DOCSLIB.ORG

Engineering Xylose Metabolism in Triacylglycerol-Producing Rhodococcus Opacus for Lignocellulosic Fuel Production

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Engineering Xylose Metabolism in Triacylglycerol-Producing Rhodococcus Opacus for Lignocellulosic Fuel Production Engineering xylose metabolism in triacylglycerol-producing Rhodococcus opacus for lignocellulosic fuel production The MIT Faculty has made this article openly available. Please share how this access benefits you. Your story matters. Citation Kurosawa, Kazuhiko, Sandra J Wewetzer, and Anthony J Sinskey. 2013 Engineering Xylose Metabolism in Triacylglycerol-producing Rhodococcus Opacus for Lignocellulosic Fuel Production. Biotechnology for Biofuels 6(1): 134. As Published http://dx.doi.org/10.1186/1754-6834-6-134 Publisher BioMed Central Ltd. Version Final published version Citable link http://hdl.handle.net/1721.1/81356 Terms of Use Creative Commons Attribution Detailed Terms http://creativecommons.org/licenses/by/2.0 Stachyose D-Malic Acid Oxalic Acid Turanose Pyruvic Acid N-Acetyl-D-Glucosaminitol D-Melezitose L-Malic Acid D-Glucose-6-Phosphate D-Fructose Citric Acid α-Hydroxy Glutaric Acid-γ-Lactone D-Melibiose L-Arginine Glyoxylic Acid D-Raffinose L-Isoleucine α-Methyl-D-Mannoside M-Inositol Citramalic Acid Sec-Butylamine Sucrose Tween 40 L-Lyxose N-Acetyl-D-Glucosamine Glycyl-L-Proline Mucic acid Lactulose L-Tartaric Acid Formic Acid Palatinose Bromo Succinic Acid Acetamide m-Hydroxy Phenyl Acetic Acid Mono Methyl Succinate D-Ribono-1,4-Lactone α-D-Lactose Succinic Acid L-Homoserine L-Rhamnose Lactitol L-Fucose β-Methyl-D-Galactoside Malonic Acid Salicin Sebacic Acid Methyl Pyruvate β-Methyl-D-Xyloside α-D-Glucose L-Alaninamide Mannan Maltotriose 5-Keto-D-Gluconic Acid Hydroxy-L-Proline α-Methyl-D-Galactoside L-Proline 3-Methyl Glucose L-Alanine Glycerol β-Cyclodextrin D-Trehalose L-Threonine Dulcitol D-Arabitol Xylitol D-Glucose-1-Phosphate γ-Amino Butyric Acid D,L-Octopamine Glycogen D-Sorbitol Succinamic Acid β-Methyl-D-Glucuronic Acid L-Alanyl-Glycine Glycine L-Methionine p-Hydroxy Phenyl Acetic Acid D-Arabinose Inulin D-Galactose L-Phenylalanine D-Fructose-6-Phosphate Melibionic Acid D-Ribose I-Erythritol Itaconic Acid Sorbic Acid L-Glucose α-Methyl-D-Glucoside D-Galacturonic Acid M-Tartaric Acid L-Valine L-Sorbose Tricarballylic Acid α-Keto-Butyric Acid D-Lactic Acid Methyl Ester α-Cyclodextrin α-Hydroxy butyric Acid D-Threonine Gentiobiose Maltose Carbon substrateCarbon Thymidine L-Arabitol D-Mannitol δ-Amino Valeric Acid Sedoheptulosan α-Keto-Glutaric Acid γ-Hydroxy Butyric Acid D,L-α-Glycerol Phosphate Tyramine Amygdalin β-Hydroxy Butyric Acid Acetoacetic Acid