DOCSLIB.ORG

MAPK8 Antibody Cat

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
MAPK8 Antibody Cat MAPK8 Antibody Cat. No.: 62-956 MAPK8 Antibody Confocal immunofluorescent analysis of MAPK8 Antibody MAPK8 Antibody immunohistochemistry analysis in with HepG2 cell followed by Alexa Fluor 488-conjugated formalin fixed and paraffin embedded human breast goat anti-rabbit lgG (green).DAPI was used to stain the cell tissue followed by peroxidase conjugation of the nuclear (blue). secondary antibody and DAB staining. Specifications HOST SPECIES: Rabbit SPECIES REACTIVITY: Human HOMOLOGY: Predicted species reactivity based on immunogen sequence: Rat This MAPK8 antibody is generated from rabbits immunized with a KLH conjugated IMMUNOGEN: synthetic peptide between 358-389 amino acids from the C-terminal region of human MAPK8. TESTED APPLICATIONS: IF, IHC-P, WB September 24, 2021 1 https://www.prosci-inc.com/mapk8-antibody-62-956.html For WB starting dilution is: 1:1000 APPLICATIONS: For IF starting dilution is: 1:10~50 For IHC-P starting dilution is: 1:10~50 PREDICTED MOLECULAR 48 kDa WEIGHT: Properties This antibody is prepared by Saturated Ammonium Sulfate (SAS) precipitation followed by PURIFICATION: dialysis CLONALITY: Polyclonal ISOTYPE: Rabbit Ig CONJUGATE: Unconjugated PHYSICAL STATE: Liquid BUFFER: Supplied in PBS with 0.09% (W/V) sodium azide. CONCENTRATION: batch dependent Store at 4˚C for three months and -20˚C, stable for up to one year. As with all antibodies STORAGE CONDITIONS: care should be taken to avoid repeated freeze thaw cycles. Antibodies should not be exposed to prolonged high temperatures. Additional Info OFFICIAL SYMBOL: MAPK8 Mitogen-activated protein kinase 8, MAP kinase 8, MAPK 8, JNK-46, Stress-activated ALTERNATE NAMES: protein kinase 1c, SAPK1c, Stress-activated protein kinase JNK1, c-Jun N-terminal kinase 1, MAPK8, JNK1, PRKM8, SAPK1, SAPK1C ACCESSION NO.: P45983 PROTEIN GI NO.: 2507195 GENE ID: 5599 USER NOTE: Optimal dilutions for each application to be determined by the researcher. Background and References September 24, 2021 2 https://www.prosci-inc.com/mapk8-antibody-62-956.html JNK1 is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various cell stimuli, and targets specific transcription factors, and thus mediates immediate-early gene expression in response to cell stimuli. The activation of BACKGROUND: this kinase by tumor-necrosis factor alpha (TNF-alpha) is found to be required for TNF- alpha induced apoptosis. This kinase is also involved in UV radiation induced apoptosis, which is thought to be related to cytochrom c-mediated cell death pathway. Studies of the mouse counterpart of this gene suggested that this kinase play a key role in T cell proliferation, apoptosis and differentiation. REFERENCES: 1) Deng, Y., et al., Cell 115(1):61-70 (2003). 2) Luo, W., et al., J. Biol. Chem. 278(39):37451-37458 (2003). 3) Ghosh, J., Biochem. Biophys. Res. Commun. 307(2):342-349 (2003). 4) Utsugi, M., et al., J. Immunol. 171(2):628-635 (2003). ANTIBODIES FOR RESEARCH USE ONLY. For additional information, visit ProSci's Terms & Conditions Page. September 24, 2021 3 https://www.prosci-inc.com/mapk8-antibody-62-956.html.
