DOCSLIB.ORG

Supporting Information

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Supporting Information Supporting Information Zhang et al. 10.1073/pnas.1219457110 SI Experimental Procedures with brine (2.5 L), dried over anhydrous sodium sulfate, and filtered. Synthesis and Characterization of PLX647. PLX647, 5-(1H-pyrrolo The solvents were removed at reduced pressure to provide ∼560 g [2,3-b]pyridin-3-ylmethyl)-N-[[4-(trifluoromethyl)phenyl]methyl] of crude product. This material was triturated with methyl tert-butyl pyridin-2-amine, was synthesized from commercially available ether:hexanes (1:1.3) to yield compound 4 (360 g, 79.0%) as a yel- 1 5-bromopyridin-2-amine, 4-(trifluoromethyl)benzaldehyde and low solid. HNMRδ (CDCl3) 9.84 (s, 1H), 8.57 (s, 1H), 7.95 (dd, 1H-pyrrolo[2,3-b]pyridine following the synthetic route depicted 1H, J = 2.0, 8.8 Hz), 7.65 (d, 2H, J = 8.4Hz),7.50(d,2H,J= 8.4 Hz), in Scheme S1. 6.50 (d, 1H, J = 8.8 Hz), 5.72 (s, 1H), 4.77 (d, 2H, J = 5.2 Hz). Step 3 Step 1 Step 2 1 2 3 4 Step 4 Step 5 7a R = H 5 6 PLX647 7b R = CH3 Scheme S1. Step 1. Synthesis of 5-bromo-N-[[4-(trifluoromethyl)phenyl]methyl]pyridin- Step 3. Synthesis of tert-butyl N-(5-formyl-2-pyridyl)-N-[[4-(trifluoromethyl) 2-amine (compound 3). To a suspension of 5-bromopyridin-2-amine phenyl]methyl]carbamate (compound 5). To a solution of 6-[[4-(tri- (compound 1, 446.8 g, 2.58 mol) in acetonitrile (7.2 L) under an fluoromethyl)phenyl]methylamino]pyridine-3-carbaldehyde (com- atmosphere of nitrogen at room temperature, 4-(trifluoromethyl) pound 4, 485.5 g, 1.73 mol) in anhydrous THF (3.7 L), under benzaldehyde (compound 2,452.0g,2.60mol),triethylsilane nitrogen, di-tert-butyl dicarbonate (589.0 g, 2.70 mol), 4-dimethy- (1,250 mL, 7.82 mol), and trifluoroacetic acid (600 mL, 7.84 mol) laminopyridine (11.8 g, 0.097 mol), and N,N-diisopropylethyl- were added sequentially via addition funnel. The reaction was amine (550.0 mL, 3.16 mol) were added sequentially via additional refluxed (∼73 °C) for 16 h. The reaction mixture was cooled, funnel over 30 min. The reaction was stirred at room temperature concentrated under reduced pressure, and poured into a mixture for 1 h, poured into water (3 L), and extracted twice with ethyl of water (5 L) and hexane (3 L). The organic layer was separated acetate ( 3L and 1 L). The organic layers were combined, washed and discarded. Saturated potassium carbonate solution was added with brine (1.5 L), dried over anhydrous sodium sulfate, filtered, to the aqueous layer with stirring until a pH ∼9 and was extracted and concentrated to give crude product 5 (709 g, 107.6%), which twice with ethyl acetate (3 L each). The organic layers were com- was used in the next step without further purification. bined, washed with brine (2 L), dried over anhydrous sodium sul- Step 4. Synthesis of tert-butyl N-[5-[hydroxy(1H-pyrrolo[2,3-b]pyridin-3- fate, and filtered. Solvents were removed under reduced pressure yl)methyl]-2-pyridyl]-N-[[4-(trifluoromethyl)phenyl]methyl] carbamate to provide ∼995 g of crude product, which upon recrystallization (compound 7). To a solution 1H-pyrrolo[2,3-b]pyridine (compound from methyl tert-butyl ether/hexane (2:3) yielded 656.2 g of com- 6, 142.9 g, 1.21 mol) in methanol (4.5 L), under nitrogen, tert-butyl 1 fl pound 3 (76.6% yield) as white needles. HNMRδ (CDCl3) 8.16 N-(5-formyl-2-pyridyl)-N-[[4-(tri uoromethyl)phenyl]methyl] (d, 1H, J = 2.4 Hz), 7.62 (d, 2H, J = 8.0 Hz), 7.52 (dd, 1H, J = 2.4, carbamate (compound 5, 478.1 g, 1.26 mol) and sodium hydroxide 8.8Hz),7.48(d,2H,J= 8.0Hz),6.33(d,1H,J= 8.8 Hz), 5.12 (145 g, 3.63 mol) were added. The reaction was stirred at room (s, 1H), and 4.61 (d, 2H, J = 6.0 Hz). temperature for 15 h, poured into water (12 L), and the product Step 2. Synthesis of 6-[[4-(trifluoromethyl)phenyl]methylamino]pyridine-3- was extracted twice with ethyl acetate (9 L and 4 L). The com- carbaldehyde (compound 4). To a cooled (dry ice–acetone bath) bined organic layers were washed twice with brine (2.5 L each), solution of 5-bromo-N-[[4-(trifluoromethyl)phenyl]methyl]pyridin- dried over sodium sulfate, filtered, and concentrated under re- 2-amine (compound 3, 541.7 g, 1.63 mol) in anhydrous THF (6.5 L) duced pressure to provide a crude mixture of