L-Leucine D-Glucosamine Inosine D-Alanine L-Ornithine N-Acetyl-L-Glutamic Acid L-Pyroglutamic Acid 2,3-Butanediol D-Serine 2-Aminoethanol D-Glucuronic Acid L-Histidine Butyric Acid 1,2-Propanediol D-Tagatose D-Glucosaminic Acid N-Acetyl-β-D-Mannosamine Citraconic Acid L-Asparagine Oxalomalic Acid Gelatin Phenylethyl-amine L-Glutamic Acid N-Acetyl-Neuraminic Acid Caproic Acid D-Xylose Glycolic Acid Maltitol Glucuronamide Chondroitin Sulfate C D-Galactonic Acid-γ-Lactone L-Lysine L-Serine α-Keto Valeric Acid 2,3-Butanone 2-Deoxy-D-Ribose D-Saccharic Acid Glycyl-L-Glutamic Acid D-Aspartic Acid D-Gluconic Acid D-Mannose Adonitol L-Glutamine D-Fucose Pectin Propionic Acid N-Acetyl-D-Galactosamine D-Tartaric Acid L-Aspartic Acid 3-Hydroxy 2-Butanone Dihydroxy Acetone L-Lactic Acid Laminarin 3-O-β-D-Galacto-pyranosyl-D-Arabinose 4-Hydroxy Benzoic Acid Arbutin β-D-Allose Fumaric Acid Dextrin Adenosine Quinic Acid L-Arabinose 2-Deoxy Adenosine D,L-Malic Acid Uridine Tween 20 Acetic Acid γ-Cyclodextrin Capric Acid Putrescine β-Methyl-D-Glucoside D-Cellobiose Tween 80 Glycyl-L-Aspartic Acid 2-Hydroxy Benzoic Acid D,L-Carnitine D-Psicose L-Galactonic Acid-γ-Lactone 0.0 0.4 0.8 1.2 1.6 0.0 0.4 0.8 1.2 1.6 0.0 0.4 0.8 1.2 1.6 Overall well color development (OD595) Wild-type PD630 Transformant Xsp8 Figure S1 Carbon utilization profiles of R. opacus strains. Turbidity data measure bacterial growth, indicative of substrate utilization. Washed cells grown on LB plates for 3 days were suspended in 28 ml IF-0a GN/GP Base Inoculating Fluid (Biolog) and 0.3 ml Redox Dye Mix D (Biolog) and adjusted to an OD660 of 0.01. Aliquots of 50 µl the mixture were dispensed into each well of the BIOLOG PM microplates. Data are based on the absorbance following incubation of the plates for 5 days. The well color development for each sample was calculated as the mean value of the OD595 in the three replicates of each substrate, subtracted of the average OD595 in the background wells. The order of the carbon sources is the rank of the growth on 190 substrates for PD630. Error bars show the standard deviations. Hyg-XI MNYQPTPEDRFTFGLWTVGWQGRDPFGDATRRALDPVETVQRLAELGAHGVTFHDDDLIPFGSSDTERESHIKRFRQALD Ave-XI MNYQPTPEDRFTFGLWTVGWQGRDPFGDATRRALDPVETVQRLAGLGAHGVTFHDDDLIPFGSSDTERESHIKRFRQALD Cha-XI MSYQPTPEDRFTFGLWTVGWQGRDPFGDATRRALDPVETVQRLAELGAHGVTFHDDDLIPFGSSDTEREAHIKRFRQALD Coe-XI MNYQPTPEDRFTFGLWTVGWQGRDPFGDATRQALDPAESVRRLSELGAYGVTFHDDDLIPFGSSDTERESHIKRFRQALD Sp8-O1 MSFQPTPEDRFTFGLWTVGWQGRDPFGDATRPALDPVETVQRLAELGAYGVTFHDDDLIPFGSSDTERESHIKRFRQALD 80 *.:**************************** ****.