMU EQPUVCPE[QHKVUJQTK\QPCPFUM[6JG composition, with rare instances of of ocean and river, verges, adjacencies wide city is found in the gaps between verticality and compactness. of road and railways – all referred to the city’s low, sparsely built fabric, and as reserves. Regardless of their type, KPVJGXCUVITGGPDTGCMUVJCVRGTHQTCVG City of the immediate future reserves are spaces that are set aside its plan and line its riverine and coastal The city of the immediate future has for future development or precluded shores. These gaps in the city’s fabric two separate but interrelated concerns, from development entirely: they are in trade the vertices and channelled views one spatial and one temporal. Its fact preserved spaces. So reserve city of dense development for pervasive spatial dimension lies with the outward moves beyond the plotting of sites of openness, both spatial and visual. The extension of the region’s limits openness to identifying a mindset that concern for the wide city is the question in accordance with the demands of the surrounds them – an attitude of deferral, of its permeability: the space between private city through the release of new a reluctance to construct. In this sense, its thinly spread forms is generally land and the proliferation of generic and particularly with regard to the PGICVKXGURCEGUGVDCEMCURJCNVNCYP suburban townscapes. substantial green frontages of the ocean and the green tracts that line its water and river, the reserve acquires not just a bodies are usually made up of stretches The city of the immediate future URCVKCNUKIPKɑECPEGDWVCEQIPKVKXGQPG QHITCUUDTQMGPD[RCTMKPINQVU6JG describes the expediency with which a delirium for the unbuilt. YKFGEKV[OC[QɈGTCTGNCVKQPUJKRVQ parcels of housing emerge out of the VJGUM[VJGYKPFCPFVJGJQTK\QP UCPFCVVJGQWVUMKTVUQHVJGEKV[CPF City of form ﬁxation but its opportunity for engagement the usurpation of rural land that occurs %KV[QHHQTOɑZCVKQPKUCEQPFKVKQPVJCV is limited. Its role is more residual there. derives from the wide, even spread of than opportunistic, more visual than built form. It is about the architectural performative. The open spaces that Its temporal facet concerns the consequence of singularity that results OCMGWRVJGYKFGEKV[CTGPQVEWTTGPVN[ rewriting of the core, in which from the division of plots of land and NKMGN[UKVGUHQTGPEQWPVGT OQFKɑECVKQPUVQVJGKPPGTEKV[CTG the regulated placement of buildings sometimes hasty, sometimes expansive, upon them. If each cadastral plot Even city CPFQHVGPVQVCNKUKPIKPVJGKTGɈGEVU receives a building on its centreline, and In the context of the thin development A readiness for erasure, coupled each building is limited in height and pattern of the wide and private cities, with a reluctance for staging, brings distanced from each of its boundaries, the even city presumes the region’s the immediacy of the periphery’s VJGPVJGDWKNFKPIKUQDLGEVKɑGFVJGUKVG plan to be regularly meted with development to operations on the core is its plinth. If architectural fabric is civic, recreational and commercial of the city. In both contexts, the city of generated through spatial continuity, programs. Being a vastly suburban city, the immediate future relies on the clean VJGPKPVJGEKV[QHHQTOɑZCVKQP VGPWQWUN[URTGCFCPFJGCXKN[EQFKɑGF slate, dispensing with the past in the instances of urban fabric are few. ɻ the even city also concerns a level service of current ideals. of monotony in Perth’s built form, a For the full PhD, please visit pattern of similarly scaled buildings Reserve city http://researchbank.rmit.edu.au/ on independent sites. The even city Reserve city grew naturally out of view/rmit:7877 presumes uniformity and spaciousness the activity of mapping, and the

- 64 - - 65 - These narratives were delved into, mapped, critiqued and amounted ﬁnally to the development of propositions for peripheral sites around the city proper, where the greatest morphological forces are present. The following are key mappings and the speculative projects that sprung from them

- 66 - - 67 - - 68 - - 69 - review.