the hydroxy 7a and under nitrogen was added n-butyllithium (2.5 M in hexane, 1,970 mL, methoxy 7b (682 g, 117%) which was used in the next step without + + 4.93 mol) via additional funnel maintaining the internal temperature further purification. MS (electrospray ionization) [M+H ] = below –57 °C. The reaction mixture was stirred for 1.5 h at ≤–65 °C 499.4 (7a). before the addition of anhydrous dimethylformamide (265 mL, Step 5. Synthesis of 5-(1H-pyrrolo[2,3-b]pyridin-3-ylmethyl)-N-[[4- 3.42 mol) over a period of 30 min. The reaction mixture was al- (trifluoromethyl)phenyl]methyl]pyridin-2-amine (PLX647). To a solution lowed to warm up to about 0 °C in 1 h. Saturated NH4Cl aqueous of tert-butyl N-[5-[hydroxy(1H-pyrrolo[2,3-b]pyridin-3-yl)methyl]- solution (3 L) was added to quench the reaction and the products 2-pyridyl]-N-[[4-(trifluoromethyl)phenyl] methyl] carbamate and were extracted with ethyl acetate (8 L). The organic layer was washed tert-butyl N-[5-[methoxy(1H-pyrrolo[2,3-b]pyridin-3-yl)methyl]- Zhang et al. www.pnas.org/cgi/content/short/1219457110 1of10 2-pyridyl]-N-[[4-(trifluoromethyl)phenyl]methyl]carbamate (7a were grown in ESF921 media (Expression Systems) at 2.0 × 106 and 7b, 682 g, 1.37 mol) in anhydrous acetonitrile (4.1 L), under cells/mL and were infected with a multiplicity of infection (MOI) = 5. nitrogen, triethylsilane (700 mL, 4.38 mol) and trifluoroacetic Cells were harvested 72 h postinfection and lysed using 10 mM acid (500 mL, 6.54 mol) were added via additional funnel over K-phosphate (pH 8.0), 25 mM NaCl, 0.5 mM PMSF, and pro- a period of 25 min. The reaction mixture was refluxed (∼66 °C) tease inhibitor mixture (EMD Millipore). Following clarification for 22 h, cooled, concentrated under reduced pressure, and by centrifugation the supernatant was adjusted to 40 mM K- poured into water (4 L) and hexane (4 L). The organic layer was phosphate (pH 8.0), 200 mM NaCl, and 30 mM imidazole. FMS separated and discarded. The pH of the aqueous layer was ad- proteins were purified through a combination of IMAC and further justed by the addition of a saturated aqueous solution of po- purified by ion-exchange and size-exclusion chromatography. The tassium carbonate with stirring until the pH solution was at ∼9 clarified cell extract was bound to an IMAC column (HiTrap, and the product was extracted twice with ethyl acetate (3 L each). nickel-charged chelating Sepharose Fast Flow; GE Healthcare) The organic layers were combined, washed with water (2 L) and then washed using 40 mM phosphate (pH 8.0), 200 mM NaCl, and brine (2 L), dried over anhydrous sodium sulfate, filtered, and 30 mM imidazole and eluted using 25 mM Hepes (pH 7.0), 150 mM concentrated to give crude product (546 g). The solid was tritu- NaCl, and 300 mM imidazole. Following elution, 10 mM DTT was rated with methanol and dried to give PLX647 (262.8 g, 58.9%) as added to the eluent. Pooled fractions were further diluted with + + a yellow solid. MS (electrospray ionization) [M+H ] = 383.1. 1H 20 mM Hepes (pH 7.0) before loading over a cation exchange NMR δ (DMSO-d6) 11.36 (s, 1H), 8.15 (s, 1H), 7.92 (s, 1H), 7.81 column (HiTrap SP Fast Flow; GE Healthcare), proteins separated/ (1H, d, J = 7.2 Hz), 7.62 (d, 2H, J = 7.6 Hz), 7.48 (d, 2H, J = eluted using a NaCl gradient. Final purity was achieved by further 7.2 Hz), 7.27 (d, 1H, J = 7.6 Hz), 7.23 (s, 1H), 7.00 (t, 1H,, J = chromatography using a Superdex S200 gel filtration column (26/ 4.0 Hz), 6.95 (d, 1H, J = 7.2 Hz), 6.44 (d, 1H, J = 8.0 Hz), 4.51 60; GE Healthcare) in 20 mM Hepes (pH 7.0), 150 mM NaCl, and 13 (d, 2H, J = 4.0 Hz), 3.81 (s, 2H). C NMR δ (DMSO-d6) 157.50, 10 mM DTT. 149.32, 147.23, 146.65, 142.97, 137.84, 128.24, 127.66 (q, JCF = Crystallization and structure determination. The KIT protein, at 31.7 Hz), 127.20, 125.56 (q, JCF = 5.6 Hz), 125.01, 124.98 (q, JCF = a concentration of ∼5 mg/mL, was incubated with 1 mM PLX647 217 Hz), 123.80, 119.60, 115.38, 113.76, 108.61, 44.40, 27.94. before setting up the 24-well crystallization trays using the sitting drop method at 20 °C. The protein was diluted 1:1 with mother Protein Purification, Crystallization, and Structure Determination. liquor consisting of 1.6 M ammonium sulfate, 2.0 M sodium Purification of KIT proteins.
