SYVN1 (Human) Recombinant Protein (P01)

Total Page：16

File Type：pdf, Size：1020Kb

SYVN1 (Human) Recombinant Protein (P01) Catalog # : H00084447-P01 規格 : [ 10 ug ] [ 25 ug ] List All Specification Application Image Product Human SYVN1 full-length ORF ( NP_757385.1, 1 a.a. - 617 a.a.) Enzyme-linked Immunoabsorbent Assay Description: recombinant protein with GST-tag at N-terminal. Western Blot (Recombinant Sequence: MFRTAVMMAASLALTGAVVAHAYYLKHQFYPTVVYLTKSSPSMAVLYIQ protein) AFVLVFLLGKVMGKVFFGQLRAAEMEHLLERSWYAVTETCLAFTVFRD DFSPRFVALFTLLLFLKCFHWLAEDRVDFMERSPNISWLFHCRIVSLMFL Antibody Production LGILDFLFVSHAYHSILTRGASVQLVFGFEYAILMTMVLTIFIKYVLHSVDL QSENPWDNKAVYMLYTELFTGFIKVLLYMAFMTIMIKVHTFPLFAIRPMYL Protein Array AMRQFKKAVTDAIMSRRAIRNMNTLYPDATPEELQAMDNVCIICREEMVT GAKRLPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLPAQSPPPPEP ADQGPPPAPHPPPLLPQPPNFPQGLLPPFPPGMFPLWPPMGPFPPVPP PPSSGEAVAPPSTSAAALSRPSGAATTTAAGTSATAASATASGPGSGSA PEAGPAPGFPFPPPWMGMPLPPPFAFPPMPVPPAGFAGLTPEELRALE GHERQHLEARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNST EETATTVVAAASSTSIPSSEATTPTPGASPPAPEMERPPAPESVGTEEMP EDGEPDAAELRRRRLQKLESPVAH Host: Wheat Germ (in vitro) Theoretical MW 94.1 (kDa): Preparation in vitro wheat germ expression system Method: Purification: Glutathione Sepharose 4 Fast Flow Quality Control 12.5% SDS-PAGE Stained with Coomassie Blue. Testing: Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing. Instruction: Note: Best use within three months from the date of receipt of this protein. MSDS: Download Datasheet: Download Page 1 of 2 2020/7/14 Applications Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array Gene Information Entrez GeneID: 84447 GeneBank NM_172230.2 Accession#: Protein NP_757385.1 Accession#: Gene Name: SYVN1 Gene Alias: HRD1,KIAA1810,MGC40372 Gene synovial apoptosis inhibitor 1, synoviolin Description: Omim ID: 608046 Gene Ontology: Hyperlink Gene Summary: This gene encodes a protein involved in endoplasmic reticulum (ER)- associated degradation. The encoded protein removes unfolded proteins, accumulated during ER stress, by retrograde transport to the cytosol from the ER. This protein also uses the ubiquitin-proteasome system for additional degradation of unfolded proteins. This gene and the mitochondrial ribosomal protein L49 gene use in their respective 3' UTRs some of the same genomic sequence. Sequence analysis identified two transcript variants that encode different isoforms. [provided by RefSeq Other synoviolin 1 Designations: Gene Pathway Ubiquitin mediated proteolysis 服務條款 | 隱私權政策 | 著作及商標 | 網站地圖 ©2020 亞諾法生技股份有限公司 Abnova Corporation. 版權所有. Page 2 of 2 2020/7/14.

