DOCSLIB.ORG

And Leanne Brown Eat Well on $4/Day

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
And Leanne Brown Eat Well on $4/Day EAT WELL ON $4/DAY GOOD AND CHEAP LEANNE BROWN Salad ...............................................42 Broiled Eggplant Salad ....................................43 Kale Salad ..................................................... 44 NEW Ever-Popular Potato Salad ........................46 Introduction ....................5 NEW Spicy Panzanella......................................49 Text, recipes, and most photographs and A Note on $4/Day ...........................................6 Cold (and Spicy?) Asian Noodles .....................50 design by Leanne Brown, in fulfillment My Philosophy ................................................7 Taco Salad ......................................................52 of a final project for a master’s degree in Tips for Eating and Shopping Well ...................8 Beet and Chickpea Salad ................................53 First, I’d like to thank my husband, Food Studies at New York University. Pantry Basics .................................................12 Broccoli Apple Salad .......................................54 Dan. Without him this book would not NEW Charred Summer Salad ............................55 exist. Thank you also to my wonderful This book is distributed under a family and friends, who believed in this Creative Commons Attribution- idea before anyone else. And thank you NonCommercial ShareAlike 4.0 license. Breakfast ..............................14 to everyone who has taken the time to For more information, visit Tomato Scrambled Eggs .................................15 Snacks, Sides & tell me what Good and Cheap means to www.creativecommons.org/licenses/ Broiled Grapefruit ..........................................16 them. I heard from thousands of people by-nc-sa/4.0 Omelette ........................................................17 Small Bites .........................56 throughout the course of creating and Banana Pancakes ...........................................18 Jacket Sweet Potato ........................................57 distributing this book. The outpouring You may freely distribute this book NEW Chocolate Zucchini Muffins .....................21 Smoky and Spicy Roasted Cauliflower ............58 of love and support I’ve received is electronically. To download a free PDF Whole-Wheat Jalapeño Cheddar Scones..........22 Spicy Green Beans ..........................................59 probably enough for several lifetimes. or buy a print copy, visit NEW Peanut Butter and Jelly Granola Bars .......25 Mexican Street Corn ......................................60 To those who told me this book has www.leannebrown.com NEW Egg Sandwich with Mushroom Hash ......26 Green Chili and Cheddar Quesadillas ..............61 given them hope, inspired them, or IDEAS Oatmeal 6 Ways ....................................28 Cornmeal Crusted Veggies .............................62 otherwise brought them pleasure: Brown, Leanne IDEAS Yogurt Smash! .......................................32 Brussels Sprout Hash and Eggs.......................65 I don’t deserve so much gratitude for Good and Cheap: Eat Well on $4/Day Poutine ..........................................................66 so little, but doing work that matters is ISBN: 978-0-9938448-2-9 IDEAS Toast 8 Ways .........................................69 all I have ever wanted. IDEAS Popcorn 8 Ways .....................................74 Version 1.1, August 2014 Soup ..................................................34 Version 1.0, June 2014 Dal ................................................................35 Version 0.9, December 2013 Corn Soup .....................................................36 NEW French Onion Soup ..................................39 Handheld ..............................76 Lightly Curried Butternut Squash Soup ..........40 Cauliflower Tacos ..........................................77 Potato Leek Pizza ...........................................79 Broccoli Rabe and Mozzarella Calzones ..........80 NEW Broccoli, Egg, and Cheddar Empanadas ....83 Potato and Kale Rolls with Raita .....................84 IDEAS Leftovers ................................................87 3 Dinner .........................................88 Introduction Creamy Zucchini Fettuccine ...........................89 Pasta with Eggplant and