Load more

Recommended publications
  • Supplemental Information to Mammadova-Bach Et Al., “Laminin Α1 Orchestrates VEGFA Functions in the Ecosystem of Colorectal Carcinogenesis”
    Supplemental information to Mammadova-Bach et al., “Laminin α1 orchestrates VEGFA functions in the ecosystem of colorectal carcinogenesis” Supplemental material and methods Cloning of the villin-LMα1 vector The plasmid pBS-villin-promoter containing the 3.5 Kb of the murine villin promoter, the first non coding exon, 5.5 kb of the first intron and 15 nucleotides of the second villin exon, was generated by S. Robine (Institut Curie, Paris, France). The EcoRI site in the multi cloning site was destroyed by fill in ligation with T4 polymerase according to the manufacturer`s instructions (New England Biolabs, Ozyme, Saint Quentin en Yvelines, France). Site directed mutagenesis (GeneEditor in vitro Site-Directed Mutagenesis system, Promega, Charbonnières-les-Bains, France) was then used to introduce a BsiWI site before the start codon of the villin coding sequence using the 5’ phosphorylated primer: 5’CCTTCTCCTCTAGGCTCGCGTACGATGACGTCGGACTTGCGG3’. A double strand annealed oligonucleotide, 5’GGCCGGACGCGTGAATTCGTCGACGC3’ and 5’GGCCGCGTCGACGAATTCACGC GTCC3’ containing restriction site for MluI, EcoRI and SalI were inserted in the NotI site (present in the multi cloning site), generating the plasmid pBS-villin-promoter-MES. The SV40 polyA region of the pEGFP plasmid (Clontech, Ozyme, Saint Quentin Yvelines, France) was amplified by PCR using primers 5’GGCGCCTCTAGATCATAATCAGCCATA3’ and 5’GGCGCCCTTAAGATACATTGATGAGTT3’ before subcloning into the pGEMTeasy vector (Promega, Charbonnières-les-Bains, France). After EcoRI digestion, the SV40 polyA fragment was purified with the NucleoSpin Extract II kit (Machery-Nagel, Hoerdt, France) and then subcloned into the EcoRI site of the plasmid pBS-villin-promoter-MES. Site directed mutagenesis was used to introduce a BsiWI site (5’ phosphorylated AGCGCAGGGAGCGGCGGCCGTACGATGCGCGGCAGCGGCACG3’) before the initiation codon and a MluI site (5’ phosphorylated 1 CCCGGGCCTGAGCCCTAAACGCGTGCCAGCCTCTGCCCTTGG3’) after the stop codon in the full length cDNA coding for the mouse LMα1 in the pCIS vector (kindly provided by P.