Load more

Recommended publications
  • Personalized Prediction of Acquired Resistance to EGFR-Targeted Inhibitors Using a Pathway-Based Machine Learning Approach
    Cancers 2019, 11, x S1 of S9 Supplementary Materials: Personalized Prediction of Acquired Resistance to EGFR-Targeted Inhibitors Using a Pathway-Based Machine Learning Approach Young Rae Kim, Yong Wan Kim, Suh Eun Lee, Hye Won Yang and Sung Young Kim Table S1. Characteristics of individual studies. Sample Size Origin of Cancer Drug Dataset Platform S AR (Cell Lines) Lung cancer Agilent-014850 Whole Human GSE34228 26 26 (PC9) Genome Microarray 4x44K Gefitinib Epidermoid carcinoma Affymetrix Human Genome U133 GSE10696 3 3 (A431) Plus 2.0 Head and neck cancer Illumina HumanHT-12 V4.0 GSE62061 12 12 (Cal-27, SSC-25, FaDu, expression beadchip SQ20B) Erlotinib Head and neck cancer Illumina HumanHT-12 V4.0 GSE49135 3 3 (HN5) expression beadchip Lung cancer (HCC827, Illumina HumanHT-12 V3.0 GSE38310 3 6 ER3, T15-2) expression beadchip Lung cancer Illumina HumanHT-12 V3.0 GSE62504 1 2 (HCC827) expression beadchip Afatinib Lung cancer * Illumina HumanHT-12 V4.0 GSE75468 1 3 (HCC827) expression beadchip Head and neck cancer Affymetrix Human Genome U133 Cetuximab GSE21483 3 3 (SCC1) Plus 2.0 Array GEO, gene expression omnibus; GSE, gene expression series; S, sensitive; AR, acquired EGFR-TKI resistant; * Lung Cancer Cells Derived from Tumor Xenograft Model. Table S2. The performances of four penalized regression models. Model ACC precision recall F1 MCC AUROC BRIER Ridge 0.889 0.852 0.958 0.902 0.782 0.964 0.129 Lasso 0.944 0.957 0.938 0.947 0.889 0.991 0.042 Elastic Net 0.978 0.979 0.979 0.979 0.955 0.999 0.023 EPSGO Elastic Net 0.989 1.000 0.979 0.989 0.978 1.000 0.018 AUROC, area under curve of receiver operating characteristic; ACC, accuracy; MCC, Matthews correlation coefficient; EPSGO, Efficient Parameter Selection via Global Optimization algorithm.
    [Show full text]
  • MAP2K7 Monoclonal Antibody (M04), Clone 2G5
    MAP2K7 monoclonal antibody (M04), clone 2G5 Catalog # : H00005609-M04 規格 : [ 100 ug ] List All Specification Application Image Product Mouse monoclonal antibody raised against a partial recombinant Western Blot (Transfected lysate) Description: MAP2K7. Immunogen: MAP2K7 (NP_660186, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLAND GGSRSPSSESSPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEI enlarge Host: Mouse Western Blot (Recombinant protein) Reactivity: Human Immunohistochemistry Isotype: IgG1 Kappa (Formalin/PFA-fixed paraffin- embedded sections) Quality Control Antibody Reactive Against Recombinant Protein. Testing: enlarge Immunofluorescence Western Blot detection against Immunogen (36.63 KDa) . enlarge Storage Buffer: In 1x PBS, pH 7.4 ELISA In situ Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Proximity Ligation Assay (Cell) Instruction: MSDS: Download Datasheet: Download Applications enlarge Western Blot (Transfected lysate) Page 1 of 3 2016/5/21 Western Blot analysis of MAP2K7 expression in transfected 293T cell line by MAP2K7 monoclonal antibody (M04), clone 2G5. Lane 1: MAP2K7 transfected lysate(47.485 KDa). Lane 2: Non-transfected lysate. Protocol Download Western Blot (Recombinant protein) Protocol Download Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlarge this image Immunoperoxidase of monoclonal antibody to MAP2K7 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 1.2 ug/ml] Protocol Download Immunofluorescence enlarge this image Immunofluorescence of monoclonal antibody to MAP2K7 on HeLa cell . [antibody concentration 10 ug/ml] Protocol Download ELISA In situ Proximity Ligation Assay (Cell) Page 2 of 3 2016/5/21 Proximity Ligation Analysis of protein-protein interactions between MAPK8 and MAP2K7. HeLa cells were stained with anti-MAPK8 rabbit purified polyclonal 1:1200 and anti-MAP2K7 mouse monoclonal antibody 1:50.