Copy Link

Recommended publications

1 Supporting Information for a Microrna Network Regulates
Supporting Information for A microRNA Network Regulates Expression and Biosynthesis of CFTR and CFTR-ΔF508 Shyam Ramachandrana,b, Philip H. Karpc, Peng Jiangc, Lynda S. Ostedgaardc, Amy E. Walza, John T. Fishere, Shaf Keshavjeeh, Kim A. Lennoxi, Ashley M. Jacobii, Scott D. Rosei, Mark A. Behlkei, Michael J. Welshb,c,d,g, Yi Xingb,c,f, Paul B. McCray Jr.a,b,c Author Affiliations: Department of Pediatricsa, Interdisciplinary Program in Geneticsb, Departments of Internal Medicinec, Molecular Physiology and Biophysicsd, Anatomy and Cell Biologye, Biomedical Engineeringf, Howard Hughes Medical Instituteg, Carver College of Medicine, University of Iowa, Iowa City, IA-52242 Division of Thoracic Surgeryh, Toronto General Hospital, University Health Network, University of Toronto, Toronto, Canada-M5G 2C4 Integrated DNA Technologiesi, Coralville, IA-52241 To whom correspondence should be addressed: Email: [email protected] (M.J.W.); yi- [email protected] (Y.X.); Email: [email protected] (P.B.M.) This PDF file includes: Materials and Methods References Fig. S1. miR-138 regulates SIN3A in a dose-dependent and site-specific manner. Fig. S2. miR-138 regulates endogenous SIN3A protein expression. Fig. S3. miR-138 regulates endogenous CFTR protein expression in Calu-3 cells. Fig. S4. miR-138 regulates endogenous CFTR protein expression in primary human airway epithelia. Fig. S5. miR-138 regulates CFTR expression in HeLa cells. Fig. S6. miR-138 regulates CFTR expression in HEK293T cells. Fig. S7. HeLa cells exhibit CFTR channel activity. Fig. S8. miR-138 improves CFTR processing. Fig. S9. miR-138 improves CFTR-ΔF508 processing. Fig. S10. SIN3A inhibition yields partial rescue of Cl- transport in CF epithelia.
[Show full text]
Genome-Wide Methylation Study on Depression: Differential Methylation and Variable Methylation in Monozygotic Twins
OPEN Citation: Transl Psychiatry (2015) 5, e557; doi:10.1038/tp.2015.49 www.nature.com/tp ORIGINAL ARTICLE Genome-wide methylation study on depression: differential methylation and variable methylation in monozygotic twins A Córdova-Palomera1,2, M Fatjó-Vilas1,2, C Gastó2,3,4, V Navarro2,3,4, M-O Krebs5,6,7 and L Fañanás1,2 Depressive disorders have been shown to be highly influenced by environmental pathogenic factors, some of which are believed to exert stress on human brain functioning via epigenetic modifications. Previous genome-wide methylomic studies on depression have suggested that, along with differential DNA methylation, affected co-twins of monozygotic (MZ) pairs have increased DNA methylation variability, probably in line with theories of epigenetic stochasticity. Nevertheless, the potential biological roots of this variability remain largely unexplored. The current study aimed to evaluate whether DNA methylation differences within MZ twin pairs were related to differences in their psychopathological status. Data from the Illumina Infinium HumanMethylation450 Beadchip was used to evaluate peripheral blood DNA methylation of 34 twins (17 MZ pairs). Two analytical strategies were used to identify (a) differentially methylated probes (DMPs) and (b) variably methylated probes (VMPs). Most DMPs were located in genes previously related to neuropsychiatric phenotypes. Remarkably, one of these DMPs (cg01122889) was located in the WDR26 gene, the DNA sequence of which has been implicated in major depressive disorder from genome-wide association studies. Expression of WDR26 has also been proposed as a biomarker of depression in human blood. Complementarily, VMPs were located in genes such as CACNA1C, IGF2 and the p38 MAP kinase MAPK11, showing enrichment for biological processes such as glucocorticoid signaling.
[Show full text]
The Unfolded Protein Response and Its Potential Role In
F1000Research 2016, 4:103 Last updated: 22 JUL 2020 RESEARCH ARTICLE The unfolded protein response and its potential role in Huntington's disease elucidated by a systems biology approach [version 2; peer review: 2 approved] Ravi Kiran Reddy Kalathur1, Joaquin Giner-Lamia1, Susana Machado1, Tania Barata1, Kameshwar R S Ayasolla1, Matthias E. Futschik1,2 1Centre for Biomedical Research, University of Algarve, Faro, 8005-139, Portugal 2Centre of Marine Sciences, University of Algarve, Faro, 8005-139, Portugal First published: 01 May 2015, 4:103 Open Peer Review v2 https://doi.org/10.12688/f1000research.6358.1 Latest published: 02 Mar 2016, 4:103 https://doi.org/10.12688/f1000research.6358.2 Reviewer Status Abstract Invited Reviewers Huntington ́s disease (HD) is a progressive, neurodegenerative disease 1 2 with a fatal outcome. Although the disease-causing gene (huntingtin) has been known for over 20 years, the exact mechanisms leading to neuronal version 2 cell death are still controversial. One potential mechanism contributing to (revision) report the massive loss of neurons observed in the brain of HD patients could be 02 Mar 2016 the unfolded protein response (UPR) activated by accumulation of misfolded proteins in the endoplasmic reticulum (ER). As an adaptive response to counter-balance accumulation of un- or misfolded proteins, the version 1 UPR upregulates transcription of chaperones, temporarily attenuates new 01 May 2015 report report translation, and activates protein degradation via the proteasome. However, persistent ER stress and an activated UPR can also cause apoptotic cell death. Although different studies have indicated a role for the Scott Zeitlin, University of Virginia, UPR in HD, the evidence remains inconclusive.