- 70 -- 70 --- 71 -- -- 71 -- northbridge evolution 2004 - 2015 Author David McLoughlin

6JGKPXGUVOGPVKPVJGRWDNKETGCNOKP0QTVJDTKFIGRCTVKEWNCTN[CVVJGEQTPGTQH,COGUCPF.CMG5VTGGVU PQYVJG0QTVJDTKFIG2KC\\C QXGTVJGRCUVFGECFGJCUUGGPUKIPKɑECPVEJCPIGKPVJGDWKNVGPXKTQPOGPV Prior to the Piazza, this corner was occupied by the run down and dominant food court. 9KVJVJGDWUVNKPI2KC\\CCPFPGKIJDQWTKPIFGXGNQROGPVUPQYYGNNGUVCDNKUJGFKVECPDGFKɋEWNVVQ reimagine this space just ten years ago. Here, David McLoughlin presents a series of photographs VCMGPKP#RTKNCPFVJGPCICKPKP#RTKNJKIJNKIJVKPIVJKUFTCOCVKEVTCPUHQTOCVKQP

- 72 - - 73 - - 74 - - 75 - a new village in town Author Sarah McGann

The Claremont Quarter, a joint venture between Christou and Hassell Architects, is one of the OQUVUKIPKɑECPVFGXGNQROGPVUKP2GTVJӑU9GUVGTPUWDWTDUKPVJGNCUVFGECFG+VUIWKFKPIWTDCPFGUKIP concept and impact on the established Claremont precinct is examined.