    [Show full text]
  • Gene Symbol Gene Description ACVR1B Activin a Receptor, Type IB
    Table S1. Kinase clones included in human kinase cDNA library for yeast two-hybrid screening Gene Symbol Gene Description ACVR1B activin A receptor, type IB ADCK2 aarF domain containing kinase 2 ADCK4 aarF domain containing kinase 4 AGK multiple substrate lipid kinase;MULK AK1 adenylate kinase 1 AK3 adenylate kinase 3 like 1 AK3L1 adenylate kinase 3 ALDH18A1 aldehyde dehydrogenase 18 family, member A1;ALDH18A1 ALK anaplastic lymphoma kinase (Ki-1) ALPK1 alpha-kinase 1 ALPK2 alpha-kinase 2 AMHR2 anti-Mullerian hormone receptor, type II ARAF v-raf murine sarcoma 3611 viral oncogene homolog 1 ARSG arylsulfatase G;ARSG AURKB aurora kinase B AURKC aurora kinase C BCKDK branched chain alpha-ketoacid dehydrogenase kinase BMPR1A bone morphogenetic protein receptor, type IA BMPR2 bone morphogenetic protein receptor, type II (serine/threonine kinase) BRAF v-raf murine sarcoma viral oncogene homolog B1 BRD3 bromodomain containing 3 BRD4 bromodomain containing 4 BTK Bruton agammaglobulinemia tyrosine kinase BUB1 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) BUB1B BUB1 budding uninhibited by benzimidazoles 1 homolog beta (yeast) C9orf98 chromosome 9 open reading frame 98;C9orf98 CABC1 chaperone, ABC1 activity of bc1 complex like (S. pombe) CALM1 calmodulin 1 (phosphorylase kinase, delta) CALM2 calmodulin 2 (phosphorylase kinase, delta) CALM3 calmodulin 3 (phosphorylase kinase, delta) CAMK1 calcium/calmodulin-dependent protein kinase I CAMK2A calcium/calmodulin-dependent protein kinase (CaM kinase) II alpha CAMK2B calcium/calmodulin-dependent
    [Show full text]
  • Outlier Kinase Expression by RNA Sequencing As Targets for Precision Therapy
    Published OnlineFirst February 5, 2013; DOI: 10.1158/2159-8290.CD-12-0336 RESEARCH ARTICLE Outlier Kinase Expression by RNA Sequencing as Targets for Precision Therapy Vishal Kothari 1 , Iris Wei 2 , Sunita Shankar 1 , 3 , Shanker Kalyana-Sundaram 1 , 3 , 8 , Lidong Wang 2 , Linda W. Ma 1 , Pankaj Vats 1 , Catherine S. Grasso 1 , Dan R. Robinson 1 , 3 , Yi-Mi Wu 1 , 3 , Xuhong Cao 7 , Diane M. Simeone 2 , 4 , 5 , Arul M. Chinnaiyan 1 , 3 , 4 , 6 , 7 , and Chandan Kumar-Sinha 1 , 3 ABSTRACT Protein kinases represent the most effective class of therapeutic targets in cancer; therefore, determination of kinase aberrations is a major focus of cancer genomic studies. Here, we analyzed transcriptome sequencing data from a compendium of 482 cancer and benign samples from 25 different tissue types, and defi ned distinct “outlier kinases” in individual breast and pancreatic cancer samples, based on highest levels of absolute and differential expression. Frequent outlier kinases in breast cancer included therapeutic targets like ERBB2 and FGFR4 , distinct from MET , AKT2 , and PLK2 in pancreatic cancer. Outlier kinases imparted sample-specifi c depend- encies in various cell lines, as tested by siRNA knockdown and/or pharmacologic inhibition. Outlier expression of polo-like kinases was observed in a subset of KRAS -dependent pancreatic cancer cell lines, and conferred increased sensitivity to the pan-PLK inhibitor BI-6727. Our results suggest that outlier kinases represent effective precision therapeutic targets that are readily identifi able through RNA sequencing of tumors. SIGNIFICANCE: Various breast and pancreatic cancer cell lines display sensitivity to knockdown or pharmacologic inhibition of sample-specifi c outlier kinases identifi ed by high-throughput transcrip- tome sequencing.
    [Show full text]
  • Reframing Psychiatry for Precision Medicine
    Reframing Psychiatry for Precision Medicine Elizabeth B Torres 1,2,3* 1 Rutgers University Department of Psychology; [email protected] 2 Rutgers University Center for Cognitive Science (RUCCS) 3 Rutgers University Computer Science, Center for Biomedicine Imaging and Modelling (CBIM) * Correspondence: [email protected]; Tel.: (011) +858-445-8909 (E.B.T) Supplementary Material Sample Psychological criteria that sidelines sensory motor issues in autism: The ADOS-2 manual [1, 2], under the “Guidelines for Selecting a Module” section states (emphasis added): “Note that the ADOS-2 was developed for and standardized using populations of children and adults without significant sensory and motor impairments. Standardized use of any ADOS-2 module presumes that the individual can walk independently and is free of visual or hearing impairments that could potentially interfere with use of the materials or participation in specific tasks.” Sample Psychiatric criteria from the DSM-5 [3] that does not include sensory-motor issues: A. Persistent deficits in social communication and social interaction across multiple contexts, as manifested by the following, currently or by history (examples are illustrative, not exhaustive, see text): 1. Deficits in social-emotional reciprocity, ranging, for example, from abnormal social approach and failure of normal back-and-forth conversation; to reduced sharing of interests, emotions, or affect; to failure to initiate or respond to social interactions. 2. Deficits in nonverbal communicative behaviors used for social interaction, ranging, for example, from poorly integrated verbal and nonverbal communication; to abnormalities in eye contact and body language or deficits in understanding and use of gestures; to a total lack of facial expressions and nonverbal communication.