[Show full text]
Viral Mediated Tethering to SEL1L Facilitates ER-Associated Degradation of IRE1
bioRxiv preprint doi: https://doi.org/10.1101/2020.10.07.330779; this version posted October 9, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. 1 2 3 Viral mediated tethering to SEL1L facilitates ER-associated degradation of IRE1 4 5 6 Florian Hinte, Jendrik Müller, and Wolfram Brune* 7 8 Heinrich Pette Institute, Leibniz Institute for Experimental Virology, Hamburg, Germany 9 10 * corresponding author. [email protected] 11 12 Running head: MCMV M50 promotes ER-associated degradation of IRE1 13 14 15 Word count 16 Abstract: 249 17 Text: 3275 (w/o references) 18 Figures: 7 1 bioRxiv preprint doi: https://doi.org/10.1101/2020.10.07.330779; this version posted October 9, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. 19 Abstract 20 The unfolded protein response (UPR) and endoplasmic reticulum (ER)-associated 21 degradation (ERAD) are two essential components of the quality control system for proteins 22 in the secretory pathway. When unfolded proteins accumulate in the ER, UPR sensors such 23 as IRE1 induce the expression of ERAD genes, thereby increasing protein export from the ER 24 to the cytosol and subsequent degradation by the proteasome. Conversely, IRE1 itself is an 25 ERAD substrate, indicating that the UPR and ERAD regulate each other.
[Show full text]
View of All NF-Κb Post-Translational Modifications See Review by Perkins [179]
UNIVERSITY OF CINCINNATI Date: 8-May-2010 I, Michael Wilhide , hereby submit this original work as part of the requirements for the degree of: Master of Science in Molecular, Cellular & Biochemical Pharmacology It is entitled: Student Signature: Michael Wilhide This work and its defense approved by: Committee Chair: Walter Jones, PhD Walter Jones, PhD Mohammed Matlib, PhD Mohammed Matlib, PhD Basilia Zingarelli, MD, PhD Basilia Zingarelli, MD, PhD Jo El Schultz, PhD Jo El Schultz, PhD Muhammad Ashraf, PhD Muhammad Ashraf, PhD 5/8/2010 646 Hsp70.1 contributes to the NF-κΒ paradox after myocardial ischemic insults A thesis submitted to the Graduate School of the University of Cincinnati in partial fulfillment of the requirement for the degree of Master of Science (M.S.) in the Department of Pharmacology and Biophysics of the College of Medicine by Michael E. Wilhide B.S. College of Mount St. Joseph 2002 Committee Chair: W. Keith Jones, Ph.D. Abstract One of the leading causes of death globally is cardiovascular disease, with most of these deaths related to myocardial ischemia. Myocardial ischemia and reperfusion causes several biochemical and metabolic changes that result in the activation of transcription factors that are involved in cell survival and cell death. The transcription factor Nuclear Factor-Kappa B (NF-κB) is associated with cardioprotection (e.g. after permanent coronary occlusion, PO) and cell injury (e.g. after ischemia/reperfusion, I/R). However, there is a lack of knowledge regarding how NF- κB mediates cell survival vs. cell death after ischemic insults, preventing the identification of novel therapeutic targets for enhanced cardioprotection and decreased injurious effects.
