Polymorphisms in AKT3, FIGF, PRKAG3, and TGF-Beta Genes Are

Total Page:16

File Type:pdf, Size:1020Kb

Load more

Research Note Polymorphisms in AKT3, FIGF, PRKAG3, and TGF-β genes are associated with myofiber characteristics in chickens Sirui Chen ,1 Jianyong An ,1 Ling Lian , Lujiang Qu , Jiangxia Zheng , Guiyun Xu , and Ning Yang 2 National Engineering Laboratory for Animal Breeding and MOA Key Laboratory of Animal Genetics and Breeding, College of Animal Science and Technology, China Agricultural University, Beijing 100193, China ABSTRACT Muscle characteristics such as myofiber for each bird. Six SNP with a very low minor allele fre- diameter, density, and total number are important quency (<1%) were excluded for further analysis. The traits in broiler breeding and production. In the pres- remaining 13 SNP were used for the association study ent study, 19 SNP of 13 major genes, which are located with muscle characteristics. The results showed that in the vicinity of quantitative trait loci affecting breast SNP in TGF-β1/2/3 had significant effects on myofiber muscle weight, including INS, IGF2, PIK3C2A, AKT3, diameter. A SNP in PRKAG3 had a significant effect PRKAB2, PRKAG3, VEGFA, RPS6KA2/3, FIGF, and on myofiber density (P < 0.05). A C > G mutation in TGF-β1/2/3, were chosen to be genotyped by high- FIGF was strongly associated with total fiber number throughput matrix-assisted laser desorption/ionization (P < 0.05). Additionally, birds with the GG genotype time-of-flight mass spectrometry in a broiler popula- of the C > G mutation in AKT3 had significantly larger tion. One hundred twenty birds were slaughtered at 6 myofiber numbers (P < 0.05) than birds with the CC or wk of age. Body weight, breast muscle weight, myofiber GC genotype. The SNP identified in the present study diameter, density, and total number were determined might be used as potential markers in broiler breeding. Key words: AKT3 , FIGF , PRKAG3 , TGF-β , myofiber characteristic 2013 Poultry Science 92 :325–330 http://dx.doi.org/ 10.3382/ps.2012-02766 INTRODUCTION tions in the mammalian target of rapamycin (mTOR) pathway, which have been considered as important me- Muscle is a fibrous composite material at any level diators of protein synthesis and significantly associated of its structure, and as such its macroscopic properties with muscle mass and strength (Nie et al., 2005; Park depend on characteristics at all of these levels. Myofi- et al., 2006). Transforming growth factor β (TGF-β) bers are major components of the muscle tissue. Previ- is a secreted protein that exists in at least 3 isoforms ous studies have attempted to relate the myofiber char- called TGF-β1, TGF-β2, and TGF-β3 (Kambadur acteristics to muscle mass or muscularity in different et al., 1997; Rehfeldt et al., 2000). All 3 isoforms of domestic animal species. Joubert (1956) demonstrated TGF-β are related with the mTOR pathway through that a close relationship exists between myofiber di- their effects on RPS6KB1 via the PP2A gene (Petri- ameter and total musculature in lamb. Double-muscled tsch et al., 2000; Batut et al., 2008). They are unique cattle have twice as many myofibers as normal cattle growth factors because of their multifunctional and di- (Swatland and Kiefer, 1974). In pigs, a positive rela- verse activities in affecting cellular function of a variety tionship between myofiber number and fast growth of different cells (Cordeiro, 2002). All 13 genes we se- rate has been reported (Dwyer and Stickland, 1991). In lected are in the vicinity of QTL affecting breast muscle broiler breeding, myofiber characteristics such as myo- weight (BMW; http://www.animalgenome.org/cgi- fiber diameter, density, and total number are indispens- bin/QTLdb/index). The purpose of this investigation is able indicators of meat quality. to examine the association of genetic variation in these Numerous pathways/gene families/SNP play im- genes with muscle mass and myofiber characteristics in portant roles in muscle weight and tenderness. The chickens. genes AKT3, FIGF, IGF2, INS, PIK3C2A, PRKAB2, PRKAG3, RPS6KA2/3, and VEGFA are crucial junc- MATERIALS AND METHODS Bird Management and Muscle © 2013 Poultry Science Association Inc. Received September 12, 2012. Characterization Accepted October 14, 2012. 