*:*:**: ***:********************:********** Hyg-XI ATGMTVPMATTNLFTHPVFKDGAFTANDRDVRRYALRKTIRNIDLAAELGAKTYVAWGGREGAESGAAKDVRSALDRMKE Ave-XI ATGMAVPMATTNLFTHPVFKDGAFTANDRDVRRYALRKTIRNIDLAAELGAKTYVAWGGREGAESGAAKDVRVALDRMKE Cha-XI ATGMKVPMATTNLFAHPVFKDGAFTANDRDVRRYALRKTIRNIDLAVELGAQVYVAWGGREGAESGAAKDVRAALDRMKE Coe-XI ATGMKVPMATTNLFTHPVFKDGAFTANDRDVRRYALRKTIRNIDLAVELGASVYVAWGGREGAESGAAKDVRDALDRMKE Sp8-O1 ATGMTVPMATTNLFTHPVFKDGGFTANDRDVRRYALRKTIRNIDLAAELGAKTYVAWGGREGAESGGAKDVRDALDRMKE 160 **** *********:*******.***********************.****..*************.***** ******* Hyg-XI AFDLLGEYVTSQGYDLRFAIEPKPNEPRGDILLPTVGHALAFIERLERPELYGVNPEVGHEQMAGLNFPHGIAQALWAGK Ave-XI AFDLLGEYVTAQGYDLRFAIEPKPNEPRGDILLPTVGHALAFIERLERPELYGVNPEVGHEQMAGLNFPHGIAQALWAGK Cha-XI AFDLLGEYVTSQGYDLRFAIEPKPNEPRGDILLPTVGHALAFIERLERPELYGVNPEVGHEQMAGLNFPHGIAQALWAGK Coe-XI AFDLLGEYVTEQGYDLKFAIEPKPNEPRGDILLPTVGHALAFIERLERPELYGVNPEVGHEQMAGLNFPHGIAQALWAGK Sp8-O1 AFDLLGEYVIAQGYDLRFAIEPKPNEPRGDILLPTVGHALAFIERLERPELYGVNPEVGHEQMAGLNFPHGIAQALWAGK 240 ********* *****:*************************************************************** Hyg-XI LFHIDLNGQSGIKYDQDLRFGAGDLRSAFWLVDLLESAGYEGPRHFDFKPPRTEDLDGVWASAAGCMRNYLILKERAAAF Ave-XI LFHIDLNGQSGIKYDQDLRFGAGDLRAAFWLVDLLESAGYEGPKHFDFKPPRTEDLDGVWASAAGCMRNYLILKERTAAF Cha-XI LFHIDLNGQSGIKYDQDLRFGAGDLRAAFWLVDLLESAGYTGPRHFDFKPPRTEDLDGVWASAAGCMRNYLILKERAAAF Coe-XI LFHIDLNGQSGIKYDQDLRFGAGDLRAAFWLVDLLERAGYAGPRHFDFKPPRTEDFDGVWASAAGCMRNYLILKDRAAAF Sp8-O1 LFHIDLNGQSGIKYDQDLRFGAGDLRAAFWLVDLLETAGYEGPRHFDFKPPRTEDFDGVWASAAGCMRNYLILKDRAAAF 320 **************************:********* *** **:***********:******************:*:*** Hyg-XI RADPEVQEALRASRLDQLAQPTAADGLEDLLADRAAFEDFDVEAAAARGMAFERLDQLAMDHLLGARG Ave-XI RADPEVQEALRAARLDELAQPTAGDGLTALLADRTAFEDFDVEAAAARGMAFEQLDQLAMDHLLGARG Cha-XI RADPEVQEALRAARLDELAQPTAADGLQALLADRSAFESFDVEAAAARGMAFEHLDQLAMDHLLGARG Coe-XI RADPQVQEALAAARLDELARPTAEDGLAALLADRSAYDTFDVDAAAARGMAFEHLDQLAMDHLLGAR- Sp8-O1 RADPEVQEALRAARLDQLAQATAADGLDALLADRSAFEDFDVDAAAARGMAFEHLDQLAMDHLLGARG 388 ****:***** *:***:**:.** *** *****:*:: ***:**********:************* Figure S2 Comparison of ORF-1 in pXsp8 insert with several xylose isomerases at the deduced amino acid sequence level using the CLUSTALW program. Hyg-XI, xylose isomerase of S. hygroscopicus accession no. AEY87893; Ave-XI, xylose isomerase of S. avermitilis accession no. NP_828358; Cha-XI, xylose isomerase of S. chartreusis accession no. ZP_09957234; Coe-XI, xylose isomerase of S. coelicolor accession no. NP_625460; Sp8-O1, ORF-1 of the 3603-bp insert. Numbering of the amino acids starts at the N-terminus of all proteins. The introduction of gaps is indicated by dashes. Asterisks, colons and periods indicate identical, strongly similar and weakly similar conserved residues, respectively, among all of these enzymes. *************:***********.:**:***********::* ************* *** ***:**:****:*:****** Cha-XK