    [Show full text]
  • Profiling Data
    Compound Name DiscoveRx Gene Symbol Entrez Gene Percent Compound Symbol Control Concentration (nM) JNK-IN-8 AAK1 AAK1 69 1000 JNK-IN-8 ABL1(E255K)-phosphorylated ABL1 100 1000 JNK-IN-8 ABL1(F317I)-nonphosphorylated ABL1 87 1000 JNK-IN-8 ABL1(F317I)-phosphorylated ABL1 100 1000 JNK-IN-8 ABL1(F317L)-nonphosphorylated ABL1 65 1000 JNK-IN-8 ABL1(F317L)-phosphorylated ABL1 61 1000 JNK-IN-8 ABL1(H396P)-nonphosphorylated ABL1 42 1000 JNK-IN-8 ABL1(H396P)-phosphorylated ABL1 60 1000 JNK-IN-8 ABL1(M351T)-phosphorylated ABL1 81 1000 JNK-IN-8 ABL1(Q252H)-nonphosphorylated ABL1 100 1000 JNK-IN-8 ABL1(Q252H)-phosphorylated ABL1 56 1000 JNK-IN-8 ABL1(T315I)-nonphosphorylated ABL1 100 1000 JNK-IN-8 ABL1(T315I)-phosphorylated ABL1 92 1000 JNK-IN-8 ABL1(Y253F)-phosphorylated ABL1 71 1000 JNK-IN-8 ABL1-nonphosphorylated ABL1 97 1000 JNK-IN-8 ABL1-phosphorylated ABL1 100 1000 JNK-IN-8 ABL2 ABL2 97 1000 JNK-IN-8 ACVR1 ACVR1 100 1000 JNK-IN-8 ACVR1B ACVR1B 88 1000 JNK-IN-8 ACVR2A ACVR2A 100 1000 JNK-IN-8 ACVR2B ACVR2B 100 1000 JNK-IN-8 ACVRL1 ACVRL1 96 1000 JNK-IN-8 ADCK3 CABC1 100 1000 JNK-IN-8 ADCK4 ADCK4 93 1000 JNK-IN-8 AKT1 AKT1 100 1000 JNK-IN-8 AKT2 AKT2 100 1000 JNK-IN-8 AKT3 AKT3 100 1000 JNK-IN-8 ALK ALK 85 1000 JNK-IN-8 AMPK-alpha1 PRKAA1 100 1000 JNK-IN-8 AMPK-alpha2 PRKAA2 84 1000 JNK-IN-8 ANKK1 ANKK1 75 1000 JNK-IN-8 ARK5 NUAK1 100 1000 JNK-IN-8 ASK1 MAP3K5 100 1000 JNK-IN-8 ASK2 MAP3K6 93 1000 JNK-IN-8 AURKA AURKA 100 1000 JNK-IN-8 AURKA AURKA 84 1000 JNK-IN-8 AURKB AURKB 83 1000 JNK-IN-8 AURKB AURKB 96 1000 JNK-IN-8 AURKC AURKC 95 1000 JNK-IN-8
    [Show full text]
  • Application of a MYC Degradation
    SCIENCE SIGNALING | RESEARCH ARTICLE CANCER Copyright © 2019 The Authors, some rights reserved; Application of a MYC degradation screen identifies exclusive licensee American Association sensitivity to CDK9 inhibitors in KRAS-mutant for the Advancement of Science. No claim pancreatic cancer to original U.S. Devon R. Blake1, Angelina V. Vaseva2, Richard G. Hodge2, McKenzie P. Kline3, Thomas S. K. Gilbert1,4, Government Works Vikas Tyagi5, Daowei Huang5, Gabrielle C. Whiten5, Jacob E. Larson5, Xiaodong Wang2,5, Kenneth H. Pearce5, Laura E. Herring1,4, Lee M. Graves1,2,4, Stephen V. Frye2,5, Michael J. Emanuele1,2, Adrienne D. Cox1,2,6, Channing J. Der1,2* Stabilization of the MYC oncoprotein by KRAS signaling critically promotes the growth of pancreatic ductal adeno- carcinoma (PDAC). Thus, understanding how MYC protein stability is regulated may lead to effective therapies. Here, we used a previously developed, flow cytometry–based assay that screened a library of >800 protein kinase inhibitors and identified compounds that promoted either the stability or degradation of MYC in a KRAS-mutant PDAC cell line. We validated compounds that stabilized or destabilized MYC and then focused on one compound, Downloaded from UNC10112785, that induced the substantial loss of MYC protein in both two-dimensional (2D) and 3D cell cultures. We determined that this compound is a potent CDK9 inhibitor with a previously uncharacterized scaffold, caused MYC loss through both transcriptional and posttranslational mechanisms, and suppresses PDAC anchorage- dependent and anchorage-independent growth. We discovered that CDK9 enhanced MYC protein stability 62 through a previously unknown, KRAS-independent mechanism involving direct phosphorylation of MYC at Ser .