Tomato ....................90 Chana Masala ................................................93 Black-Eyed Peas and Collards ..........................94 Eating is one of life’s greatest pleasures. In a perfect Vegetable Jambalaya ......................................97 world, healthy and delicious food would be all around NEW Filipino Chicken Adobo ............................98 Drinks ........................................148 us. It would be easy to choose and easy to enjoy. NEW Baked Beans 2 Ways ..............................101 Agua Fresca .................................................149 NEW Half-Veggie Burgers ...............................102 IDEAS Smoothies 4 Ways ...............................150 But of course it’s not a perfect world. There are NEW Beef Stroganoff ......................................105 thousands of barriers that can keep us from eating in a NEW Tofu Hot Pot ..........................................106 way that nourishes our bodies and satisfies our tastes. NEW Deconstructed Cabbage Rolls .................109 Money just needn’t be one of them. Savory Summer Cobbler .............................. 110 Desserts ..................................152 Cauliflower Cheese ....................................... 113 Caramelized Bananas ...................................153 Kitchen skill, not budget, is the key to great food. This Vegetable Quiche, Hold the Crust .................. 114 Coconut Chocolate Cookies ..........................155 cookbook is a celebration of the many delicious meals Shrimp and Grits ......................................... 117 Peach Coffee Cake ........................................156 available to those on even the most strict of budgets. Spicy, Crunchy, Creamy Polenta ................... 118 Fast Melon Sorbet ........................................158 Roast Chicken ..............................................121 NEW Avocado Milkshake ...............................159 Eating on a limited budget is not easy, and there are METHOD Roasted Vegetables .............................122 times when a tough week can turn mealtime into a Roasted Potatoes with Chilies .......................125 chore. As one woman told me, “I’m weary of the ‘what’s Spicy Broiled Tilapia with Lime ....................126 for dinner?’ game.” I hope the recipes and techniques in Flavor ............................................160 this book can help make those times rare and the tough Peanut Sauce ................................................ 161 choices a little more bearable. Spice Oil .......................................................162 Big Batch .............................127 Salsa ............................................................163 At the same time, this book is not a meal plan—those Spicy Pulled Pork .........................................129 Raita ............................................................164 are much too individual to share on a wide scale. NEW Deviled Eggs 6 Ways .............................130 Tzatziki .......................................................165 Every person and every family has specific needs and Perogies .......................................................132 IDEAS Spices and Aromatics ...........................166 unique tastes. We live in different regions, different NEW Dumplings 2 Ways ...............................134 neighborhoods, and with varying means. One book cannot account for all of that, but I hope it can be a spark, a general strategy, a flexible set of approachable Thanks .....................................168 and cheap recipes. The rest is up to you. Staples .......................................136 Flour Tortillas .............................................. 137 I think you’ll find (or perhaps have already found) that Roti .............................................................138 learning to cook has a powerfully positive effect. If you Pizza Dough 2 Ways ....................................139 Index .............................................172 can become a more skilled, more conscious cook, you’ll NEW Fresh Pasta ............................................ 