MSAAEGPLVVGVDSSTQSTKALVVDVSTGRVVASGQAPHTVSSGSGRESDPRQWWDALCEALRQCGDAAHEAAAVSVGGQQHG Coe-XK MSAAEGPLVVGVDTSTQSTKALVVDAATGRVVASGQAPHTVSSGTGRESDPRQWWDALGEALSQCGEAAREAAAVSVGGQ QHG Ave-XK MSAAEGPLVVGVDTSTQSTKALVVDASTGRVVASGQAPHTVSAGAGRESDPRQWWDALCEALHQCGDAAHEAAAISVGGQ QHG Hyg-XK MSAAEGPLVVGVDTSTQSTKALVVDAATGQVVASGQAPHTVSSGAGRESDPRQWWDALCEALRQCGDAAHEAAAVSIGGQ QHG Sp8-O2 MSAAEGPLVVGVDTSTQSTKALVVDAATGQVVASGQAPHTVTTGGGRESDPRQWWDALCEALRQCGDAAHEAAAISVGGQ QHG 83 ***** :*:***************** ** :****.* *********..***.:*****:******.**. ************ Cha-XK LVTLDDRGEPVRPALLWNDVRSAPQARRLTEELGGAKFWAERTGSVPAASFTVTKWAWLAEHEPEAARATKAVRLPHDYLTER Coe-XK LVTLDARGEPVRPALLWNDVRSAPQARRLIDELGGAKAWAERTGSVPSASFTVTKWAWLTEHEPEAARAVKAVRLPHDYLTER Ave-XK LVTLDAHGDPVRPALLWNDVRSAPQARRLIEELGGPKAWAERTGSVPGPSFTVTKWAWLTEHEPEAVRATAAVRLPHDYLTER Hyg-XK LVTLDERGEPVRPALLWNDVRSAPQAGRLVEELGGPKAWAERTGSVPGASFTVTKWAWLAEHEPEAVRATRAVRLPHDYLTER Sp8-O2 LVTLDERGEPVRPALLWNDVRSAPQARRLVEELGGPKAWAERTGSVPGASFTASKWAWLAEHEPEAARATRAVRLPHDYLTER 166 ***:..*****.********.** ***: *:::.**************:.*****.*.**********.*************: Cha-XK LTGQGTTDRGDASGTGWWASGTERYDEEILAQVGLDPALLPRVVRPGEIAGTVRDSHDLPFSKGTLVAPGTGDNAAAALGLGV Coe-XK LTGEGTTDRGDVSGTGWWASGTEAYDEEILARVALDPALLPRVVRPGEVAGTVRDGHGLPFSKGTLVAAGTGDNAAAALGLGL Ave-XK LTGQGTTDRGDVSGTGWWASATESYDEEVLTHVGLDPALLPRVVRPGEVVGTVRDSHDLPFSKGTLVAPGTGDNAAAALGLGL Hyg-XK LTGQGTTDRGDASGTGWWASGTEAYDEETLAHVGLDPALLPRVVRPGEVAGTVRDSHDLPFSKGTLVAPGTGDNAAAALGLGL Sp8-O2 LTGQAVTDRGDASGTGWWASGTERYDEDTLAHLGLDPALLPRVVRPGEVAGTVRDGHGLPFSKGTLVASGTGDNAAAALGLGL 249 **.**:*******.**** :**:**:******************************:********* .* *****:***** Cha-XK RPGVPVMSLGTSGTVYAVSQRRPADPSGTVAGFADARGDWLPLACTLNCTLAVDRVATLLGLDREAVEPGTAVTLLPYLDGER
Load more

Recommended publications
  • Determining the Effect of Small Doses of Fructose and Its Epimers on Glycemic Control
    Determining the Effect of Small Doses of Fructose and its Epimers on Glycemic Control by Jarvis Clyde Noronha A thesis submitted in conformity with the requirements for the degree of Master of Science Department of Nutritional Sciences University of Toronto © Copyright by Jarvis Clyde Noronha 2017 ii Determining the Effect of Small Doses of Fructose and its Epimers on Glycemic Control Jarvis Clyde Noronha Master of Science Department of Nutritional Sciences University of Toronto 2017 Abstract Given that sugars have emerged as the dominant nutrient of concern in diabetes, there is a need for the development of alternative sweeteners. To assess the role of small doses (5g, 10g) of fructose and allulose on postprandial glucose metabolism, we conducted an acute randomized controlled trial in individuals with type 2 