The project comprises a retail podium, of the mall the designers have used an to Dovey (1999), these sorts of centres replicate authentic public streets in a XKUKV+PQVKEGFVJCVVJGTGYCUCOCTMGF undergoing change; new opportunities popular in many Asian cities, with a intelligent articulation of scale, light are ‘inversions’ of the city. The liminal privatised zone. The sense of place is FKɈGTGPEGDGVYGGPVJGIJQUVVQYP for innovation and diversity become four-storey apartment building set and materials to create a contemporary space of these shopping centres distorts orchestrated to provide cohesion and of the once-bustling Bayview Terrace available. The wave of pop-up shops, DCEMQPVJGRQFKWOQXGTNQQMKPIC CPFWNVKOCVGN[CɎWGPVHGGN6JGUECNG time, climate and any sense of place the right commercial mix that suits the CPFVJGVJTQPIUQHRGQRNGYCNMKPI SWKTM[ PQPHTCPEJKUG ECHGUCPFUOCNN NCPFUECRGFUYKOOKPIRQQNFGEM6JG of the building interior is generous and through this disconnection with any target consumer. shopping and eating in the internal bars that have grown popular around development is bounded by St Quentin carefully controls the mix of single and local context. mall and along the Lane. Despite the Perth could conceivably reignite the Avenue, Bayview Terrace and by the double height spaces to bring natural However, the positioning of the Lane, beautiful day, Bayview Terrace was area in a more organic, less controlled, railway to the north and consists of NKIJVVQVJGJKIJN[VTCɋEMGFITQWPF 7PNKMGUWEJUJQRRKPIEGPVTGUVJG and its connection to the Square, empty. From an urban perspective the perhaps more authentic way. The USOQHEQOOGTEKCNURCEG ɔQQT#ɑNVGTGFTQQHNKIJVTWPPKPIVJG Claremont Quarter nobly forgoes provides a ‘shortcut’ that increases the semi-pedestrianising of this streetscape aspiration of creating ‘a village in USOQHQɋEGURCEGCRCTVOGPVUCPF length of the mall provides natural commercially-proven disconnection level of permeability and accessibility JCUJCFCUVTCPIGFGUGTVGFGɈGEVQP a village’ is a worthy one, but one 1450 car bays. According to Christou light to the interior which assists in to create a new ‘Square’ and ‘Lane’ that for the pedestrian and railway traveller. the place. Street-art sculptures are that needs innovative enterprise, Architects the project engages a counteracting the negative impact NGCFQɈVJGKPUKFGOCNNVQGPICIGYKVJ #EEQTFKPIVQ,CEQDU WTDCP WUGFCUVTCɋEUVQRRGTUCPFEQPVTKDWVG and reasonable rents to sustain ‘shopping village’ concept in response associated with internalised space. This the locale. The Square addresses the St vitality is dependent on this sort of to the highly-directed one-way car both the inner and outer village in a to the existing streetscapes and creates is contrasted with areas of ‘shade’ that Quentin streetscape, provides a visual urban permeability and shortcutting signage that feels unnatural and over- complementary way. ɻ new streets, malls and lanes to produce lie under the mezzanine areas. The DTGCMKPVJGRQFKWOXQNWOGCPFETGCVGU through cities. In contrast, though, controlled. Bayview Terrace has become ‘a village within a village’. It received a OCVGTKCNUWPFGTHQQVCTGUVTGGVNKMGDWV an outdoor pause or gathering place. VJGOCKPOCNNUGGOUOQTGNKMGCJWIG CUVTCPIGUQTVQHFGCFGPFVJCVNCEMUVJG commendation in the Urban Design soft. The decision to use an outdoor 6JKUURCEGKUQXGTNQQMGFD[VJGWRRGT cul-de-sac running lengthways from urban vitality it once had. As a result category in the 2012 AIA WA awards. ɔQQTUWTHCEGUVTKRGFKPQRRQUKVKQPVQ level mall and by a café that opens to Bayview Terrace and ending at the of this, and the obvious competition of The mixed-use development brings new the mall length, is one that seems to it, providing visual activity and passive OCTMGVUV[NGHTWKVCPFXGIGVCDNGUJQRCV VJGOCNNCPFKVUECTRCTMOCP[QHVJG DWUKPGUUGUYQTMGTUCPFTGUKFGPVUVQVJKU YQTMYGNNCTEJKVGEVWTCNN[KPETGCUKPI UWTXGKNNCPEG6JG5SWCTGKUGɈGEVKXGN[ the far end. Similarly the underground shops on Bayview show considerable GUVCDNKUJGFCTGC5WEJFGPUKɑECVKQP the perceived depth and counteracting the pedestrian ‘streetfront’ of the ECTRCTMETGCVGUCPQVJGTV[RGQHXGTVKECN signs of commercial stress; closed, with apartment buildings along a VJGNKPGCTXQKFUOCFGD[VJGECTRCTM centre. The Lane connects to the Square cul-de-sac by directing shoppers to closing-down, for lease, or popping up. primary rail transit route, is a strong travelators. VJTQWIJVJGOCNNCPFKUVJGȄDCEMNCPGӑ emerge directly into the centre of the In contrast, and drawing on Dovey’s investment into the suburb and into access to the railway station via the OCNNHTQODGNQYCPFTGVTGCVDCEMFQYP analysis, there are no signs of failure in public transport in line with transit- In most malls found in and around DCEMQHJQWUGECTHQEWUGFGNGXCVKQP to their car through the travelator the mall. Made up of largely the same orientated design principles. It provides Perth there is little access or integration of Gugeri Street. The Lane comprises a without entering the ‘real’ streets of collection of (successful) chain shops as a new population to support the local with streetscapes, or views connecting collection of restaurants with outdoor Claremont. every other mall, the aesthetic is of up- enterprises of retail, business and to the context in which they sit. settings that line an articulated and beat messaging that is highly controlled, lifestyle. 5JQRRKPIEGPVTGUUWEJCU-CTTKP[WR furnished laneway. Arguably, it could be In the case of the Claremont Quarter, mostly of sales and success. or Morley, consist of large, mainly seen as an open-air mall that provides the impact of the city ‘inversion’ with Focusing here on the retail aspect, DNCPMXQNWOGUUWTTQWPFGFD[CUGCQH a curated high-end alternative to the KVUKPVGITCVGFRCTMKPIKUOQUVGXKFGPV It is worth considering that while the architectural detail and quality is RCTMGFECTUCPFECPHGGNKORGPGVTCDNG jaded food court concept. Described in the now outlying parts of Claremont. Bayview Terrace is feeling the pressure clearly evident. Inside the main street to the local or pedestrian. According as ‘lifestyle’ malls these sorts of spaces During my recent Sunday lunchtime of losing its village-centre status and is