1 These authors contributed equally to the work. Chicks from a pure line of broilers were raised on a 2 Corresponding author: [email protected] floor and managed in a conventional way. Commercial 325 326 CHEN ET AL. diets were provided ad libitum. One hundred twenty in 1 mm2 was used to represent the fiber density. The birds in equal numbers of males and females were killed total myofiber number was determined based on the at 6 wk of age. The BW and BMW of each bird were method reported by Gollnick et al. (1981). All proce- measured. The whole chicken was immerged in 10% dures in this experiment were approved by the Animal (vol/vol) buffered formalin fixative pH 7.0 at 4°C for Care Committee of the China Agricultural University. at least 2 d. After fixation, the right side of the breast muscle was removed. A proper sample was taken from Genotyping the anterior portion of the breast by dissecting along the lengthwise myofiber orientation (Figure 1). Sam- Genomic DNA was extracted from the blood sam- ples were processed as described by Scheuermann et al. ples using a traditional phenol-chloroform protocol, (2004). then quantified using a NanoDrop spectrophotometer Muscle sections were stained with hematoxylin and (GE Healthcare Life Sciences, Uppsala, Sweden), and eosin to observe the morphology of the muscle tissue. the final concentrations were 2 to 10 ng/μL. Nineteen The images of the slide were captured by the digital SNP in 13 genes, AKT3, FIGF, IGF2, INS, PIK3C2A, microscope camera linked with a biological microscope PRKAB2, PRKAG3, RPS6KA2/3, TGF-β1/2/3, and (YS100, Nikon, Tokyo, Japan). An image analyzer (Im- VEGFA, were selected from the UCSC SNP database age Pro Plus 5.0, Media Cybernetics, Silver Spring, (http://genome.ucsc.edu/cgi-bin/). Three primers, MD) was used to score all of the parameters in the sec- composed of 2 PCR primers and 1 extension primer, tions. At least 50 fibers in each picture were measured were designed for each SNP (Table 1). Genotyping of to get the mean of the fiber diameter. Number of fibers the 120 individuals was performed using matrix-assist- ed laser desorption/ionization time-of-flight mass spec- trometry on the Mass ARRAY iPLEX Platform (Se- quenom, San Diego, CA). Genotype quality control and data filtering were conducted for all SNP data across the 120 individuals before further analysis. Statistical Analysis Single nucleotide polymorphisms that deviated from the Hardy-Weinberg equilibrium were excluded. The SNP with a genotype call rate <85% and minor allele frequency <1% across all individuals were discarded. The association of the remaining SNP with chicken muscle characteristics was performed with the GLM procedure in SAS version 9.2 software (SAS Institute Inc., Cary, NC). The model was as follows: Yijk = μ + Gi + Sj + Gi × Sj + eijk, where Yijk represents the observed values of the traits, μ is the population mean, Gi is the fixed effect of SNP genotypes, Sj is the fixed effect of sex, Gi × Sj is the interaction effect between SNP genotype and sex, and eijk are the residuals. RESULTS AND DISCUSSION In the present study, genotype quality control and data filtering resulted in the removal of 6 SNP with a low minor allele frequency. The remaining 13 SNP in Hardy-Weinberg equilibrium were finally detected as polymorphic with minor allele frequency > 1% and genotype call rate > 85% (Table 2). Association analy- sis revealed that none of 13 SNP were significantly as- sociated with BW or BMW, although they are in the vicinity of quantitative trait loci affecting BMW. Six Figure 1. Schematic view of pectoralis muscle sampling: a meat sample was taken from the breast by dissecting along the lengthwise of them were significantly associated with at least one myofiber orientation. myofiber characteristic, as shown in Table 3. Table 1. Primer sequences for the selected SNP sites Location Gene SNP code in UCSC1 of SNP Forward primer Reverse primer Extension primer INS Snp.34.128.23869.S.1 Intron 1 ACGTTGGATGTTTGCTTGCTCTGCTCGTAG ACGTTGGATGAACTGTTCTGCATTTGGCCC GCTTCTTCACCCATCAC Snp.34.128.25436.S.1 Intron 1 ACGTTGGATGATAGATGGAGAAGAGTCCCC ACGTTGGATGGAGCTGTACTATAGTTAGGG TCGTACCCTGCCAAGTCCCAATCAT IGF-2 Snp.34.125.29324.S.1 3′-downstream ACGTTGGATGATTACCATTATCAGCGTGCC ACGTTGGATGCCCATCATCCTCTCTCCTAA TCCAATTATCAGCGTGCCCTTGTG region Snp.34.126.10608.S.1 5′-upstream ACGTTGGATGCTCACCAGCAAACATAGCTC ACGTTGGATGTAATGGCCTTCTTCCCATGC ATGCAATCAGCCCCTTAATT region NOTE RESEARCH PIK3C2A Snp.34.179.36113.S.1 Intron 21 ACGTTGGATGGGTGTGGGAAAGGAATTAAG ACGTTGGATGTCCAAGGTATTTGGAATCTG ATGCTCCCTGACTCA Snp.34.179.7791.S.1 5′-upstream ACGTTGGATGTCACAGGTAGGTAGAGCAAG ACGTTGGATGGTGAAGCTTGTTAGGTACCC GAGGTAGAGCAAGTACTTT region Akt3 Snp.9.219.25666.S.2 5′-upstream ACGTTGGATGCGAAACCTTAAGGAAACGCC ACGTTGGATGTGCTGCGTTGCAAAGAATGG TGAAACGCCAGAGGAG region Snp.9.216.35315.S.3 Intron 9 ACGTTGGATGTCTCACCCCCTTCAAAACTC ACGTTGGATGGACAGCTGACTTAAACTGGC TCCTTCCACATGATGTCATA PRKAB2 Snp.40.153.727.S.1 5′-upstream ACGTTGGATGTTGGATATGCCCACAGCTTG ACGTTGGATGCTTCAGACCTCAGTTTCCAC AGTCTGATCTGTTGCTATATGATA region PRKAG3 Snp.15.42.7455.S.1 3′-downstream ACGTTGGATGGGTGTGAGGAGCAAAGAGAG ACGTTGGATGACCTCCTCTTTTTCTCCCTG AAGTAGCAAAGAGAGCTACTC region TGF-β1 Snp.41.175.82522.S.1 5′-upstream ACGTTGGATGTACACAATCCTGTCTAGGAG ACGTTGGATGTCAAGCATCTGTAGGCTCTG GATCCTGTCTAGGAGCATCTC region TGF-β2 Snp.9.573.9474.S.1 Intron 6 ACGTTGGATGCCCTTCGGTGCTTTTGTAAA
Recommended publications
  • Gene Symbol Gene Description ACVR1B Activin a Receptor, Type IB