[Show full text]
Characterization of Five Transmembrane Proteins: with Focus on the Tweety, Sideroflexin, and YIP1 Domain Families
fcell-09-708754 July 16, 2021 Time: 14:3 # 1 ORIGINAL RESEARCH published: 19 July 2021 doi: 10.3389/fcell.2021.708754 Characterization of Five Transmembrane Proteins: With Focus on the Tweety, Sideroflexin, and YIP1 Domain Families Misty M. Attwood1* and Helgi B. Schiöth1,2 1 Functional Pharmacology, Department of Neuroscience, Uppsala University, Uppsala, Sweden, 2 Institute for Translational Medicine and Biotechnology, Sechenov First Moscow State Medical University, Moscow, Russia Transmembrane proteins are involved in many essential cell processes such as signal transduction, transport, and protein trafficking, and hence many are implicated in different disease pathways. Further, as the structure and function of proteins are correlated, investigating a group of proteins with the same tertiary structure, i.e., the same number of transmembrane regions, may give understanding about their functional roles and potential as therapeutic targets. This analysis investigates the previously unstudied group of proteins with five transmembrane-spanning regions (5TM). More Edited by: Angela Wandinger-Ness, than half of the 58 proteins identified with the 5TM architecture belong to 12 families University of New Mexico, with two or more members. Interestingly, more than half the proteins in the dataset United States function in localization activities through movement or tethering of cell components and Reviewed by: more than one-third are involved in transport activities, particularly in the mitochondria. Nobuhiro Nakamura, Kyoto Sangyo University, Japan Surprisingly, no receptor activity was identified within this dataset in large contrast with Diego Bonatto, other TM groups. The three major 5TM families, which comprise nearly 30% of the Departamento de Biologia Molecular e Biotecnologia da UFRGS, Brazil dataset, include the tweety family, the sideroflexin family and the Yip1 domain (YIPF) Martha Martinez Grimes, family.
[Show full text]
The Mammalian Endoplasmic Reticulum-Associated Degradation System
Downloaded from http://cshperspectives.cshlp.org/ on October 4, 2021 - Published by Cold Spring Harbor Laboratory Press The Mammalian Endoplasmic Reticulum-Associated Degradation System James A. Olzmann1, Ron R. Kopito1, and John C. Christianson2 1Department of Biology, Stanford University, Stanford, California 94305 2Ludwig Institute for Cancer Research, University of Oxford, ORCRB, Headington, Oxford OX3 7DQ, United Kingdom Correspondence: [email protected] The endoplasmic reticulum (ER) is the site of synthesis for nearly one-third of the eukaryotic proteome and is accordingly endowed with specialized machinery to ensure that proteins deployed to the distal secretory pathway are correctly folded and assembled into native oligomeric complexes. Proteins failing to meet this conformational standard are degraded by ER-associated degradation (ERAD), a complex process through which folding-defective proteins are selected and ultimately degraded by the ubiquitin-proteasome system. ERAD proceeds through four tightly coupled steps involving substrate selection, dislocation across the ER membrane, covalent conjugation with polyubiquitin, and proteasomal degradation. The ERAD machinery shows a modular organization with central ER membrane-embedded ubiquitin ligases linking components responsible for recognition in the ER lumen to the ubiquitin-proteasome system in the cytoplasm. The core ERAD machinery is highly con- served among eukaryotes and much of our basic understanding of ERAD organization has been derived from genetic and
[Show full text]
Recent Insights Into the Role of Unfolded Protein Response in ER Stress in Health and Disease
CORE Metadata, citation and similar papers at core.ac.uk Provided by University of Liverpool Repository REVIEW published: 10 May 2017 doi: 10.3389/fcell.2017.00048 Recent Insights into the Role of Unfolded Protein Response in ER Stress in Health and Disease Dan Lindholm 1, 2*, Laura Korhonen 2, 3, Ove Eriksson 1 and Sulev Kõks 4, 5 1 Medicum, Department of Biochemistry and Developmental Biology, Faculty of Medicine, University of Helsinki, Helsinki, Finland, 2 Minerva Foundation Institute for Medical Research, Helsinki, Finland, 3 Division of Child Psychiatry, Helsinki University Central Hospital, Helsinki, Finland, 4 Department of Pathophysiology, University of Tartu, Tartu, Estonia, 5 Department of Reproductive Biology, Estonian University of Life Sciences, Tartu, Estonia Unfolded stress response (UPR) is a conserved cellular pathway involved in protein quality control to maintain homeostasis under different conditions and disease states characterized by cell stress. Although three general schemes of and genes induced by UPR are rather well-established, open questions remain including the precise role of UPR in human diseases and the interactions between different sensor systems during cell stress signaling. Particularly, the issue how the normally adaptive and pro-survival UPR Edited by: pathway turns into a deleterious process causing sustained endoplasmic reticulum (ER) Cesare Indiveri, stress and cell death requires more studies. UPR is also named a friend with multiple University of Calabria, Italy personalities that we need to understand better to fully recognize its role in normal Reviewed by: Luca Ulianich, physiology and in disease pathology. UPR interacts with other organelles including Consiglio Nazionale Delle Ricerche, mitochondria, and with cell stress signals and degradation pathways such as autophagy Italy Roberto Pérez-Torrado, and the ubiquitin proteasome system.