    [Show full text]
  • The Number of Genes
    Table S1. The numbers of KD genes in each KD time The number The number The number The number Cell lines of genes of genes of genes of genes (96h) (120h) (144h) PC3 3980 3822 128 1725 A549 3724 3724 0 0 MCF7 3688 3471 0 1837 HT29 3665 3665 0 0 A375 3826 3826 0 0 HA1E 3801 3801 0 0 VCAP 4134 34 4121 0 HCC515 3522 3522 0 0 Table S2. The predicted results in the PC3 cell line on the LINCS II data id target rank A07563059 ADRB2 48 A12896037 ADRA2C 91 A13021932 YES1 77 PPM1B;PPP1CC;PPP2CA; A13254067 584;1326;297;171;3335 PTPN1;PPP2R5A A16347691 GMNN 2219 PIK3CB;MTOR;PIK3CA;PIK A28467416 18;10;9;13;8 3CG;PIK3CD A28545468 EHMT2;MAOB 14;67 A29520968 HSPB1 1770 A48881734 EZH2 1596 A52922642 CACNA1C 201 A64553394 ADRB2 155 A65730376 DOT1L 3764 A82035391 JUN 378 A82156122 DPP4 771 HRH1;HTR2C;CHRM3;CH A82772293 2756;2354;2808;2367 RM1 A86248581 CDA 1785 A92800748 TEK 459 A93093700 LMNA 1399 K00152668 RARB 105 K01577834 ADORA2A 525 K01674964 HRH1;BLM 31;1314 K02314383 AR 132 K03194791 PDE4D 30 K03390685 MAP2K1 77 K06762493 GMNN;APEX1 1523;2360 K07106112 ERBB4;ERBB2;EGFR 497;60;23 K07310275 AKT1;MTOR;PIK3CA 13;12;1 K07753030 RGS4;BLM 3736;3080 K08109215 BRD2;BRD3;BRD4 1413;2786;3 K08248804 XIAP 88 K08586861 TBXA2R;MBNL1 297;3428 K08832567 GMNN;CA12 2544;50 LMNA;NFKB1;APEX1;EH K08976401 1322;341;3206;123 MT2 K09372874 IMPDH2 232 K09711437 PLA2G2A 59 K10859802 GPR119 214 K11267252 RET;ALK 395;760 K12609457 LMNA 907 K13094524 BRD4 7 K13662825 CDK4;CDK9;CDK5;CDK1 34;58;13;18 K14704277 LMNA;BLM 1697;1238 K14870255 AXL 1696 K15170068 MAN2B1 1756 K15179879
    [Show full text]
  • P1382-Human Cellexp FLT-3 Ligand, Recombinant Mouse
    FOR RESEARCH ONLY! Human CellExp™ FLT-3 Ligand, Mouse Recombinant CATALOG #: P1382-50 P1382-10 AMOUNT: 50 µg 10 µg FLT3LG, FL, FLT3L, Flt3 ligand ALTERNATE NAMES: MOL. WT. The protein has a calculated MW of 20.2 kDa. The protein migrates as 25-33 kDa under reducing (R) condition (SDS-PAGE) due to glycosylation. SOURCE: HEK 293 cells PURITY: >90% as determined by SDS-PAGE. ENDOTOXIN: Less than 1.0 EU per μg by the LAL method FORM: Lyophilized FORMULATION: Lyophilized from 0.22 μm filtered solution in PBS, pH7.4. Normally trehalose is added as protectant before lyophilization. Centrifuge the vial prior to opening. Reconstitute in sterile deionized water to a concentration of 100 µg/ml. RECONSTITUTION: Do not vortex. It is recommended to store at -20°C. SPECIFIC ACTIVITY: Immobilized Mouse Flt-3 Ligand, His Tag at 1 μg/mL (100 μL/well) can bind Human Flt-3/Flk-2 Fc Chimera with a linear range of 1-5 ng/mL STORAGE CONDITIONS: Store at -20°C. After reconstitution, aliquot and store at -20°C and use within 3 months. Avoid repeated freezing and thawing cycles. DESCRIPTION: FMS-like tyrosine kinase 3 ligand (Flt-3 Ligand) is also known as FL, Flt3L and FLT3LG, is an α-helical cytokine that promotes the differentiation of multiple hematopoietic cell lineages. FLT3LG is expressed as a noncovalentlylinked dimer by T cells and bone marrow and thymic fibroblasts. Each 36 kDa chain carries approximately 12 kDa of N- and O- linked carbohydrates. FLT3LG is structurally homologous to stem cell factor (SCF) and colony stimulating facor 1 (CSF-1).