141 be able to conjure deliciousness in any kitchen, anytime. Best Tomato Sauce .......................................142 Good cooking alone can’t solve hunger in America, but NEW Chorizo and White Bean Ragu ...............143 it can make life happier—and that is worth every effort. NEW Rainbow Rice 3 Ways ............................144 METHOD How to Cook Dried Beans..................145 Just as a good meal is best shared with others, so is METHOD Croutons or Breadcrumbs .................146 a good recipe. I may not be able to share a meal with you, but I’d love to offer a few ideas. What’s for dinner? Here’s my answer. 4 5 A Note on $4/Day My Philosophy I designed these recipes to fit the budgets of people living on SNAP, the The best health advice is simple: eat fruits and vegetables. Many US program that used to be called food stamps. If you’re on SNAP, you American cookbooks rely on meat as the central feature of a meal. My already know that the benefit formulas are complicated, but the rule of recipes celebrate the vegetables rather than the meat. thumb is that you end up with $4
Load more

Recommended publications
  • Pubcon Exhibitor Prospectus
    PubCon. Las Vegas. NV.USA. 2011 Sponsor and Exhibitor Prospectus — When it comes to creating marketing buzz online, webmasters pretty much invented the concept. The alpha attendees to PubCon are among the most highly pursued demographic in the online marketing world. Highly educated and computer savvy, they're early adopters of the latest web technologies and have large disposable incomes to match. These are the folks that any forward thinking company wants to reach and capture. — Sponsor and Exhibitor Prospectus Conference Exhibition Opportunities Event Exhibitor (10’X’10) $3,750 (10’X’20) $5,499 (20’X’20) $5,499 • One six foot table per 100 sq ft. • Two side chairs • Waste basket • Booth sign with company name on it • Standard pipe and drapery (10 ft back, 3 ft sides) • Single-sided full-page color advertisement in handbook • Company name and description in handbook • A total of four complementary exhibit hall passes per exhibitor • Mentioned in pre-event flyers, emails, and press releases • Logo in rotation on WebmasterWorld. Guaranteed one million logo impressions • Logo link to your exhibitor bio page • Company bio and info page on website from conference site exhibitor section • Ten show coupons for 15% off to give to your customers and attendees • Screen saver rotation with name at all sessions • Matching funds from PRWeb on selected PRWeb services when PubCon is referenced (TABLE TOP) $950 • One six foot table Each exhibitor is responsible for all booth staffing, booth decoration and other requirements specific to their booth such as electrical, shipping, Internet access, drayage, etc. Exhibit Hall Hours: Exhibition Hours: Wednesday (Nov 9) 10:00 a.m.
    [Show full text]
  • Tips to Roast Vegetables Spice Guide
    Tips to Roast Vegetables • Roast at a high oven temp- 400 to 450 degrees F • Chop vegetables in uniform size so they cook evenly • Don’t over crowd the pan, otherwise they will become soft • Roasting veggies with some oil will help them become crispier • To get the most flavor/crispier roast them on the top rack • Seasoning before putting them in the oven will add flavor • Flip veggies halfway through to ensure even cooking • When roasting multiple types of veggies, ensure they have similar cooking times. Good pairs include: Cauliflower and Broccoli cc Carrots and Broccoli Baby potatoes and Butternut Squash Onions and Bell Peppers Zucchini and Yellow Squash Asparagus and Leeks Spice Guide Table of Contents Spices by Cuisine Herbs and Spices 1 Mexican Coriander, Cumin, oregano, garlic powder, cinnamon, chili powder Herbs and Spices that Pair well with Proteins 2 Caribbean Chicken Fajita Bowl Recipe 3 All spice, nutmeg, garlic powder, cloves, cinnamon, ginger Shelf life of Herbs and Spices 4 French Nutmeg, thyme, garlic powder, rosemary, oregano, Herbs de Provence Spices by Cuisine 5 North African Tips to Roast Vegetables BP Cardamum, cinnamon, cumin, paprika, turmeric, ginger Cajun Cayenne, oregano, paprika, thyme, rosemary, bay leaves, Cajun seasoning Thai Basil, cumin, garlic, ginger, turmeric, cardamum, curry powder Mediterranean Oregano, rosemary, thyme, bay leaves, cardamum, cinnamon, cloves, coriander, basil, ginger Indian Bay leaves, cardamum, cayenne, cinnamon, coriander, cumin, ginger, nutmeg, paprika, turmeric, garam masala, curry powder Middle Eastern Bay leaves, cardamum, cinnamon, cloves, cumin, ginger, coriander, oregano, za’atar, garlic powder 5 Shelf Life of Herbs and Herbs and Spices Spices Herbs Herbs are plants that’s leaves can be used to add flavor to foods.