[Show full text]
Genome-Wide Identification and Gene Expression Profiling of Ubiquitin
www.nature.com/scientificreports OPEN Genome-wide identification and gene expression profiling of ubiquitin ligases for endoplasmic Received: 04 September 2015 Accepted: 08 July 2016 reticulum protein degradation Published: 03 August 2016 Masayuki Kaneko1, Ikuko Iwase2, Yuki Yamasaki3, Tomoko Takai1, Yan Wu4, Soshi Kanemoto1, Koji Matsuhisa1, Rie Asada1, Yasunobu Okuma5, Takeshi Watanabe3, Kazunori Imaizumi1 & Yausyuki Nomura6 Endoplasmic reticulum (ER)-associated degradation (ERAD) is a mechanism by which unfolded proteins that accumulate in the ER are transported to the cytosol for ubiquitin–proteasome-mediated degradation. Ubiquitin ligases (E3s) are a group of enzymes responsible for substrate selectivity and ubiquitin chain formation. The purpose of this study was to identify novel E3s involved in ERAD. Thirty-seven candidate genes were selected by searches for proteins with RING-finger motifs and transmembrane regions, which are the major features of ERAD E3s. We performed gene expression profiling for the identified E3s in human and mouse tissues. Several genes were specifically or selectively expressed in both tissues; the expression of four genes (RNFT1, RNF185, CGRRF1 and RNF19B) was significantly upregulated by ER stress. To determine the involvement of the ER stress-responsive genes in ERAD, we investigated their ER localisation, in vitro autoubiquitination activity and ER stress resistance. All were partially localised to the ER, whereas CGRRF1 did not possess E3 activity. RNFT1 and RNF185, but not CGRRF1 and RNF19B, exhibited significant resistance to ER stressor in an E3 activity-dependent manner. Thus, these genes are possible candidates for ERAD E3s. The ubiquitin–proteasome system (UPS) is an important mechanism for protein degradation in the cytosol and nucleus.
[Show full text]
A Meta-Analysis of the Effects of High-LET Ionizing Radiations in Human Gene Expression
Supplementary Materials A Meta-Analysis of the Effects of High-LET Ionizing Radiations in Human Gene Expression Table S1. Statistically significant DEGs (Adj. p-value < 0.01) derived from meta-analysis for samples irradiated with high doses of HZE particles, collected 6-24 h post-IR not common with any other meta- analysis group. This meta-analysis group consists of 3 DEG lists obtained from DGEA, using a total of 11 control and 11 irradiated samples [Data Series: E-MTAB-5761 and E-MTAB-5754]. Ensembl ID Gene Symbol Gene Description Up-Regulated Genes ↑ (2425) ENSG00000000938 FGR FGR proto-oncogene, Src family tyrosine kinase ENSG00000001036 FUCA2 alpha-L-fucosidase 2 ENSG00000001084 GCLC glutamate-cysteine ligase catalytic subunit ENSG00000001631 KRIT1 KRIT1 ankyrin repeat containing ENSG00000002079 MYH16 myosin heavy chain 16 pseudogene ENSG00000002587 HS3ST1 heparan sulfate-glucosamine 3-sulfotransferase 1 ENSG00000003056 M6PR mannose-6-phosphate receptor, cation dependent ENSG00000004059 ARF5 ADP ribosylation factor 5 ENSG00000004777 ARHGAP33 Rho GTPase activating protein 33 ENSG00000004799 PDK4 pyruvate dehydrogenase kinase 4 ENSG00000004848 ARX aristaless related homeobox ENSG00000005022 SLC25A5 solute carrier family 25 member 5 ENSG00000005108 THSD7A thrombospondin type 1 domain containing 7A ENSG00000005194 CIAPIN1 cytokine induced apoptosis inhibitor 1 ENSG00000005381 MPO myeloperoxidase ENSG00000005486 RHBDD2 rhomboid domain containing 2 ENSG00000005884 ITGA3 integrin subunit alpha 3 ENSG00000006016 CRLF1 cytokine receptor like
[Show full text]
Elucidation of the Cellular and Molecular Mechanisms Of