    [Show full text]
  • H00005609-M04
    Product Datasheet MKK7/MEK7 Antibody (2G5) H00005609-M04 Unit Size: 0.1 mg Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. Protocols, Publications, Related Products, Reviews, Research Tools and Images at: www.novusbio.com/H00005609-M04 Updated 10/13/2020 v.20.1 Earn rewards for product reviews and publications. Submit a publication at www.novusbio.com/publications Submit a review at www.novusbio.com/reviews/destination/H00005609-M04 Page 1 of 3 v.20.1 Updated 10/13/2020 H00005609-M04 MKK7/MEK7 Antibody (2G5) Product Information Unit Size 0.1 mg Concentration Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services. Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. Clonality Monoclonal Clone 2G5 Preservative No Preservative Isotype IgG1 Kappa Purity IgG purified Buffer In 1x PBS, pH 7.4 Product Description Host Mouse Gene ID 5609 Gene Symbol MAP2K7 Species Human Specificity/Sensitivity MAP2K7 - mitogen-activated protein kinase kinase 7 Immunogen MAP2K7 (NP_660186, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLANDGGSR SPSSESSPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEI Notes Quality control test: Antibody Reactive Against Recombinant Protein. This product is produced by and distributed for Abnova, a company based in Taiwan. Product Application Details Applications Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Proximity Ligation Assay Recommended Dilutions Western Blot 1:500, ELISA, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunohistochemistry- Paraffin 1:10-1:500, Proximity Ligation Assay Application Notes Antibody reactivity against transfected lysate and recombinant protein for WB.
    [Show full text]
  • SNP Gene Chr* Region P Value Odd Ratios Minor Allele Major Allele Rs11184708 PRMT6 1 Upstream 6.447× 10−13 6.149 T a Rs108025
    Supplementary Table S1. Detailed information on scrub typhus-related candidate SNPs with a p value < 1 × 10−4. Odd Minor Major SNP Gene Chr* Region p value Ratios Allele Allele rs11184708 PRMT6 1 upstream 6.447× 10−13 6.149 T A rs10802595 RYR2 1 intron 0.00008738 2.593 A G downstream, intron, rs401974 LINC00276,LOC100506474 2 0.0000769 0.3921 T C upstream rs1445126 MIR4757,NT5C1B 2 upstream 0.00004819 3.18 A G LOC101930107,MIR4435-1,PLGLB rs62140478 2 downstream, upstream 7.404 × 10−8 9.708 T C 2 rs35890165 CPS1,ERBB4 2 downstream 0.00003952 0.373 A G rs34599430 ZNF385D,ZNF385D-AS2 3 intron, upstream 0.00002317 2.767 G A rs6809058 RBMS3,TGFBR2 3 downstream, upstream 0.00002507 3.094 G A rs3773683 SIDT1 3 intron 0.00006635 0.3543 C T rs11727383 CRMP1,EVC 4 intron 0.0000803 0.3459 A G rs17338338 NUDT12,RAB9BP1 5 upstream 0.00006987 0.3746 G A rs2059950 DTWD2,LOC102467225 5 downstream 0.000008739 2.911 G A rs72663337 DTWD2,LOC102467225 5 downstream 0.00009856 2.566 T C rs6882516 LSM11 5 UTR-3 0.00007553 2.968 A C rs76949230 TENM2 5 intron 0.00006305 3.048 G C rs3804468 LY86,LY86-AS1 6 intron 0.00003155 0.202 C T rs3778337 DSP 6 exon,intron 0.00007311 0.3897 G A rs16883596 MAP3K7,MIR4643 6 upstream 0.00005186 4.274 A G rs35144103 CCT6P3,ZNF92 7 downstream, upstream 0.00004885 3.422 A G rs13244090 LOC407835,TPI1P2 7 downstream, upstream 0.00004505 2.638 G A rs17167553 LRGUK 7 missense 0.00008788 2.75 T G rs6583826 IDE,KIF11 10 upstream 0.00006894 0.2846 G A rs10769111 LOC221122,PRDM11 11 downstream, upstream 0.0000619 0.3816 T G rs10848921
    [Show full text]
  • Role of the C-Jun N-Terminal Kinase Signaling Pathway in the Activation of Trypsinogen in Rat Pancreatic Acinar Cells