diabetes. We found that small doses of allulose, but not fructose, modestly reduced the postprandial glycemic response to a 75g oral glucose load. To assess whether low-dose (< 50-g/day) fructose and all its epimers (allulose, tagatose and sorbose) lead to sustainable improvements in long-term glycemic control, we conducted a systematic review and meta-analysis of controlled feeding trials. The available evidence suggested that fructose and tagatose led to significant reductions in HbA1c and fasting glucose. Our findings highlight the need for long-term randomized controlled trials to confirm the viability of fructose and its epimers as alternative sweeteners. iii Table of Contents Contents Abstract ...........................................................................................................................
    [Show full text]
  • Download Author Version (PDF)
    Environmental Science: Nano CdS Nanoparticles in Soil Induce Metabolic Reprogramming in Broad Bean (Vicia faba L.) Roots and Leaves Journal: Environmental Science: Nano Manuscript ID EN-ART-08-2019-000933.R1 Article Type: Paper Page 1 of 36 Environmental Science: Nano 1 2 3 4 The rapid development of nanotechnology has raised concern regarding the 5 6 7 environmental toxicity of nanoparticles (NPs). However, little is known about the 8 9 molecular mechanisms underlying NP toxicity in plants. Understanding toxic 10 11 12 mechanisms in organisms at molecular level, especially in crop plants, is important for 13 14 their sustainable use and development. In this study, although none of the phenotypic 15 16 17 parameters of broad bean plants (photosynthetic pigments contents, biomass, and lipid 18 19 20 peroxidation) were overtly impacted in response to CdS-NPs in soil during 28 d of 21 22 exposure, metabolomics revealed marked and statistically significant alterations in the 23 24 25 metabolite profiles of plant roots and leaves. The reprogramming of antioxidant 26 27 metabolite production presumably reflected the molecular defense response of the 28 29 30 plants to CdS-NPs stress. The sensitive responses of flavone, putrescine and 31 32 33 noradrenaline in the leaves suggests the use of these compounds in legumes as 34 35 biomarkers of oxidative stress induced by the presence of CdS-NPs in soil. 36 37 38 Metabolomics might thus be a suitable approach for the early detection of soil 39 40 contamination by Cd. In the plants, the reprogramming of carbon and nitrogen 41 42 43 metabolism (including sugars, organic acids, amino acids, and N-containing 44 45 46 compounds) alleviated the toxicity of CdS-NPs, which may have been caused by free 47 48 Cd2+ ions or perhaps by a particle-specific response.