- 76 - - 77 - Image: Bo Wong are designed in awaythat dealswithare designed Thevolumes narrow lottownhouse. UWPMGPDCVJTQQOVQCPGZKUVKPIӑU verandah’adds anew‘enclosed and Philip’s designforthis smallextension clear.two wasimmediately parties theand collaborative spiritbetween through itandthe strong connection YJQYGTGMKPFGPQWIJVQVCNMOG I metPhilipandthe clientatthe project, line upofarchitects. amidst astrong and Additionscategory ArchitectureResidential –Alterations (AIA)Architects nationalawardforthe the prestigiousAustralian Institute of mastery.and artistic won Theproject that combinespragmatism, intuition inamanner and methodology crafted however is the project small budget; with regardtothe are economical used The formalstructure andmaterials architectural simplicityisastonishing. itsparticular behind sophistication 2JKNKR5VGLUMCN;GVVJGFKUEKRNKPGCPF by alterations andadditionsproject play inthis nationalaward-winning There isawonderful simplicityat philip stejskal architecture bellevue terrace / the levels, climate and history ofthethe levels, climateandhistory GɈGEVKXGFKCITCOVJCVTGURQPFUVQ Overall clearand there isadirect, ‘Alterations category. andAdditions’ the nationalawardsitcameunderthe forthe WAcategory Awards, but for underthe ‘Small Project’ and awarded wasentered Interestingly the project contemplation. andamomentfor corner windowseat, the rearyard, providing adelightful towards cantilevers itself andprojects unravelling the journey. Aroom VJGPCTTQYUKVGFGɑPKPIURCEGCPF the visual andfoldsaround experience Thebuildingenvelope extendsdesired. as adjusted that canbe openings 6JGURCEGUCTGɔGZKDNGYKVJQRGTCDNG thresholds. habitable blurring the interiority/exteriority with is via anarrangement ofgradating steps ventilation. Thejourneytothe rearyard the views tothe garden,privacyand out transition/level transition, framing suchasinside- multiple architectonics Author BradLadyman - 79 (Alterations andAdditions). Architecturefor Residential –Houses Award and theAIA NationalAward Chapter) SmallProject Architecture This project wonthe2014AIA (WA innovative architectural designinWA. capability andambitionforcreative and practitioners who demonstrate strong anewgeneration of represents QPRCNRCDNGGZRGTKGPEG2JKNKR5VGLUMCN Australian designwith anemphasis approachtocontemporary modern aregionalpragmaticexpresses neo- and embodies project This delightful condensing it. OCMGUVJGURCEGHGGNNCTIGTTCVJGTVJCP planning diagram inthis instance RTQɑEKGPE[+PCYC[VJGVJTGGDCTTGN evidence ofastonishingarchitectural andshow formandfunction resolve FGEMKPICPFDTKEMRCXGFRNKPVJUVQ FRC elements,timber andtiled claddingandveneer, timber framed FGɑPGUVJGURCEGUWVKNKUKPIUVGGN site. Aminimalpalette ofmaterials ɻ Images: Robert Frith – Acorn Photo the space. ETCHVUOCPUJKRGZGORNKɑGFVJTQWIJQWV a touchstoneforthe simplicityand narrative acting as of the restaurant, underpins the andconceptual operation CPFCEJCKPNKPMEWTVCKP6JGDCMGT[ ofcustom-made breadtrolleys series bya from the remainingwarehouse subtly divided and issemi-enclosed, DCEMUGEVKQPQHVJGQRGPYCTGJQWUG 6JGCTVKUCPDCMGT[QEEWRKGUVJG TGCYCMGPVJGURCEG to tradespeople engaging ateamoflocal itspotential, Spaceagency recognised KPCITKO[OCMGUJKHVNCD[TKPVJ[GV alterations andadditions