    Gene Symbol Gene Description ACVR1B Activin a Receptor, Type IB

    Table S1. Kinase clones included in human kinase cDNA library for yeast two-hybrid screening Gene Symbol Gene Description ACVR1B activin A receptor, type IB ADCK2 aarF domain containing kinase 2 ADCK4 aarF domain containing kinase 4 AGK multiple substrate lipid kinase;MULK AK1 adenylate kinase 1 AK3 adenylate kinase 3 like 1 AK3L1 adenylate kinase 3 ALDH18A1 aldehyde dehydrogenase 18 family, member A1;ALDH18A1 ALK anaplastic lymphoma kinase (Ki-1) ALPK1 alpha-kinase 1 ALPK2 alpha-kinase 2 AMHR2 anti-Mullerian hormone receptor, type II ARAF v-raf murine sarcoma 3611 viral oncogene homolog 1 ARSG arylsulfatase G;ARSG AURKB aurora kinase B AURKC aurora kinase C BCKDK branched chain alpha-ketoacid dehydrogenase kinase BMPR1A bone morphogenetic protein receptor, type IA BMPR2 bone morphogenetic protein receptor, type II (serine/threonine kinase) BRAF v-raf murine sarcoma viral oncogene homolog B1 BRD3 bromodomain containing 3 BRD4 bromodomain containing 4 BTK Bruton agammaglobulinemia tyrosine kinase BUB1 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) BUB1B BUB1 budding uninhibited by benzimidazoles 1 homolog beta (yeast) C9orf98 chromosome 9 open reading frame 98;C9orf98 CABC1 chaperone, ABC1 activity of bc1 complex like (S. pombe) CALM1 calmodulin 1 (phosphorylase kinase, delta) CALM2 calmodulin 2 (phosphorylase kinase, delta) CALM3 calmodulin 3 (phosphorylase kinase, delta) CAMK1 calcium/calmodulin-dependent protein kinase I CAMK2A calcium/calmodulin-dependent protein kinase (CaM kinase) II alpha CAMK2B calcium/calmodulin-dependent
  • 32-3099: PRKAB1 Recombinant Protein Description