    INTERNATIONAL JOURNAL OF MOleCular meDICine 41: 1119-1126, 2018 Role of the c-Jun N-terminal kinase signaling pathway in the activation of trypsinogen in rat pancreatic acinar cells ZHENGPENG YANG1, WEIGUANG YANG1, MING LU2, ZHITUO LI1, XIN QIAO2, BEI SUN1, WEIHUI ZHANG1 and DONGBO XUE1 1Department of General Surgery, The First Affiliated Hospital of Harbin Medical University, Harbin, Heilongjiang 150001, P.R. China; 2Department of Surgery, David Geffen School of Medicine, University of Califonia at Los Angeles, Los Angeles, CA 90095, USA Received May 11, 2016; Accepted November 8, 2017 DOI: 10.3892/ijmm.2017.3266 Abstract. Bile acid causes trypsinogen activation in is an ATP‑competitive, efficient, selective and reversible pancreatic acinar cells through a complex process. Additional inhibitor of JNK. The results were verified by four sets of research is required to further elucidate which signaling experiments and demonstrated that trypsinogen activation is pathways affect trypsinogen activation when activated. The mediated by the JNK signaling pathway in the pathogenesis changes in the whole‑genome expression profile of AR42J of acute pancreatitis (AP). The present study provided a useful cells under the effect of taurolithocholic acid 3-sulfate reference for better understanding the pathogenesis of AP and (TLC‑S) were investigated. Furthermore, gene groups that identifying new targets to regulate trypsinogen activation, in may play a regulatory role were analyzed using the modular addition to providing valuable information for the treatment approach of biological networks. The aim of the present of A P. study was to improve our understanding of the changes in TLC-S-stimulated AR42J cells through a genetic functional Introduction modular analysis.
    [Show full text]
  • Computer Vision Profiling of Neurite Outgrowth Dynamics Reveals Spatiotemporal Modularity of Rho Gtpase Signaling
    Published January 4, 2016 JCB: ArticleTools Computer vision profiling of neurite outgrowth dynamics reveals spatiotemporal modularity of Rho GTPase signaling Ludovico Fusco,1* Riwal Lefort,2* Kevin Smith,3* Fethallah Benmansour,3 German Gonzalez,3 Caterina Barillari,4 Bernd Rinn,4 Francois Fleuret,2 Pascal Fua,3 and Olivier Pertz1 1Department of Biomedicine, University of Basel, 4058 Basel, Switzerland 2Institut Dalla Molle d'Intelligence Artificielle Perceptive (IDI AP Research Institute), 1920 Martigny, Switzerland 3Computer Vision Laboratory, École Polytechnique Fédérale de Lausanne, 1015 Lausanne, Switzerland 4Department of Biosystems Science and Engineering, Eidgenössische Technische Hochschule, 4058 Basel, Switzerland Rho guanosine triphosphatases (GTPases) control the cytoskeletal dynamics that power neurite outgrowth. This process consists of dynamic neurite initiation, elongation, retraction, and branching cycles that are likely to be regulated by Downloaded from specific spatiotemporal signaling networks, which cannot be resolved with static, steady-state assays. We present Neu- riteTracker, a computer-vision approach to automatically segment and track neuronal morphodynamics in time-lapse datasets. Feature extraction then quantifies dynamic neurite outgrowth phenotypes. We identify a set of stereotypic neurite outgrowth morphodynamic behaviors in a cultured neuronal cell system. Systematic RNA interference perturba- tion of a Rho GTPase interactome consisting of 219 proteins reveals a limited set of morphodynamic phenotypes. As proof of concept, we show that loss of function of two distinct RhoA-specific GTPase-activating proteins (GAPs) leads to jcb.rupress.org opposite neurite outgrowth phenotypes. Imaging of RhoA activation dynamics indicates that both GAPs regulate differ- ent spatiotemporal Rho GTPase pools, with distinct functions. Our results provide a starting point to dissect spatiotempo- ral Rho GTPase signaling networks that regulate neurite outgrowth.