hadresulted Numerousinterior of conservation. worthy the frontfaçadewasdeemed however only Inventory; Heritage onthe Fremantleis included Municipal OCTKPGUGTXKEGUYQTMUJQR6JGDWKNFKPI asa of the andlaterfunctioned century atthe turnpharmaceutical warehouse asa building wasoriginallyconstructed .QECVGFQP2CMGPJCO5VTGGVVJG to continue. the buildingwhilstallowingitsnarrative gently re-appropriating of custodians, OCMKPI5RCEGCIGPE[CUUWOGFVJGTQNG hand-made quality bread- ofartisan andthe simplicityand by ‘slowfood’ VQVJGUKVGCPFRTQITCOYCUKPɔWGPEGF built fabric.Thethoughtfulapproach with andsympathetic tothe existing DCMGT[CPFTGUVCWTCPVEQORCVKDNG Fremantle asartisan initiatesadualuse of of ahistoricbuildinginthe heart andre-occupation refurbishment andnationalaward-winning This state bread incommon/spaceagency HTQOFGOQNKVKQPYQTMQPUKVG#DQXG concrete concrete wallsusingrecycled oframmed- bya series articulated under amezzaninelevel andare 6JGȄDCEMQHJQWUGӑHCEKNKVKGUGZVGPF INQYQXGTVJGYQTMDGPEJGU ɑVVKPIUVJCVGOKVCDTKIJVKPFWUVTKCN lit bythe light building’s originalsteel NGXGNYKPFQYQRGPKPIU6JGMKVEJGPKU TQQOKUOCKPVCKPGFKPENWFKPIɑXGJKIJ DWUVNKPIQRGPMKVEJGPHTQOVJGFKPKPI time. Theoriginalwalldividing the towearspace andareintended over ɔQQTD[CTVKUV#PIGNC(GTQNNCUQHVGPVJG aggregate ontothe exposed screened FKUVKNNKPIXCVUYJKNUVECTRGVUUKNM brandy fromdisused of Joinarecrafted (TGPEJQCMFKPKPIVCDNGUD[2CWN/QTTKU OCTKPGUGTXKEGUYQTMUJQRDGURQMG manufacturing languageofthe former shelving referencesthe steel Customised VTCPUHQTOCVKXGDGURQMGGNGOGPVU its character of through anumber typology,warehouse whilstsoftening The dininghallcelebrates the industrial intimacy inthis communalsetting. areasthat provideseating momentsof URCEGCPFNQQUGN[FGɑPKPIUGEQPFCT[ quality throughoutcandle-lit the dining awarm, imparting rafters, exposed hangsdramatically from thependants bulb ofEdison the 1900s,acollection YGNNEQQMGFHQQF+PCUWDVNGPQFVQ thethat sharingofsimple, facilitates creates awarmandwelcoming interior the hall communal diningtables, with Filled the warehouse. converted thequalities dim,lofty of epitomises dininghall timber-trussed The open Author HayleyCurnow - 81 - Interior Architecture. Award, andtheAIA NationalAward for AIA (WA Chapter)MondoluceLighting Architecture Award the for Commercial, Architecture, theAIA (WA Chapter) Julius Elischer Award for Interior Award for Heritage, theAIA (WA Chapter) Chapter) Margaret PittMorison This project wonthe2014AIA (WA to the evolving identityofFremantle. KUTGɑPGFCPFWPFGTUVCVGFEQPVTKDWVKPI it.Theresultingaesthetic overwhelming the existing builtfabricwithout elements enhancethe richnessof FKUEKRNKPGUVQETGCVGDGURQMGFGUKIP with andcollaboration allied to detail material palette, rigorousattention conversion. Therestrained warehouse inthiscraftsmanship thoughtful 5RCEGCIGPE[TGɔGEVUKORNKEKV[CPF experience. an alternative tothe ubiquitous alfresco EQPVCKPGFYCTGJQWUGYJKNUVQɈGTKPI forthe asabeacon activates the street RTQFWEGHQTVJGMKVEJGP6JGICTFGP supplying in frontofthe warehouse, the formerloadingbays garden occupies XKGYUVQVJGMKVEJGPDGNQY#PWTDCP YKVJCEKTEWNCTȄEJGHӑUVCDNGӑQɈGTKPI lounge andanintimatediningroom the mezzanineprovides aninformal ɻ sussex street / mountford architects Author Carly Barrett