    32-3099: PRKAB1 Recombinant Protein Description

    9853 Pacific Heights Blvd. Suite D. San Diego, CA 92121, USA Tel: 858-263-4982 Email: [email protected] 32-3099: PRKAB1 Recombinant Protein Alternative Name : AMPK,HAMPKb,5'-AMP-activated protein kinase subunit beta-1,AMPK subunit beta-1,AMPKb,PRKAB1. Description Source : E.coli. PRKAB1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 293 amino acids (1-270 a.a.) and having a molecular mass of 32.8 kDa. The PRKAB1 is fused to a 23 amino acid His Tag at N- Terminus and purified by proprietary chromatographic techniques. 5'-AMP-activated protein kinase subunit beta-1 (PRKAB1) hinders protein, carbohydrate and lipid biosynthesis, in addition to cell growth and proliferation. AMPK is a heterotrimer comprised of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK acts via direct phosphorylation of metabolic enzymes, and longer-term effects by phosphorylation of transcription regulators. PRKAB1 is a regulator of cellular polarity by remodeling the actin cytoskeleton; most likely by indirectly activating myosin. Beta non-catalytic subunit acts as a scaffold on which the AMPK complex compiles, through its C-terminus that joins alpha (PRKAA1 or PRKAA2) and gamma subunits (PRKAG1, PRKAG2 or PRKAG3). Product Info Amount : 5 µg Purification : Greater than 85% as determined by SDS-PAGE. The PRKAB1 protein solution (0.5mg/ml) contains 20mM Tris-HCl buffer (pH 8.0), 0.15M NaCl, Content : 10% glycerol and 1mM DTT. Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of Storage condition : time.
  • AMPK Beta 1 (PRKAB1) Mouse Monoclonal Antibody [Clone ID: OTI3D10] Product Data

    AMPK Beta 1 (PRKAB1) Mouse Monoclonal Antibody [Clone ID: OTI3D10] Product Data

    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA813116S AMPK beta 1 (PRKAB1) Mouse Monoclonal Antibody [Clone ID: OTI3D10] Product data: Product Type: Primary Antibodies Clone Name: OTI3D10 Applications: WB Recommended Dilution: WB 1:500 Reactivity: Human, Mouse, Rat Host: Mouse Isotype: IgG1 Clonality: Monoclonal Immunogen: Human recombinant protein fragment corresponding to amino acids 2-270 of human PRKAB1 (NP_006244) produced in E.coli. Formulation: PBS (PH 7.3) containing 1% BSA, 50% glycerol and 0.02% sodium azide. Concentration: 1 mg/ml Purification: Purified from mouse ascites fluids or tissue culture supernatant by affinity chromatography (protein A/G) Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 30.2 kDa Gene Name: protein kinase AMP-activated non-catalytic subunit beta 1 Database Link: NP_006244 Entrez Gene 19079 MouseEntrez Gene 83803 RatEntrez Gene 5564 Human Q9Y478 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 AMPK beta 1 (PRKAB1) Mouse Monoclonal Antibody [Clone ID: OTI3D10] – TA813116S Background: Non-catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy- consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation.
  • Active AMPK (A1/B2/G3)

    Active AMPK (A1/B2/G3)