    [Show full text]
  • SUSHI! Page 10 Page 14 Page 18 2 | AROUND the RANCH AROUNDTHERANCH.COM WEDNESDAY, DECEMBER 16, 2020
    Around the Ranch AROUNDTHERANCH.COM THE COMMUNITY NEWSPAPER OF LAKEWOOD RANCH WEDNESDAY, DECEMBER 16, 2020 PEACE OUT, 2020 – The second annual Mindful Triathlon was held last month at Bob Gardner Park in Lakewood Ranch. The reimagined event benefited the Brain Health Initiative and drew some 60 attendees. For more photos see pages 12-13. Photo by Eric Nalpas INSIDE: COMMUNITY DUELING GROCERY NEW AT UNIVERSITY ACTIVITIES CARTS IN LWR CORNER: SUSHI! Page 10 Page 14 Page 18 2 | AROUND THE RANCH AROUNDTHERANCH.COM WEDNESDAY, DECEMBER 16, 2020 IT'S THAT TIME OF YEAR TO START ENJOYING YOUR OWN BACK YARD! % INTEREST0 AVAILABLE Patio Factory Supercenter ENTERTAINING OUTDOORS NEVER LOOKED SO GOOD! Visit one of our stores today! • Lloyd Flanders • Woodard • Gensun • South Sea Rattan VOTED 941-925-1686 3855 Clark Road, Sarasota, FL # 9 YEARS (East of Beneva on Northside of Clark) • Mon-Sat 9am-5pm • Sun 11am-5pm IN A ROW 941-739-7711 941-889-7450 in1Sarasota, Manatee and Venice 5615 14th Street West, Bradenton, FL 3616 Tamiami Trail, Port Charlotte, FL (US41-Tamiami Trail) • Mon-Sat 9:30am-5:30pm • Sun 11am-5pm Mon.-Sat. 9:30am-5:30pm • Sun. 11am-5pm 2019 www.patiofactorysupercenter.com FO-1887432 WEDNESDAY, DECEMBER 16, 2020 AROUNDTHERANCH.COM AROUND THE RANCH | 3 Howinthe World Do YouStopaStroke? Comprehensively. It’s extremelycomplicated to stop astroke’srapid killing course onceit’sstarted.Ittakes stroke neurologyexperts in collaboration with stroke-specificemergencyspecialists to diagnoseand treateachpatient’scomplex symptoms immediatelyand with the most advanced care.That’sthe difference betweenour ComprehensiveStrokeCenter andthe next best option. Sarasota Memorialisthisregion’s only state-certified ComprehensiveStrokeCenter, providingpatients with thehighest levelofstrokespecialtycare –multidisciplinarycare that canmakeall thedifferenceinthe world for patients whowantmorethan survival.
    [Show full text]
  • Stock Vs. Broth: Are You Confused? Kim Schuette, CN Certified GAPS Practitioner
    Stock vs. Broth: Are You Confused? Kim Schuette, CN Certified GAPS Practitioner French chefs have a term fonds de cuisine, which translates “the foundation and working capital of the kitchen.” Bone and meat stock provide just that, the foundation of both the kitchen and ultimately one’s physical health. One of the most common Questions that those individuals embarking upon the GAPS Diet™ have is “Do I make stock or broth?” What is the difference between the two? The two words are often used interchangeably by the most educated of chefs. For the purpose of the GAPS Diet™, Dr. Natasha Campbell-McBride uses the terms “meat stock” and “bone stock.” In this paper, I will use “meat stock” when referencing meat stock and “bone broth” for bone stock. Meat stock, rather than bone broth, is used in the beginning stages of the GAPS Diet™, especially during the Introduction Diet where the primary focus is healing the gut. Bone broth is ideal for consuming once gut healing has taken place. The significant difference is that the meat stock is not cooked as long as bone broth. Meat stock is especially rich in gelatin and free amino acids, like proline and glycine. These amino acids, along with the gelatinous protein from the meat and connective tissue, are particularly beneficial in healing and strengthening connective tissue such as that found in the lining of the gut, respiratory tract, and blood/brain barrier. These nutrients are pulled out of the meat and connective tissue during the first several hours of cooking meaty fish, poultry, beef and lamb.