    [Show full text]
  • Fermentation of Glucose and Xylose to Hydrogen in the Presence of Long Chain Fatty Acids
    University of Windsor Scholarship at UWindsor Electronic Theses and Dissertations Theses, Dissertations, and Major Papers 2009 Fermentation of Glucose and Xylose to Hydrogen in the Presence of Long Chain Fatty Acids Stephen Reaume University of Windsor Follow this and additional works at: https://scholar.uwindsor.ca/etd Recommended Citation Reaume, Stephen, "Fermentation of Glucose and Xylose to Hydrogen in the Presence of Long Chain Fatty Acids" (2009). Electronic Theses and Dissertations. 92. https://scholar.uwindsor.ca/etd/92 This online database contains the full-text of PhD dissertations and Masters’ theses of University of Windsor students from 1954 forward. These documents are made available for personal study and research purposes only, in accordance with the Canadian Copyright Act and the Creative Commons license—CC BY-NC-ND (Attribution, Non-Commercial, No Derivative Works). Under this license, works must always be attributed to the copyright holder (original author), cannot be used for any commercial purposes, and may not be altered. Any other use would require the permission of the copyright holder. Students may inquire about withdrawing their dissertation and/or thesis from this database. For additional inquiries, please contact the repository administrator via email ([email protected]) or by telephone at 519-253-3000ext. 3208. Fermentation of Glucose and Xylose to Hydrogen in the Presence of Long Chain Fatty Acids by Stephen Reaume A Thesis Submitted to the Faculty of Graduate Studies through the Environmental Engineering Program in Partial Fulfillment of the Requirements for the Degree of Master of Applied Science at the University of Windsor Windsor, Ontario, Canada 2009 © 2009 Stephen Reaume AUTHORS DECLARATION OF ORIGINALITY I hereby certify that I am the sole author of this thesis and that no part of this thesis has been published or submitted for publication.
    [Show full text]
  • Acute and Chronic Effects of Dietary Lactose in Adult Rats Are Not Explained by Residual Intestinal Lactase Activity
    Nutrients 2015, 7, 5542-5555; doi:10.3390/nu7075237 OPEN ACCESS nutrients ISSN 2072-6643 www.mdpi.com/journal/nutrients Article Acute and Chronic Effects of Dietary Lactose in Adult Rats Are not Explained by Residual Intestinal Lactase Activity Bert J. M. van de Heijning *, Diane Kegler, Lidewij Schipper, Eline Voogd, Annemarie Oosting and Eline M. van der Beek Danone Nutricia Research, PO Box 80141, TC Utrecht 3508, The Netherlands; E-Mails: [email protected] (D.K.); [email protected] (L.S.); [email protected] (E.V.); [email protected] (A.O.); [email protected] (E.M.B.) * Author to whom correspondence should be addressed; E-Mail: [email protected]; Tel.: +31-30-2095-000. Received: 5 June 2015 / Accepted: 30 June 2015 / Published: 8 July 2015 Abstract: Neonatal rats have a high intestinal lactase activity, which declines around weaning. Yet, the effects of lactose-containing products are often studied in adult animals. This report is on the residual, post-weaning lactase activity and on the short- and long-term effects of lactose exposure in adult rats. Acutely, the postprandial plasma response to increasing doses of lactose was studied, and chronically, the effects of a 30% lactose diet fed from postnatal (PN) Day 15 onwards were evaluated. Intestinal lactase activity, as assessed both in vivo and in vitro, was compared between both test methods and diet groups (lactose vs. control). A 50%–75% decreased digestive capability towards lactose was observed from weaning into adulthood. Instillation of lactose in adult rats showed disproportionally low increases in plasma glucose levels and did not elicit an insulin response.