    Catalog # Aliquot Size P83-10G-05 5 µg P83-10G-10 10 µg AMPK (A1/B2/G3), Active Full-length recombinant protein expressed in Sf9 cells Catalog # P83-10G Lot # Y1103 -1 Product Description Specific Activity Recombinant full-length human AMPK (combination of A1/B2/G3 subunits) was expressed by baculovirus in Sf9 480,000 insect cells using the N-terminal GST and C-terminal His tags. The gene accession numbers for the three subunits 360,000 (A1/B2/G3) are NM_006251 , NM_005399 , and NM_017431 . 240,000 Gene Aliases 120,000 Activity (cpm) Activity Subunit A1: PRKAA1, MGC33776, MGC57364 0 Subunit B2: PRKAB2, MGC61468 0 50 100 150 200 Subunit G3: PRKAG3 Protein (ng) Formulation The specific activity of AMPK was determined to be 400 nmol /min/mg as per activity assay protocol. Recombinant protein stored in 50mM Tris-HCl, pH 7.5, 150mM NaCl, 10mM glutathione, 0.1mM EDTA, 0.25mM Purity DTT, 0.1mM PMSF, 25% glycerol. Storage and Stability Store product at –70 oC. For optimal storage, aliquot target into smaller quantities after centrifugation and The purity of AMPK was determined store at recommended temperature. For most favorable to be >80% by densitometry, performance, avoid repeated handling and multiple approx. MW ~92kDa (A1), ~62kDa (B2), and ~108kDa (G3). freeze/thaw cycles. Scientific Background AMP-activated protein kinase (AMPK) exhibits a key role as a master regulator of cellular energy homeostasis (1). AMPK exists as a heterotrimeric complex composed of a AMPK (A1/B2/G3), Active catalytic α subunit and regulatory β and γ subunits. Full-length recombinant protein expressed in Sf9 cells Binding of AMP to the γ subunit allosterically activates the complex.
  • Metabolic Regulations in T Cells

    Metabolic Regulations in T Cells

    Metabolic Regulations in T Cells Catalog No. AKT Related Products Applications Reactivity H00000207-M01 AKT1 monoclonal antibody (M01), clone 4C3 S-ELISA,ELISA,IP,RNAi-Ab,PLA-Ce Human H00000207-A01 AKT1 polyclonal antibody (A01) ELISA,WB-Re Human H00000207-D01P AKT1 purified MaxPab rabbit polyclonal antibody (D01P) WB-Tr,PLA-Ce Human PAB2612 AKT1 (phospho S129) polyclonal antibody ELISA,Dot-Pep Human MAB0065 AKT1 (phospho S473) monoclonal antibody, clone 104A282 IP,WB-Ce Human,Mouse MAB10260 AKT1 (phospho T308) monoclonal antibody, clone 18F3.H11 IP,ELISA,WB-Ce,IHC-P Human,Mouse PAB7912 AKT1 (phospho T34) polyclonal antibody ELISA,WB-Ce Human,Rabbit,Rat PAB25897 AKT1 (phospho T450) polyclonal antibody IHC-P,IF Human,Mouse,Rat H00000207-PW1 AKT1 (Human) IP-WB Antibody Pair IP-WB Human H00000207-AP11 AKT1 (Human) Matched Antibody Pair EPair-Re Human H00000207-P01 AKT1 (Human) Recombinant Protein (P01) AP,Array,ELISA,WB-Re H00000207-T01 AKT1 293T Cell Transient Overexpression Lysate(Denatured) WB KA2151 AKT1 (pS473) (Human/Mouse/Rat) ELISA Kit Qual Human,Mouse,Rat KA4587 AKT1 (pS473)/GSK3B (pS9)/MTOR (pS2448)/Pan Qual Human AKT1/GSK3B/MTOR (Human) ELISA Kit KA2152 AKT1 (pS473)/Pan AKT1 (Human/Mouse/Rat) ELISA Kit Qual Human,Mouse,Rat H00000208-M01 AKT2 monoclonal antibody (M01), clone 1B3 WB-Ce,IF,S-ELISA,ELISA,WB-Re Human H00000208-A01 AKT2 polyclonal antibody (A01) ELISA,WB-Re Human PAB0404 AKT2 (phospho S474) polyclonal antibody Dot-Pep Human MAB15924 AKT2 (phospho S478) monoclonal antibody, clone Q10-E ICC Human H00000208-AP41 AKT2 (Human)
  • Chemical Agent and Antibodies B-Raf Inhibitor RAF265