    [Show full text]
  • Discovery of Potent and Selective MRCK Inhibitors with Therapeutic
    Published OnlineFirst January 30, 2018; DOI: 10.1158/0008-5472.CAN-17-2870 Cancer Translational Science Research Discovery of Potent and Selective MRCK Inhibitors with Therapeutic Effect on Skin Cancer Mathieu Unbekandt1, Simone Belshaw2, Justin Bower2, Maeve Clarke2, Jacqueline Cordes2, Diane Crighton2, Daniel R. Croft2, Martin J. Drysdale2, Mathew J. Garnett3, Kathryn Gill2, Christopher Gray2, David A. Greenhalgh4, James A.M. Hall3, Jennifer Konczal2, Sergio Lilla5, Duncan McArthur2, Patricia McConnell2, Laura McDonald2, Lynn McGarry6, Heather McKinnon2, Carol McMenemy4, Mokdad Mezna2, Nicolas A. Morrice5, June Munro1, Gregory Naylor1, Nicola Rath1, Alexander W. Schuttelkopf€ 2, Mairi Sime2, and Michael F. Olson1,7 Abstract The myotonic dystrophy–related Cdc42-binding kinases an autophosphorylation site, enabling development of a phos- MRCKa and MRCKb contribute to the regulation of actin–myosin phorylation-sensitive antibody tool to report on MRCKa status in cytoskeleton organization and dynamics, acting in concert with tumor specimens. In a two-stage chemical carcinogenesis model the Rho-associated coiled-coil kinases ROCK1 and ROCK2. The of murine squamous cell carcinoma, topical treatments reduced absence of highly potent and selective MRCK inhibitors has MRCKa S1003 autophosphorylation and skin papilloma out- resulted in relatively little knowledge of the potential roles of growth. In parallel work, we validated a phospho-selective anti- these kinases in cancer. Here, we report the discovery of the body with the capability to monitor drug pharmacodynamics. azaindole compounds BDP8900 and BDP9066 as potent and Taken together, our findings establish an important oncogenic selective MRCK inhibitors that reduce substrate phosphorylation, role for MRCK in cancer, and they offer an initial preclinical proof leading to morphologic changes in cancer cells along with inhi- of concept for MRCK inhibition as a valid therapeutic strategy.
    [Show full text]
  • Persistence, Engraftment, and Myogenesis of Frep Cells In
    Supplemental Information Supplemental Figures Supplemental Figure 1: Persistence, engraftment, and myogenesis of FReP cells in SCID mice TA muscles. Confocal microscopy images at transverse section view of SCID mice TA muscles at 6-weeks post-implantation are shown. Cellular myogenesis was documented by ACTN, myosin, and ACTA1 staining, while cell persistence and engraftment were indicated by the staining of 1 human myosin (using an anti-myosin antibody that recognized human antigen, but not mouse antigen), human MHC Class I, and human mitochondria. Scale bar = 25 μm. 2 Supplemental Figure 2: Intramuscular implantation of iPSC bears a high risk of tumorigenesis in vivo. 6 weeks after implantation of retrovirus-mediated BJ-iPSC in the left TA muscles of SCID mice, 2 of the 8 animals (25%; the dashed outlines highlighted animals in Figure 2) experienced tumor formation instead of muscle generation. Proliferating cell nuclear antigen (PCNA) was used to identify the proliferating cells. Scale bar = 500 μm (black) or 50 μm (white). 3 (continued on the next page) 4 Supplemental Figure 3: No tumor formation was observed in Fox Chase SCID-Beige mice that underwent intratesticular implantation of FReP cells. Gross appearance and histological evaluation (H&E staining) of adult Fox Chase SCID-Beige mice testes implanted with 1 x 106 (A) BJ fibroblasts [The representative gross appearance and H&E staining images shown in Figure 4A (leftmost panels in the first and second rows) 5 are reshown and outlined by the Black box here], (B) retrovirus-mediated
    [Show full text]
  • Identifying Patient-Specific Flow of Signal Transduction Perturbed By