    [Show full text]
  • Arxiv:2012.15102V2 [Hep-Ph] 13 May 2021 T > Tc
    Confinement of Fermions in Tachyon Matter at Finite Temperature Adamu Issifu,1, ∗ Julio C.M. Rocha,1, y and Francisco A. Brito1, 2, z 1Departamento de F´ısica, Universidade Federal da Para´ıba, Caixa Postal 5008, 58051-970 Jo~aoPessoa, Para´ıba, Brazil 2Departamento de F´ısica, Universidade Federal de Campina Grande Caixa Postal 10071, 58429-900 Campina Grande, Para´ıba, Brazil We study a phenomenological model that mimics the characteristics of QCD theory at finite temperature. The model involves fermions coupled with a modified Abelian gauge field in a tachyon matter. It reproduces some important QCD features such as, confinement, deconfinement, chiral symmetry and quark-gluon-plasma (QGP) phase transitions. The study may shed light on both light and heavy quark potentials and their string tensions. Flux-tube and Cornell potentials are developed depending on the regime under consideration. Other confining properties such as scalar glueball mass, gluon mass, glueball-meson mixing states, gluon and chiral condensates are exploited as well. The study is focused on two possible regimes, the ultraviolet (UV) and the infrared (IR) regimes. I. INTRODUCTION Confinement of heavy quark states QQ¯ is an important subject in both theoretical and experimental study of high temperature QCD matter and quark-gluon-plasma phase (QGP) [1]. The production of heavy quarkonia such as the fundamental state ofcc ¯ in the Relativistic Heavy Iron Collider (RHIC) [2] and the Large Hadron Collider (LHC) [3] provides basics for the study of QGP. Lattice QCD simulations of quarkonium at finite temperature indicates that J= may persists even at T = 1:5Tc [4] i.e.
    [Show full text]
  • Imagining Outer Space Also by Alexander C
    Imagining Outer Space Also by Alexander C. T. Geppert FLEETING CITIES Imperial Expositions in Fin-de-Siècle Europe Co-Edited EUROPEAN EGO-HISTORIES Historiography and the Self, 1970–2000 ORTE DES OKKULTEN ESPOSIZIONI IN EUROPA TRA OTTO E NOVECENTO Spazi, organizzazione, rappresentazioni ORTSGESPRÄCHE Raum und Kommunikation im 19. und 20. Jahrhundert NEW DANGEROUS LIAISONS Discourses on Europe and Love in the Twentieth Century WUNDER Poetik und Politik des Staunens im 20. Jahrhundert Imagining Outer Space European Astroculture in the Twentieth Century Edited by Alexander C. T. Geppert Emmy Noether Research Group Director Freie Universität Berlin Editorial matter, selection and introduction © Alexander C. T. Geppert 2012 Chapter 6 (by Michael J. Neufeld) © the Smithsonian Institution 2012 All remaining chapters © their respective authors 2012 All rights reserved. No reproduction, copy or transmission of this publication may be made without written permission. No portion of this publication may be reproduced, copied or transmitted save with written permission or in accordance with the provisions of the Copyright, Designs and Patents Act 1988, or under the terms of any licence permitting limited copying issued by the Copyright Licensing Agency, Saffron House, 6–10 Kirby Street, London EC1N 8TS. Any person who does any unauthorized act in relation to this publication may be liable to criminal prosecution and civil claims for damages. The authors have asserted their rights to be identified as the authors of this work in accordance with the Copyright, Designs and Patents Act 1988. First published 2012 by PALGRAVE MACMILLAN Palgrave Macmillan in the UK is an imprint of Macmillan Publishers Limited, registered in England, company number 785998, of Houndmills, Basingstoke, Hampshire RG21 6XS.