    Chemical Agent and Antibodies B-Raf Inhibitor RAF265

    Supplemental Materials and Methods: Chemical agent and antibodies B-Raf inhibitor RAF265 [5-(2-(5-(trifluromethyl)-1H-imidazol-2-yl)pyridin-4-yloxy)-N-(4-trifluoromethyl)phenyl-1-methyl-1H-benzp{D, }imidazol-2- amine] was kindly provided by Novartis Pharma AG and dissolved in solvent ethanol:propylene glycol:2.5% tween-80 (percentage 6:23:71) for oral delivery to mice by gavage. Antibodies to phospho-ERK1/2 Thr202/Tyr204(4370), phosphoMEK1/2(2338 and 9121)), phospho-cyclin D1(3300), cyclin D1 (2978), PLK1 (4513) BIM (2933), BAX (2772), BCL2 (2876) were from Cell Signaling Technology. Additional antibodies for phospho-ERK1,2 detection for western blot were from Promega (V803A), and Santa Cruz (E-Y, SC7383). Total ERK antibody for western blot analysis was K-23 from Santa Cruz (SC-94). Ki67 antibody (ab833) was from ABCAM, Mcl1 antibody (559027) was from BD Biosciences, Factor VIII antibody was from Dako (A082), CD31 antibody was from Dianova, (DIA310), and Cot antibody was from Santa Cruz Biotechnology (sc-373677). For the cyclin D1 second antibody staining was with an Alexa Fluor 568 donkey anti-rabbit IgG (Invitrogen, A10042) (1:200 dilution). The pMEK1 fluorescence was developed using the Alexa Fluor 488 chicken anti-rabbit IgG second antibody (1:200 dilution).TUNEL staining kits were from Promega (G2350). Mouse Implant Studies: Biopsy tissues were delivered to research laboratory in ice-cold Dulbecco's Modified Eagle Medium (DMEM) buffer solution. As the tissue mass available from each biopsy was limited, we first passaged the biopsy tissue in Balb/c nu/Foxn1 athymic nude mice (6-8 weeks of age and weighing 22-25g, purchased from Harlan Sprague Dawley, USA) to increase the volume of tumor for further implantation.
  • AMP-Activated Protein Kinase: the Current Landscape for Drug Development

    AMP-Activated Protein Kinase: the Current Landscape for Drug Development

    REVIEWS AMP-activated protein kinase: the current landscape for drug development Gregory R. Steinberg 1* and David Carling2 Abstract | Since the discovery of AMP-activated protein kinase (AMPK) as a central regulator of energy homeostasis, many exciting insights into its structure, regulation and physiological roles have been revealed. While exercise, caloric restriction, metformin and many natural products increase AMPK activity and exert a multitude of health benefits, developing direct activators of AMPK to elicit beneficial effects has been challenging. However, in recent years, direct AMPK activators have been identified and tested in preclinical models, and a small number have entered clinical trials. Despite these advances, which disease(s) represent the best indications for therapeutic AMPK activation and the long-term safety of such approaches remain to be established. Cardiovascular disease Dramatic improvements in health care coupled with identifying a unifying mechanism that could link these (CVD). A term encompassing an increased standard of living, including better nutri- changes to multiple branches of metabolism followed diseases affecting the heart tion and education, have led to a remarkable increase in the discovery that the AMP-activated protein kinase or circulatory system. human lifespan1. Importantly, the number of years spent (AMPK) provided a common regulatory mechanism in good health is also increasing2. Despite these positive for inhibiting both cholesterol (through phosphoryla- Non-alcoholic fatty liver disease developments, there are substantial risks that challenge tion of HMG-CoA reductase (HMGR)) and fatty acid (NAFLD). A very common continued improvements in human health. Perhaps the (through phosphorylation of acetyl-CoA carboxylase disease in humans in which greatest threat to future health is a chronic energy imbal- (ACC)) synthesis8 (BOx 1).
  • (AMP)-Activated Protein Kinase: a New Target for Nutraceutical Compounds

    (AMP)-Activated Protein Kinase: a New Target for Nutraceutical Compounds

    International Journal of Molecular Sciences Review Adenosine Monophosphate (AMP)-Activated Protein Kinase: A New Target for Nutraceutical Compounds Fabiola Marín-Aguilar 1, Luis E. Pavillard 1, Francesca Giampieri 2, Pedro Bullón 1 and Mario D. Cordero 1,* 1 Research Laboratory, Oral Medicine Department, University of Sevilla, Sevilla 41009, Spain; [email protected] (F.M.-A.); [email protected] (L.E.P.); [email protected] (P.B.) 2 Dipartimento di Scienze Cliniche Specialistiche ed Odontostomatologiche—Sez. Biochimica, Università Politecnica delle Marche, Ancona 60100, Italy; [email protected] * Correspondence: [email protected]; Tel.: +34-954-481-120; Fax: +34-954-486-784 Academic Editor: Rosa M. Lamuela-Raventós Received: 17 November 2016; Accepted: 23 January 2017; Published: 29 January 2017 Abstract: Adenosine monophosphate-activated protein kinase (AMPK) is an important energy sensor which is activated by increases in adenosine monophosphate (AMP)/adenosine triphosphate (ATP) ratio and/or adenosine diphosphate (ADP)/ATP ratio, and increases different metabolic pathways such as fatty acid oxidation, glucose transport and mitochondrial biogenesis. In this sense, AMPK maintains cellular energy homeostasis by induction of catabolism and inhibition of ATP-consuming biosynthetic pathways to preserve ATP levels. Several studies indicate a reduction of AMPK sensitivity to cellular stress during aging and this could impair the downstream signaling and the maintenance of the cellular energy balance and the stress resistance. However, several diseases have been related with an AMPK dysfunction. Alterations in AMPK signaling decrease mitochondrial biogenesis, increase cellular stress and induce inflammation, which are typical events of the aging process and have been associated to several pathological processes.
  • PRKAG3 (Human) Recombinant Protein (P01)