    Quantitative Biology 2020, 8(4): 336–346 https://doi.org/10.1007/s40484-020-0227-0 RESEARCH ARTICLE Identifying patient-specific flow of signal transduction perturbed by multiple single-nucleotide alterations Olha Kholod1,2, Chi-Ren Shyu1,5,*, Jonathan Mitchem1,3,4, Jussuf Kaifi3, Dmitriy Shin1,2 1 MU Institute for Data Science and Informatics, University of Missouri, Columbia, MO 65201, USA 2 Department Pathology and Anatomical Sciences, School of Medicine, University of Missouri, Columbia, MO 65212, USA 3 Department of Surgery, School of Medicine, University of Missouri, Columbia, MO 65212, USA 4 Harry S. Truman Memorial Veterans’ Hospital, Columbia, MO 65201, USA 5 Department of Electrical Engineering & Computer Science, University of Missouri, Columbia, MO 65212, USA * Correspondence: [email protected] Received July 17, 2020; Revised September 3, 2020; Accepted September 3, 2020 Background: Identifying patient-specific flow of signal transduction perturbed by multiple single-nucleotide alterations is critical for improving patient outcomes in cancer cases. However, accurate estimation of mutational effects at the pathway level for such patients remains an open problem. While probabilistic pathway topology methods are gaining interest among the scientific community, the overwhelming majority do not account for network perturbation effects from multiple single-nucleotide alterations. Methods: Here we present an improvement of the mutational forks formalism to infer the patient-specific flow of signal transduction based on multiple single-nucleotide alterations, including non-synonymous and synonymous mutations. The lung adenocarcinoma and skin cutaneous melanoma datasets from TCGA Pan-Cancer Atlas have been employed to show the utility of the proposed method. Results: We have comprehensively characterized six mutational forks.
    [Show full text]
  • Kinome Expression Profiling to Target New Therapeutic Avenues in Multiple Myeloma
    Plasma Cell DIsorders SUPPLEMENTARY APPENDIX Kinome expression profiling to target new therapeutic avenues in multiple myeloma Hugues de Boussac, 1 Angélique Bruyer, 1 Michel Jourdan, 1 Anke Maes, 2 Nicolas Robert, 3 Claire Gourzones, 1 Laure Vincent, 4 Anja Seckinger, 5,6 Guillaume Cartron, 4,7,8 Dirk Hose, 5,6 Elke De Bruyne, 2 Alboukadel Kassambara, 1 Philippe Pasero 1 and Jérôme Moreaux 1,3,8 1IGH, CNRS, Université de Montpellier, Montpellier, France; 2Department of Hematology and Immunology, Myeloma Center Brussels, Vrije Universiteit Brussel, Brussels, Belgium; 3CHU Montpellier, Laboratory for Monitoring Innovative Therapies, Department of Biologi - cal Hematology, Montpellier, France; 4CHU Montpellier, Department of Clinical Hematology, Montpellier, France; 5Medizinische Klinik und Poliklinik V, Universitätsklinikum Heidelberg, Heidelberg, Germany; 6Nationales Centrum für Tumorerkrankungen, Heidelberg , Ger - many; 7Université de Montpellier, UMR CNRS 5235, Montpellier, France and 8 Université de Montpellier, UFR de Médecine, Montpel - lier, France ©2020 Ferrata Storti Foundation. This is an open-access paper. doi:10.3324/haematol. 2018.208306 Received: October 5, 2018. Accepted: July 5, 2019. Pre-published: July 9, 2019. Correspondence: JEROME MOREAUX - [email protected] Supplementary experiment procedures Kinome Index A list of 661 genes of kinases or kinases related have been extracted from literature9, and challenged in the HM cohort for OS prognostic values The prognostic value of each of the genes was computed using maximally selected rank test from R package MaxStat. After Benjamini Hochberg multiple testing correction a list of 104 significant prognostic genes has been extracted. This second list has then been challenged for similar prognosis value in the UAMS-TT2 validation cohort.