    [Show full text]
  • Download Ivar's Chowders Nutritional Information
    A Northwest Soup Tradition Widely recognized as one of the finest food purveyors in the country, Ivar’s Soup & Sauce Company produces top-quality seafood soups, and sauces at our state-of-the-art facility in Mukilteo, Washington. Our soup tradition began in 1938 when Ivar Haglund began making and selling his homemade clam chowder on the Seattle waterfront. Today, along with our original line of Ivar’s seafood soups and chowders, we produce a selection of original, non-seafood recipes and new classics. Ivar’s also develops custom soups for restaurants and food-service companies, and they’re all made with the same tradition of quality that has made us famous since 1938. Ivar’s Soup & Sauce Company • 11777 Cyrus Way, Mukilteo, WA 98275 • Ivars.com Alder Smoked Salmon Chowder RTH For more information please contact our sales department at 425 493 1402 Savor the irresistible flavor of wild Alaskan smoked salmon, blended with tender potatoes and vegetables in this rich and creamy chowder. Preparation time: 30 minutes Main Ingredients: Potatoes, smoked salmon, garlic, Distribution Item Number: onion, celery, spices, Parmesan and Romano cheese Manufacturers’ Code: 969 Shelf Life: Three months refrigerated or 18 months Contents: Four 4-pound pouches of soup, ready to use. frozen. Ivar’s Puget Sound Style Clam Chowder Available in concentrated and heat-and-serve versions, this distinctive Northwest-style chowder with a tantalizing hint of bacon is made with meaty clams harvested in the icy waters of the Atlantic Ocean. Preparation Time: 35 minutes Main Ingredients: Sea clams, potatoes, bacon, Distribution Item Number: onions, celery Loaded Baked Potato Soup RTH Manufacturers’ Code: concentrate 9571, heat-and-serve 952 Shelf Life: Three months refrigerated or 18 months frozen.
    [Show full text]
  • North Carolina Obituaries Courier Tribune Name Date of Paper Page # Date of Death Abbott, Blannie Allen 7-Aug-84 7A 6-Aug-84
    North Carolina Obituaries Courier Tribune Name Date of Paper Page # Date of Death Abbott, Blannie Allen 7-Aug-84 7A 6-Aug-84 Abbott, Douglas L. 1-Sep-82 12A 30-Aug-82 Abbott, Helen Hartsook 3-Dec-82 9A 2-Dec-82 Abbott, Molly Jeane 3-Nov-81 8A 31-Oct-81 Abbott, Nora Johnson Mitchell 14-Oct-83 12A 13-Oct-83 Abbott, Roger 1-Aug-84 6A 31-Jul-84 Abercrombie, Dodd 5-Oct-80 6A 3-Oct-80 Abernathy, Ray Paul 29-Jun-80 8A 28-Jun-80 Abernathy, Shaun Travis 24-May-83 8A 24-May-83 Abrams, Reagan Vincent 28-Sep-80 6A 26-Sep-80 Abston, Thomas Earl 30-Dec-82 10A 29-Dec-82 Ackerman, Elsie K. 20-Apr-82 8A 19-Apr-82 Acree, Una Mae Phillips 6-Jul-81 6A 5-Jul-81 Adams, Anna Threadgill 9-Dec-85 9A 8-Dec-85 Adams, Annie Vaughn 12-Mar-85 6A 11-Mar-85 Adams, Bernice Hooper 6-Jul-82 8A 5-Jul-82 Adams, Dora Carrick 13-Jun-80 10A 12-Jun-80 Adams, Edward Vance 23-May-83 6A 23-May-83 Adams, Herman Hugh Sr. 29-Oct-81 8A 27-Oct-81 Adams, James Clifton 18-Sep-84 9A 17-Sep-84 Adams, John Edwin 1-Mar-84 10A 29-Feb-84 Adams, T.B. 15-Oct-82 10A 14-Oct-82 Adams, Velma D. 11-Aug-81 8A 10-Aug-81 Adcock, Plackard C. 6-Jul-82 8A 5-Jul-82 Aderholt, Daniel H. 17-May-85 10A 13-May-85 Adkins, Clarence Odell 1-Jan-85 7A 1-Jan-85 Adkins, E.G.