    PRKAG3 (Human) Recombinant Protein (P01)

    Produktinformation Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien Weitere Information auf den folgenden Seiten! See the following pages for more information! Lieferung & Zahlungsart Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic PRKAG3 (Human) Recombinant Entrez GeneID: 53632 Protein (P01) Gene Symbol: PRKAG3 Catalog Number: H00053632-P01 Gene Alias: AMPKG3 Regulation Status: For research use only (RUO) Gene Summary: The protein encoded by this gene is a Product Description: Human PRKAG3 full-length ORF regulatory subunit of the AMP-activated protein kinase ( NP_059127.2, 1 a.a. - 489 a.a.) recombinant protein (AMPK). AMPK is a heterotrimer consisting of an alpha with GST-tag at N-terminal. catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme Sequence: that monitors cellular energy status. In response to MEPGLEHALRRTPSWSSLGGSEHQEMSFLEQENSSS cellular metabolic stresses, AMPK is activated, and thus WPSPAVTSSSERIRGKRRAKALRWTRQKSVEEGEPP phosphorylates and inactivates acetyl-CoA carboxylase GQGEGPRSRPAAESTGLEATFPKTTPLAQADPAGVGT (ACC) and beta-hydroxy beta-methylglutaryl-CoA
  • Association of AMP-Activated Protein Kinase with Risk and Progression of Non–Hodgkin Lymphoma

    Association of AMP-Activated Protein Kinase with Risk and Progression of Non–Hodgkin Lymphoma

    Published OnlineFirst February 8, 2013; DOI: 10.1158/1055-9965.EPI-12-1014 Cancer Epidemiology, Research Article Biomarkers & Prevention Association of AMP-Activated Protein Kinase with Risk and Progression of Non–Hodgkin Lymphoma Aaron E. Hoffman1, Kathryn Demanelis1, Alan Fu2, Tongzhang Zheng2, and Yong Zhu2 Abstract Background: Metabolic dysregulation has been identified as an "emerging hallmark" of cancer. The heterotrimeric AMP-activated protein kinase (AMPK) complex is a central regulator of the metabolic system and an important component of the mTOR pathway and the p53 axis, making it uniquely positioned to influence carcinogenesis through its canonical functions in the metabolic arena, as well as through more traditional mechanisms such as regulation of apoptosis and angiogenesis. Methods: We conducted a population-based genetic association study to examine the impact of mutations in AMPK subunit genes on risk of non–Hodgkin lymphoma (NHL). We also analyzed public microarray data to determine the expression of AMPK in NHL cells and to assess the influence of AMPK expression on overall survival in patients with NHL. Results: We identified an AMPK subunit haplotype, which was significantly associated with NHL [OR, 5.44, 95% confidence interval (CI), 2.15–13.75] in women with no family history of cancer. Haplotypes in two subunits, PRKAA2 and PRKAG3, were nominally associated with the follicular and diffuse large B-cell lymphoma histologic subtypes, respectively, although these associations did not retain statistical significance after correction for multiple comparisons. Further, both of these subunits were differentially expressed (P < 0.05) in one or more lymphoma cell type, and higher expression of two versions of the AMPK-b subunit was significantly associated with increased 5-year survival among patients with NHL (P ¼ 0.001 and P ¼ 0.021).
  • Constitutively Active AMP Kinase Mutations Cause Glycogen Storage Disease Mimicking Hypertrophic Cardiomyopathy

    Constitutively Active AMP Kinase Mutations Cause Glycogen Storage Disease Mimicking Hypertrophic Cardiomyopathy