United Arab Emirates University Scholarworks@UAEU Dissertations Electronic Theses and Dissertations Winter 2-2015 ELUCIDATION OF THE CELLULAR AND MOLECULAR MECHANISMS OF MISSENSE MUTATIONS ASSOCIATED WITH FAMILIAL EXUDATIVE VITREORETINOPATHY AND CONGENITAL MYASTHENIC SYNDROME Reham Mahmoud Mohammed Milhem Follow this and additional works at: https://scholarworks.uaeu.ac.ae/all_dissertations Part of the Medical Pathology Commons Recommended Citation Milhem, Reham Mahmoud Mohammed, "ELUCIDATION OF THE CELLULAR AND MOLECULAR MECHANISMS OF MISSENSE MUTATIONS ASSOCIATED WITH FAMILIAL EXUDATIVE VITREORETINOPATHY AND CONGENITAL MYASTHENIC SYNDROME" (2015). Dissertations. 15. https://scholarworks.uaeu.ac.ae/all_dissertations/15 This Dissertation is brought to you for free and open access by the Electronic Theses and Dissertations at Scholarworks@UAEU. It has been accepted for inclusion in Dissertations by an authorized administrator of Scholarworks@UAEU. For more information, please contact [email protected]. United Arab Emirates University College of Medicine and Health Sciences ELUCIDATION OF THE CELLULAR AND MOLECULAR MECHANISMS OF MISSENSE MUTATIONS ASSOCIATED WITH FAMILIAL EXUDATIVE VITREORETINOPATHY AND CONGENITAL MYASTHENIC SYNDROME Reham Mahmoud Mohammed Milhem This dissertation is submitted in partial fulfilment of the requirements for the degree of Doctor of Philosophy Under the Supervision of Professor Bassam R. Ali February 2015 ii Declaration of Original Work I, Reham Mahmoud Mohammed Milhem, the undersigned, a graduate student at the United Arab Emirates University (UAEU), and the author of this PhD dissertation, entitled “Elucidation of the cellular and molecular mechanisms of missense mutations associated with familial exudative vitreoretinopathy and congenital myasthenic syndrome”. I hereby solemnly declare that this dissertation is an original research work that has been done and prepared by me under the supervision of Professor Bassam R.
[Show full text]
Notch-Induced Endoplasmic Reticulum
RESEARCH ARTICLE Notch-induced endoplasmic reticulum- associated degradation governs mouse thymocyte bÀselection Xia Liu1,2†, Jingjing Yu1,2†, Longyong Xu1,2†, Katharine Umphred-Wilson3†, Fanglue Peng1,2, Yao Ding1,2, Brendan M Barton3, Xiangdong Lv1, Michael Y Zhao1, Shengyi Sun4, Yuning Hong5, Ling Qi6, Stanley Adoro3*, Xi Chen1,2* 1Department of Molecular and Cellular Biology, Baylor College of Medicine, Houston, United States; 2Lester and Sue Smith Breast Center and Dan L Duncan Comprehensive Cancer Center, Baylor College of Medicine, Houston, United States; 3Department of Pathology, School of Medicine, Case Western Reserve University, Cleveland, United States; 4Center for Molecular Medicine and Genetics, Wayne State University, Detroit, United States; 5Department of Chemistry and Physics, La Trobe University, Melbourne, Australia; 6Department of Molecular and Integrative Physiology, University of Michigan Medical School, Ann Arbor, United States Abstract Signals from the pre-T cell receptor and Notch coordinately instruct b-selection of CD4–CD8–double negative (DN) thymocytes to generate ab T cells in the thymus. However, how these signals ensure a high-fidelity proteome and safeguard the clonal diversification of the pre- *For correspondence: selection TCR repertoire given the considerable translational activity imposed by b-selection is [email protected] (SA); largely unknown. Here, we identify the endoplasmic reticulum (ER)-associated degradation (ERAD) [email protected] (XC) machinery as a critical proteostasis checkpoint during b-selection. Expression of the SEL1L-HRD1 †These authors contributed complex, the most conserved branch of ERAD, is directly regulated by the transcriptional activity of equally to this work the Notch intracellular domain. Deletion of Sel1l impaired DN3 to DN4 thymocyte transition and ab Competing interests: The severely impaired mouse T cell development.
[Show full text]