    [Show full text]
  • And Honeydew Sugars with Respect to Their Utilization by the Hymenopteran Parasitoid Cotesia Glomerata F.L
    Journal of Insect Physiology 47 (2001) 1077–1084 www.elsevier.com/locate/jinsphys A comparison of nectar- and honeydew sugars with respect to their utilization by the hymenopteran parasitoid Cotesia glomerata F.L. Wa¨ckers * Institute of Plant Sciences, Applied Entomology, Swiss Federal Institute of Technology (ETH), 8092 Zurich, Switzerland Received 10 October 2000; received in revised form 12 February 2001; accepted 19 February 2001 Abstract Fourteen naturally occurring sugars were individually tested with respect to their effect on Cotesia glomerata longevity. Parasitoids kept with solutions of either sucrose, glucose and fructose lived for Ͼ30 days. This constitutes a factor 15 increase in life span in comparison to control individuals kept with water only. Stachyose, mannose, melezitose, melibiose, maltose and erlose increased parasitoid longevity by a factor of 11.2–6.9. Solutions of galactose and trehalose had a marginal, but still significant effect. Lactose and raffinose did not raise parasitoid longevity, while rhamnose actually reduced parasitoid survival. In an additional experiment, the relationship between quantity of sugar consumption and longevity was established for all 14 sugars. To study the effect of an unsuitable sugar in sugar mixtures, a range of glucose:rhamnose mixtures was tested. Even at 20% of the sugar mixture rhamnose suppressed the nutritional benefit of the 80% glucose. The nutritional suitability of the sugars shows a positive correlation with the previously reported gustatory response towards the individual sugars. Patterns of sugar utilization are discussed with respect to hydrolytic enzymes and carbohydrate biochemical characteristics. Our findings for C. glomerata are compared to patterns of sugar utilization reported for other species.
    [Show full text]
  • Electronic Supplementary Information
    Electronic Supplementary Material (ESI) for Chemical Science. This journal is © The Royal Society of Chemistry 2019 Electronic Supplementary Information Poly(ionic liquid)s as a Distinct Receptor Material to Create Highly- Integrated Sensing Platform for Efficiently Identifying a Myriad of Saccharides Wanlin Zhang, Yao Li, Yun Liang, Ning Gao, Chengcheng Liu, Shiqiang Wang, Xianpeng Yin, and Guangtao Li* *Corresponding authors: Guangtao Li ([email protected]) S1 Contents 1. Experimental Section (Page S4-S6) Materials and Characterization (Page S4) Experimental Details (Page S4-S6) 2. Figures and Tables (Page S7-S40) Fig. S1 SEM image of silica colloidal crystal spheres and PIL inverse opal spheres. (Page S7) Fig. S2 Adsorption isotherm of PIL inverse opal. (Page S7) Fig. S3 Dynamic mechanical analysis and thermal gravimetric analysis of PIL materials. (Page S7) Fig. S4 Chemical structures of 23 saccharides. (Page S8) Fig. S5 The counteranion exchange of PIL photonic spheres from Br- to DCA. (Page S9) Fig. S6 Reflection and emission spectra of spheres for saccharides. (Page S9) Table S1 The jack-knifed classification on single-sphere array for 23 saccharides. (Page S10) Fig. S7 Lower detection concentration at 10 mM of the single-sphere array. (Page S11) Fig. S8 Lower detection concentration at 1 mM of the single-sphere array. (Page S12) Fig. S9 PIL sphere exhibiting great pH robustness within the biological pH range. (Page S12) Fig. S10 Exploring the tolerance of PIL spheres to different conditions. (Page S13) Fig. S11 Exploring the reusability of PIL spheres. (Page S14) Fig. S12 Responses of spheres to sugar alcohols. (Page S15) Fig.