    [Show full text]
  • Antarctic Primer
    Antarctic Primer By Nigel Sitwell, Tom Ritchie & Gary Miller By Nigel Sitwell, Tom Ritchie & Gary Miller Designed by: Olivia Young, Aurora Expeditions October 2018 Cover image © I.Tortosa Morgan Suite 12, Level 2 35 Buckingham Street Surry Hills, Sydney NSW 2010, Australia To anyone who goes to the Antarctic, there is a tremendous appeal, an unparalleled combination of grandeur, beauty, vastness, loneliness, and malevolence —all of which sound terribly melodramatic — but which truly convey the actual feeling of Antarctica. Where else in the world are all of these descriptions really true? —Captain T.L.M. Sunter, ‘The Antarctic Century Newsletter ANTARCTIC PRIMER 2018 | 3 CONTENTS I. CONSERVING ANTARCTICA Guidance for Visitors to the Antarctic Antarctica’s Historic Heritage South Georgia Biosecurity II. THE PHYSICAL ENVIRONMENT Antarctica The Southern Ocean The Continent Climate Atmospheric Phenomena The Ozone Hole Climate Change Sea Ice The Antarctic Ice Cap Icebergs A Short Glossary of Ice Terms III. THE BIOLOGICAL ENVIRONMENT Life in Antarctica Adapting to the Cold The Kingdom of Krill IV. THE WILDLIFE Antarctic Squids Antarctic Fishes Antarctic Birds Antarctic Seals Antarctic Whales 4 AURORA EXPEDITIONS | Pioneering expedition travel to the heart of nature. CONTENTS V. EXPLORERS AND SCIENTISTS The Exploration of Antarctica The Antarctic Treaty VI. PLACES YOU MAY VISIT South Shetland Islands Antarctic Peninsula Weddell Sea South Orkney Islands South Georgia The Falkland Islands South Sandwich Islands The Historic Ross Sea Sector Commonwealth Bay VII. FURTHER READING VIII. WILDLIFE CHECKLISTS ANTARCTIC PRIMER 2018 | 5 Adélie penguins in the Antarctic Peninsula I. CONSERVING ANTARCTICA Antarctica is the largest wilderness area on earth, a place that must be preserved in its present, virtually pristine state.
    [Show full text]
  • Physicochemical and Nutritional Characteristics of Solar and Sun-Dried Tomato Powder
    Journal of Food Research; Vol. 7, No. 6; 2018 ISSN 1927-0887 E-ISSN 1927-0895 Published by Canadian Center of Science and Education Physicochemical and Nutritional Characteristics of Solar and Sun-dried Tomato Powder Mavis Owureku-Asare1, 2, Ibok Oduro1, Firibu K. Saalia3, Charles Tortoe4 & R. P. Kingsly Ambrose2 1Department of Food Science and Technology, Kwame Nkrumah University of Science and Technology, Kumasi, Ghana 2Department of Agricultural and Biological Engineering, Purdue University, West Lafayette, Indiana, USA 3School of Engineering, University of Ghana, Accra, Ghana 4Food Research Institute, Council for Scientific and Industrial Research, Accra, Ghana Correspondence: Mavis Owureku-Asare, Department of Food Science and Technology, Kwame Nkrumah University of Science and Technology, private mail bag, Kumasi, Ghana. Tel: 233-264-646-016. E-mail: [email protected] Received: July 31, 2018 Accepted: August 17, 2018 Online Published: September 10, 2018 doi:10.5539/jfr.v7n6p1 URL: https://doi.org/10.5539/jfr.v7n6p1 Abstract Tomato (Solanum lycopersicum) is one of the most important vegetable plants in the world used in cooking foods. In Ghana, at peak seasons of harvesting tomato, high postharvest loses are incurred because of the absence of industrial tomato processing facilities for value addition into other convenient forms to extend shelf-life. Solar drying is a more efficient and low cost method of enhancing the quality and adding value to tomato. This study was carried out to design a natural mixed mode solar dryer suitable for drying tomato and to investigate the quality characteristics of the dried products. Fresh tomatoes were pre-treated with: a) 1% potassium metabisulfite solution; b) 1 % ascorbic acid solution; and c) used untreated as control.