    [Show full text]
  • Flt3 Ligand (FLT3LG) (NM 001278637) Human Tagged ORF Clone Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RG236103 Flt3 ligand (FLT3LG) (NM_001278637) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: Flt3 ligand (FLT3LG) (NM_001278637) Human Tagged ORF Clone Tag: TurboGFP Symbol: FLT3LG Synonyms: FL; FLG3L; FLT3L Vector: pCMV6-AC-GFP (PS100010) E. coli Selection: Ampicillin (100 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RG236103 representing NM_001278637. Sequence: Blue=ORF Red=Cloning site Green=Tag(s) GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC ATGGAGCGGCTCAAGACTGTCGCTGGGTCCAAGATGCAAGGCTTGCTGGAGCGCGTGAACACGGAGATA CACTTTGTCACCAAATGTGCCTTTCAGCCCCCCCCCAGCTGTCTTCGCTTCGTCCAGACCAACATCTCC CGCCTCCTGCAGGAGACCTCCGAGCAGCTGGTGGCGCTGAAGCCCTGGATCACTCGCCAGAACTTCTCC CGGTGCCTGGAGCTGCAGTGTCAGCCCGACTCCTCAACCCTGCCACCCCCATGGAGTCCCCGGCCCCTG GAGGCCACAGCCCCGACAGCCCCGCAGCCCCCTCTGCTCCTCCTACTGCTGCTGCCCGTGGGCCTCCTG CTGCTGGCCGCTGCCTGGTGCCTGCACTGGCAGAGGACGCGGCGGAGGACACCCCGCCCTGGGGAGCAG GTGCCCCCCGTCCCCAGTCCCCAGGACCTGCTGCTTGTGGAGCAC ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAAAC Protein Sequence: >Peptide sequence encoded by RG236103 Blue=ORF Red=Cloning site Green=Tag(s) MERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFS RCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQ VPPVPSPQDLLLVEH TRTRPLEMESDESGLPAMEIECRITGTLNGVEFELVGGGEGTPEQGRMTNKMKSTKGALTFSPYLLSHV
    [Show full text]
  • 14-3-3 Proteins Inactivate DAPK2 by Promoting Its Dimerization And
    ARTICLE https://doi.org/10.1038/s42003-021-02518-y OPEN 14-3-3 proteins inactivate DAPK2 by promoting its dimerization and protecting key regulatory phosphosites ✉ ✉ Matej Horvath 1,2, Olivia Petrvalska1,2, Petr Herman 3, Veronika Obsilova 2 & Tomas Obsil 1,2 Death-associated protein kinase 2 (DAPK2) is a CaM-regulated Ser/Thr protein kinase, involved in apoptosis, autophagy, granulocyte differentiation and motility regulation, whose activity is controlled by autoinhibition, autophosphorylation, dimerization and interaction with scaffolding proteins 14-3-3. However, the structural basis of 14-3-3-mediated DAPK2 reg- ulation remains unclear. Here, we structurally and biochemically characterize the full-length 1234567890():,; human DAPK2:14-3-3 complex by combining several biophysical techniques. The results from our X-ray crystallographic analysis revealed that Thr369 phosphorylation at the DAPK2 C terminus creates a high-affinity canonical mode III 14-3-3-binding motif, further enhanced by the diterpene glycoside Fusicoccin A. Moreover, concentration-dependent DAPK2 dimerization is disrupted by Ca2+/CaM binding and stabilized by 14-3-3 binding in solution, thereby protecting the DAPK2 inhibitory autophosphorylation site Ser318 against depho- sphorylation and preventing Ca2+/CaM binding. Overall, our findings provide mechanistic insights into 14-3-3-mediated DAPK2 inhibition and highlight the potential of the DAPK2:14- 3-3 complex as a target for anti‐inflammatory therapies. 1 Department of Physical and Macromolecular Chemistry, Faculty of Science, Charles University, Prague, Czech Republic. 2 Department of Structural Biology of Signaling Proteins, Division BIOCEV, Institute of Physiology of the Czech Academy of Sciences, Vestec, Czech Republic. 3 Institute of Physics, Faculty of ✉ Mathematics and Physics, Charles University, Prague, Czech Republic.