Mountford Architects have been quietly initial perception but behind this Steel and timber-framed construction YQTMKPICYC[UKPEGVJGKTKPEGRVKQPKP there are a number of sophisticated CNNQYGFHQTCPGɋEKGPVQRGPRNCP DWVCTGEGPVUNCVGQHGZVTCQTFKPCT[ environmentally sound practices. NKXKPICTGCYKVJCTCMGFFQWDNGJGKIJV residential projects is changing that. ceiling that subtly references the home’s The practice was founded by Ben .QECVGFQPCUOCNN USO DNQEM industrial context. The emphasis that Mountford who, being locally trained the home was designed for a single was placed on sustainable materials cut his teeth on large projects on the semi-retiree who placed importance inspired the use of exposed beams, charcoal burnished slab and white east coast of Australia before returning on comfort, sustainability and long- walls that provide the new home with to Perth to set up his practice. Ben also VGTOCɈQTFCDKNKV[6JGENKGPVYCUYGNN textural patina the belies its age, whilst gained early construction experience versed in ESD principles and sought an minimising material usage and heat YQTMKPIYKVJJKUHCVJGTCTGUKFGPVKCN architectural solution that responded to gains. Its also within this main space DWKNFGT6JKUHQTOCVKXGMPQYNGFIG existing site vegetation and orientation. 6JGTGUWNVKUCUSOVYQUVQTG[VYQ that we see Mountford Architects of construction and craftsmanship employ light as an additional material, has helped Ben distinguish his bedroom home elegantly situated amongst existing trees which provide VCMKPIVJGRTQLGEVKPVQVJGTGCNOQHVJG practice locally, establishing a exceptional. shade and protection for the home’s distinctive architectural style that exterior, whilst exceptional views from is warm and livable, embracing light 6JKURTQLGEVCNUQGZGORNKɑGUCEJCPIG well placed windows internally provide a and dynamic form. in mentality. While around 95% of XGTFCPVQWVNQQMHQTVJGQEEWRCPV new homes in WA are by project home The home incorporates thermal I was privileged to visit two of builders, and the average size per new massing, sun-shading, low energy Mountford Architects’ recent projects dwelling over 245 sqm, Sussex Street ɑVVKPIUTCKPYCVGTCPFITG[YCVGT as part of last year’s Open House Perth bravely opposes this status quo in a way harvesting, permaculture gardening, that is both inspiring and edifying. event. Both locations were inundated plantation timbers, micro-climate with hundreds of visitors, a testament enhancing vegetation, and the list to quality of the designs. Paddington Mountford Architects predominantly goes on. engage in single residential projects Street, completed a couple of years DWVJCXGTGEGPVN[VCMGPQPCRCTVOGPV ago is the renovation of a 100 year old Mountford Architects sought to embed DWKNFKPICPFEQOOGTEKCNɑVQWVU cottage in North Perth that introduces low-tech sustainable initiatives within UJQYECUKPIVJGKTECRCEKV[VQWPFGTVCMG light and sculptural space into a small the design to enhance both the spatial a variety of project types. With a site. Sussex Street was completed just and the environmental quality of the number of new homes on the drawing in time for the event, and is perhaps project. The result is not overt but board it is clear that an ever-growing one of the most intelligent projects I rather an example of how clever use portfolio of high quality projects is