    [Show full text]
  • ADDITIONAL MATERIALS AVAILABLE on the HEI WEBSITE Research Report 198 Understanding the Early Biological Effects of Isoprene-Der
    ADDITIONAL MATERIALS AVAILABLE ON THE HEI WEBSITE Research Report 198 Understanding the Early Biological Effects of Isoprene-Derived Particulate Matter Enhanced by Anthropogenic Pollutants Surratt et al. Appendix A. Quality Assurance and Calibrations for DTT Assay Appendix B. Additional Characterization Results of Exposure Conditions Appendix C. Additional Results from the DTT Assay Appendix D. Cytotoxicity Measurements of Exposure Conditions Appendix E. Genes Analyzed and Additional Gene Expression Data for Exposures These Additional Materials were not formatted or edited by HEI. This document was part of the HEI Review Committee’s review process. Correspondence may be addressed to Dr. Jason D. Surratt, 135 Dauer Drive, 164 Rosenau Hall, Campus Box #7431; e-mail: [email protected]. Although this document was produced with partial funding by the United States Environmental Protection Agency under Assistance Award CR–83467701 to the Health Effects Institute, it has not been subjected to the Agency’s peer and administrative review and therefore may not necessarily reflect the views of the Agency, and no official endorsement by it should be inferred. The contents of this document also have not been reviewed by private party institutions, including those that support the Health Effects Institute; therefore, it may not reflect the views or policies of these parties, and no endorsement by them should be inferred. © 2019 Health Effects Institute, 75 Federal Street, Suite 1400, Boston, MA 02110-1817 Appendix A Quality assurance and calibrations for DTT Assay 0.5 0.4 0.3 0.2 Abs (412 nm) (412 Abs 0.1 0.0 #1 #2 #1: buffer + DTT+ sample #2: buffer + sample + DTT Figure A.1.
    [Show full text]
  • Kinases That Are Currently Stored in the Phospho.ELM Database
    List of the kinases that are currently stored in the Phospho.ELM database. The full names are mainly taken from the UniProt or HUGO databases. Kinase Full name Abl Proto-oncogene tyrosine-protein kinase ABL1 Abl2 v-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene) AFK Actin-fragmin kinase (Physarum polycephalum) ALK Anaplastic lymphoma kinase AMPK_group 5'-AMP-activated protein kinase ATM Ataxia telangiectasia mutated ATR Ataxia telangiectasia and Rad3-related protein (FRAP-related protein 1) Aurora A Serine/threonine-protein kinase 6 (STK6) Aurora B Serine/threonine-protein kinase 12 (AURKB) Axl Tyrosine-protein kinase receptor UFO BCKDK Branched-chain alpha-ketoacid dehydrogenase kinase BLK B lymphoid tyrosine kinase BMPR1B bone morphogenetic protein receptor, type IB BMX BMX non-receptor tyrosine kinase (Etk) Brk Breast tumor kinase (PTK6) BRSK1 BR serine/threonine kinase 1 (SAD1A) BTK Bruton's tyrosine kinase (AGMX1) (ATK) (BPK) CaM-KIalpha Calcium/calmodulin-dependent protein kinase I CaM-KIIalpha Calcium/calmodulin-dependent protein kinase II CaMKK_group Calcium/calmodulin-dependent protein kinases CaM-KIV Calcium/calmodulin-dependent protein kinase IV CaM-KKalpha Calcium/calmodulin-dependent protein kinase kinase 1, alpha CaM-KKbeta Calcium/calmodulin-dependent protein kinase kinase 2, beta CCDPK Ca2+/calmodulin-dependent protein kinase II (Suberites domuncula) CCRK Cell cycle related kinase CDK1 Cell division control protein 2 homolog (Cyclin-dependent kinase 1) CDK11 Cell division cycle 2-like 6
    [Show full text]