    [Show full text]
  • Supplementary Table 1. in Vitro Side Effect Profiling Study for LDN/OSU-0212320. Neurotransmitter Related Steroids
    Supplementary Table 1. In vitro side effect profiling study for LDN/OSU-0212320. Percent Inhibition Receptor 10 µM Neurotransmitter Related Adenosine, Non-selective 7.29% Adrenergic, Alpha 1, Non-selective 24.98% Adrenergic, Alpha 2, Non-selective 27.18% Adrenergic, Beta, Non-selective -20.94% Dopamine Transporter 8.69% Dopamine, D1 (h) 8.48% Dopamine, D2s (h) 4.06% GABA A, Agonist Site -16.15% GABA A, BDZ, alpha 1 site 12.73% GABA-B 13.60% Glutamate, AMPA Site (Ionotropic) 12.06% Glutamate, Kainate Site (Ionotropic) -1.03% Glutamate, NMDA Agonist Site (Ionotropic) 0.12% Glutamate, NMDA, Glycine (Stry-insens Site) 9.84% (Ionotropic) Glycine, Strychnine-sensitive 0.99% Histamine, H1 -5.54% Histamine, H2 16.54% Histamine, H3 4.80% Melatonin, Non-selective -5.54% Muscarinic, M1 (hr) -1.88% Muscarinic, M2 (h) 0.82% Muscarinic, Non-selective, Central 29.04% Muscarinic, Non-selective, Peripheral 0.29% Nicotinic, Neuronal (-BnTx insensitive) 7.85% Norepinephrine Transporter 2.87% Opioid, Non-selective -0.09% Opioid, Orphanin, ORL1 (h) 11.55% Serotonin Transporter -3.02% Serotonin, Non-selective 26.33% Sigma, Non-Selective 10.19% Steroids Estrogen 11.16% 1 Percent Inhibition Receptor 10 µM Testosterone (cytosolic) (h) 12.50% Ion Channels Calcium Channel, Type L (Dihydropyridine Site) 43.18% Calcium Channel, Type N 4.15% Potassium Channel, ATP-Sensitive -4.05% Potassium Channel, Ca2+ Act., VI 17.80% Potassium Channel, I(Kr) (hERG) (h) -6.44% Sodium, Site 2 -0.39% Second Messengers Nitric Oxide, NOS (Neuronal-Binding) -17.09% Prostaglandins Leukotriene,
    [Show full text]
  • Supplementary Material DNA Methylation in Inflammatory Pathways Modifies the Association Between BMI and Adult-Onset Non- Atopic
    Supplementary Material DNA Methylation in Inflammatory Pathways Modifies the Association between BMI and Adult-Onset Non- Atopic Asthma Ayoung Jeong 1,2, Medea Imboden 1,2, Akram Ghantous 3, Alexei Novoloaca 3, Anne-Elie Carsin 4,5,6, Manolis Kogevinas 4,5,6, Christian Schindler 1,2, Gianfranco Lovison 7, Zdenko Herceg 3, Cyrille Cuenin 3, Roel Vermeulen 8, Deborah Jarvis 9, André F. S. Amaral 9, Florian Kronenberg 10, Paolo Vineis 11,12 and Nicole Probst-Hensch 1,2,* 1 Swiss Tropical and Public Health Institute, 4051 Basel, Switzerland; [email protected] (A.J.); [email protected] (M.I.); [email protected] (C.S.) 2 Department of Public Health, University of Basel, 4001 Basel, Switzerland 3 International Agency for Research on Cancer, 69372 Lyon, France; [email protected] (A.G.); [email protected] (A.N.); [email protected] (Z.H.); [email protected] (C.C.) 4 ISGlobal, Barcelona Institute for Global Health, 08003 Barcelona, Spain; [email protected] (A.-E.C.); [email protected] (M.K.) 5 Universitat Pompeu Fabra (UPF), 08002 Barcelona, Spain 6 CIBER Epidemiología y Salud Pública (CIBERESP), 08005 Barcelona, Spain 7 Department of Economics, Business and Statistics, University of Palermo, 90128 Palermo, Italy; [email protected] 8 Environmental Epidemiology Division, Utrecht University, Institute for Risk Assessment Sciences, 3584CM Utrecht, Netherlands; [email protected] 9 Population Health and Occupational Disease, National Heart and Lung Institute, Imperial College, SW3 6LR London, UK; [email protected] (D.J.); [email protected] (A.F.S.A.) 10 Division of Genetic Epidemiology, Medical University of Innsbruck, 6020 Innsbruck, Austria; [email protected] 11 MRC-PHE Centre for Environment and Health, School of Public Health, Imperial College London, W2 1PG London, UK; [email protected] 12 Italian Institute for Genomic Medicine (IIGM), 10126 Turin, Italy * Correspondence: [email protected]; Tel.: +41-61-284-8378 Int.
    [Show full text]