    Constitutively active AMP kinase mutations cause glycogen storage disease mimicking hypertrophic cardiomyopathy Michael Arad, … , J.G. Seidman, Christine E. Seidman J Clin Invest. 2002;109(3):357-362. https://doi.org/10.1172/JCI14571. Article Mutations in PRKAG2, the gene for the γ2 regulatory subunit of AMP-activated protein kinase, cause cardiac hypertrophy and electrophysiologic abnormalities, particularly preexcitation (Wolff-Parkinson-White syndrome) and atrioventricular conduction block. To understand the mechanisms by which PRKAG2 defects cause disease, we defined novel mutations, characterized the associated cardiac histopathology, and studied the consequences of introducing these mutations into the yeast homologue of PRKAG2, Snf4. Although the cardiac pathology caused by PRKAG2 mutations Arg302Gln, Thr400Asn, and Asn488Ile include myocyte enlargement and minimal interstitial fibrosis, these mutations were not associated with myocyte and myofibrillar disarray, the pathognomonic features of hypertrophic cardiomyopathy caused by sarcomere protein mutations. Instead PRKAG2 mutations caused pronounced vacuole formation within myocytes. Several lines of evidence indicated these vacuoles were filled with glycogen-associated granules. Analyses of the effects of human PRKAG2 mutations on Snf1/Snf4 kinase function demonstrated constitutive activity, which could foster glycogen accumulation. Taken together, our data indicate that PRKAG2 mutations do not cause hypertrophic cardiomyopathy but rather lead to a novel myocardial metabolic storage disease, in which hypertrophy, ventricular pre-excitation and conduction system defects coexist. Find the latest version: https://jci.me/14571/pdf Constitutively active AMP kinase Rapid Publication mutations cause glycogen storage disease mimicking hypertrophic cardiomyopathy Michael Arad,1 D. Woodrow Benson,2 Antonio R. Perez-Atayde,3 William J. McKenna,4 Elizabeth A. Sparks,5 Ronald J.
  • Loss of the E3 Ubiquitin Ligase MKRN1 Represses Diet-Induced Metabolic Syndrome Through AMPK Activation

    Loss of the E3 Ubiquitin Ligase MKRN1 Represses Diet-Induced Metabolic Syndrome Through AMPK Activation

    ARTICLE DOI: 10.1038/s41467-018-05721-4 OPEN Loss of the E3 ubiquitin ligase MKRN1 represses diet-induced metabolic syndrome through AMPK activation Min-Sik Lee1, Hyun-Ji Han2, Su Yeon Han2, Il Young Kim3,4, Sehyun Chae5, Choong-Sil Lee2, Sung Eun Kim2, Seul Gi Yoon4, Jun-Won Park4, Jung-Hoon Kim2, Soyeon Shin2, Manhyung Jeong2, Aram Ko2, Ho-Young Lee6, Kyoung-Jin Oh 7, Yun-Hee Lee 8, Kwang-Hee Bae7, Seung-Hoi Koo9, Jea-woo Kim10, Je Kyung Seong3,4, Daehee Hwang5 & Jaewhan Song 2 1234567890():,; AMP-activated protein kinase (AMPK) plays a key role in controlling energy metabolism in response to physiological and nutritional status. Although AMPK activation has been pro- posed as a promising molecular target for treating obesity and its related comorbidities, the use of pharmacological AMPK activators has been met with contradictory therapeutic challenges. Here we show a regulatory mechanism for AMPK through its ubiquitination and degradation by the E3 ubiquitin ligase makorin ring finger protein 1 (MKRN1). MKRN1 depletion promotes glucose consumption and suppresses lipid accumulation due to AMPK stabilisation and activation. Accordingly, MKRN1-null mice show chronic AMPK activation in both liver and adipose tissue, resulting in significant suppression of diet-induced metabolic syndrome. We demonstrate also its therapeutic effect by administering shRNA targeting MKRN1 into obese mice that reverses non-alcoholic fatty liver disease. We suggest that ubiquitin-dependent AMPK degradation represents a target therapeutic strategy for meta- bolic disorders. 1 Harvard Medical School, Boston Children’s Hospital, 3 Blackfan Circle CLS-16060.2, Boston, MA 02115, USA. 2 Department of Biochemistry, College of Life Science and Biotechnology, Yonsei University, Seoul 03722, Republic of Korea.