Image: Stephen Nicholls Image: Stephen have seen in its subtle incorporation of of orientation, construction UGVVQTCKUGVJGRTQɑNGQH/QWPVHQTF ESD principles which drove the design techniques and material selection Architects even further and distinguish RTQEGUU8KUKDN[VJGCTEJKVGEVWTCNHQTO can come together with spatial VJGRTCEVKEGCUCMG[EQPVTKDWVQTVQ9#ӑU and materiality dominate one’s dynamism and poetry. TGUKFGPVKCNOCTMGVɻ

- 82 - - 83 - Image: Andrew McDonald is perth ﬁxed? Author Andrew McDonald

In the more than seven years I have been It really does seem to have been the 6JGEKV[UVKNNNCEMUVJGUVWPPKPI running the blog The Worst of Perth, bars! And the culture that went with architecture to match Perth’s the city has completely transformed. VJGOKPENWFKPIVJKPIUNKMGVJG(TKPIG resurgence. The dumping of the It’s one of the most amazing few years Festival. Although, with a ratio of one indigenous cultural centre at Elizabeth in the development of Perth since the UOCNNDCTVQFTKPMGTUECPQWTNKXGTU 3WC[YCUCTGCNNQUU#OCIPKɑEGPV gold rush era. Historians many years in VCMGCP[OQTGXKDTCPE[! NCPFOCTMDWKNFKPIEQWNFJCXGDGGPVJG the future will study this period intently, OCMKPIQH2GTVJ+PUVGCFYGCTGIQKPI perhaps from the comfort of a driverless %TWFGITCɋVKVCIUCTGIKXKPIYC[VQ VQIGVINCUUVQYGTUHQTCEEQWPVKPIɑTOU Hover-Commodore . OWTCNU9GJCXGVJGVTCɋERTQDNGOU It’s time for the architecture to match QHQVJGTUV[NKUJEKVKGU6JGDKMGTCEMU the life of our new city at domestic and These few years have changed the place are almost as designed as Barcelona’s. corporate level. HTQOCDKVQHCLQMGVQCTGCNEKV[9JCV But will we miss the times when spray VJQUGHWVWTGJKUVQTKCPUYKNNOCMGQH painted genitals covered every surface? When I started The Worst of Perth blog, The Worst of Perth blog, now quietly Will Commodores crashing into houses YGFKFPӑVMPQYYJCVXKDTCPE[YCUDWV being archived by the State library is be our nostalgia? Or will Hover- YGMPGYYGFKFPӑVJCXGKV0QYYGUVKNN anyone's guess. Thousands of original Commodores still crash into virtual FQPӑVMPQYYJCVXKDTCPE[KUDWVYG photographs of blighted cocos palms, bedrooms a hundred years from now? VJKPMYGOKIJVJCXGUQOG2QUUKDN[C DNWGUMKGU[GNNQYUCPFQWVTCIGCPF Although the character of the city has NQV/QTGVJCP&WPGFKPOC[DGaa poor spelling. The comprehensive changed, the built environment remains collection of the city’s ephemera should a bit of a disappointment. Eaveless +VӑUVKOGHQTQWTCTEJKVGEVUVQVCMG2GTVJ DGVJGDCUKUHQTCTGOCTMCDNGVJGUKU west-facing mansions still roast in the KPVQCINQTKQWU 2QUV8KDTCPE[ HWVWTG sun, pumping out hot air. Important And what has really been the essence heritage buildings are still falling. I’m The Worst of Perth is an arts, culture and QHVJGEJCPIG!a9CUKVVJCV2GTVJɑPCNN[ astonished that there was not enough satire blog that has been documenting TGCEJGFCETKVKECNUK\GYJGTGFKɈGTGPV imagination to transform the wonderful the City since 2007. The architecture and areas of the city can grow with unique FESA building into a boutique hotel. built environment of Perth is a frequent characteristics? Was it enlightened The few heritage wins still have to pay and popular topic. The Worst of Perth is Government policy? Or was it just the for their preservation with glass boxes run by comedian Andrew McDonald and UOCNNDCTU!a LCOOGFKPDGJKPFVJGOa journalist David Cohen. ɻ

- 84 - THE ARCHITECT

AUTUMN 2015 PERTH 2005 - 2015 I AUTUMN 2015

PERTH 2005 - 2015