    [Show full text]
  • The Nimrod Antarctic Expedition
    THE NIMROD ANTARCTIC EXPENDITION Dr. W. A. Rupert Michell (1879-1966) Sir Ernest Henry Shackleton (1874-1922), a giant of Antarctic exploration, made four journeys into the earth’s most southerly continent. On the Discovery Expedition of 1901-1904 he was Third Officer to Robert Falcon Scott (1868-1912)1. Then, between 1907 and 1922, he organized and led three expeditions2 himself. On the first of these his team included a 28-year- old doctor from Perth, Ontario, W. A. R. Michell. William Arthur ‘Rupert’ Michell was born at Perth, on October 18, 1879, the second son of Francis Lambton Michell (1849-1928) and Margaret Helen Bell (1854-1930). His father was, first, a teacher and later principal at the Perth Collegiate Institute and then, County Inspector of Public Schools. Michell received his primary and secondary education at Perth and in 1902 graduated from the University of Toronto Medical School. He was on staff at Hamilton General Hospital until 1904 when he returned to Lanark County and purchased the practice of Dr. Herbert Edwin Gage (1867-1926) at McDonalds Corners, in Dalhousie Township, north of Perth. In 1906 Michell left McDonald’s Corners and Canada for England where he planned to undertake post graduate studies. Before doing so, however, he signed on with the Elder-Dempster Line as a ship’s surgeon. The shipping line had been founded in 1868 specifically to serve travel and trade between the United Kingdom and colonial outposts on the west coast of Africa. Elder-Dempster ships provided scheduled service to-and- from Sierra Leone; Cape Palmas (Liberia); Cape Coast Castle and Accra (Ghana); Lagos, Benin Bonny and Old Calabar (Nigeria); and Fernando Po (Equatorial Guinea).
    [Show full text]
  • Soups & Stews Cookbook
    SOUPS & STEWS COOKBOOK *RECIPE LIST ONLY* ©Food Fare https://deborahotoole.com/FoodFare/ Please Note: This free document includes only a listing of all recipes contained in the Soups & Stews Cookbook. SOUPS & STEWS COOKBOOK RECIPE LIST Food Fare COMPLETE RECIPE INDEX Aash Rechte (Iranian Winter Noodle Soup) Adas Bsbaanegh (Lebanese Lentil & Spinach Soup) Albondigas (Mexican Meatball Soup) Almond Soup Artichoke & Mussel Bisque Artichoke Soup Artsoppa (Swedish Yellow Pea Soup) Avgolemono (Greek Egg-Lemon Soup) Bapalo (Omani Fish Soup) Bean & Bacon Soup Bizar a'Shuwa (Omani Spice Mix for Shurba) Blabarssoppa (Swedish Blueberry Soup) Broccoli & Mushroom Chowder Butternut-Squash Soup Cawl (Welsh Soup) Cawl Bara Lawr (Welsh Laver Soup) Cawl Mamgu (Welsh Leek Soup) Chicken & Vegetable Pasta Soup Chicken Broth Chicken Soup Chicken Soup with Kreplach (Jewish Chicken Soup with Dumplings) Chorba bil Matisha (Algerian Tomato Soup) Chrzan (Polish Beef & Horseradish Soup) Clam Chowder with Toasted Oyster Crackers Coffee Soup (Basque Sopa Kafea) Corn Chowder Cream of Celery Soup Cream of Fiddlehead Soup (Canada) Cream of Tomato Soup Creamy Asparagus Soup Creamy Cauliflower Soup Czerwony Barszcz (Polish Beet Soup; Borsch) Dashi (Japanese Kelp Stock) Dumpling Mushroom Soup Fah-Fah (Soupe Djiboutienne) Fasolada (Greek Bean Soup) Fisk och Paprikasoppa (Swedish Fish & Bell Pepper Soup) Frijoles en Charra (Mexican Bean Soup) Garlic-Potato Soup (Vegetarian) Garlic Soup Gazpacho (Spanish Cold Tomato & Vegetable Soup) 2 SOUPS & STEWS COOKBOOK RECIPE LIST Food
    [Show full text]