    [Show full text]
  • Xylose Fermentation to Ethanol by Schizosaccharomyces Pombe Clones with Xylose Isomerase Gene." Biotechnology Letters (8:4); Pp
    NREL!TP-421-4944 • UC Category: 246 • DE93000067 l I Xylose Fermenta to Ethanol: A R ew '.) i I, -- , ) )I' J. D. McMillan I ' J.( .!i �/ .6' ....� .T u�.•ls:l ., �-- • National Renewable Energy Laboratory II 'J 1617 Cole Boulevard Golden, Colorado 80401-3393 A Division of Midwest Research Institute Operated for the U.S. Department of Energy under Contract No. DE-AC02-83CH10093 Prepared under task no. BF223732 January 1993 NOTICE This report was prepared as an account of work sponsored by an agency of the United States government. Neither the United States government nor any agency thereof, nor any of their employees, makes any warranty, express or implied, or assumes any legal liability or responsibility for the accuracy, com­ pleteness, or usefulness of any information, apparatus, product, or process disclosed, or represents that its use would not infringe privately owned rights. Reference herein to any specific commercial product, process, or service by trade name, trademark, manufacturer, or otherwise does not necessarily con­ stitute or imply its endorsement, recommendation, or favoring by the United States government or any agency thereof. The views and opinions of authors expressed herein do not necessarily state or reflect those of the United States government or any agency thereof. Printed in the United States of America Available from: National Technical Information Service U.S. Department of Commerce 5285 Port Royal Road Springfield, VA22161 Price: Microfiche A01 Printed Copy A03 Codes are used for pricing all publications. The code is determined by the number of pages in the publication. Information pertaining to the pricing codes can be found in the current issue of the following publications which are generally available in most libraries: Energy Research Abstracts (ERA); Govern­ ment Reports Announcements and Index ( GRA and I); Scientific and Technical Abstract Reports(STAR); and publication NTIS-PR-360 available from NTIS at the above address.
    [Show full text]
  • Pharmaceutical Compositions of Rifaximin Pharmazeutische Rifaximin-Zusammensetzungen Compositions Pharmaceutiques De Rifaximine
    (19) TZZ Z__ T (11) EP 2 011 486 B2 (12) NEW EUROPEAN PATENT SPECIFICATION After opposition procedure (45) Date of publication and mention (51) Int Cl.: of the opposition decision: A61K 9/20 (2006.01) A61K 31/44 (2006.01) 12.08.2015 Bulletin 2015/33 (45) Mention of the grant of the patent: 23.05.2012 Bulletin 2012/21 (21) Application number: 08252198.0 (22) Date of filing: 26.06.2008 (54) Pharmaceutical compositions of rifaximin Pharmazeutische Rifaximin-Zusammensetzungen Compositions pharmaceutiques de rifaximine (84) Designated Contracting States: (56) References cited: AT BE BG CH CY CZ DE DK EE ES FI FR GB GR EP-A1- 0 616 808 EP-B1- 1 763 339 HR HU IE IS IT LI LT LU LV MC MT NL NO PL PT WO-A-2006/094737 WO-A2-2006/039022 RO SE SI SK TR US-A- 6 140 355 US-A1- 2005 101 598 (30) Priority: 06.07.2007 IN KO09682007 • DUPONT ET AL: "Treatment of Travelers’ 23.06.2008 EP 08252158 Diarrhea: Randomized Trial Comparing Rifaximin, Rifaximin Plus Loperamide, and (43) Date of publication of application: Loperamide Alone" CLINICAL 07.01.2009 Bulletin 2009/02 GASTROENTEROLOGY AND HEPATOLOGY, AMERICAN GASTROENTEROLOGICAL (60) Divisional application: ASSOCIATION, US, vol. 5, no. 4, 17 April 2007 11176043.5 / 2 420 226 (2007-04-17), pages 451-456, XP022029177 ISSN: 14186563.4 / 2 837 378 1542-3565 • ARYA ET AL: "Rifaximin-the promising anti- (73) Proprietor: Lupin Ltd. microbial for enteric infections" JOURNAL OF Mumbai, Maharashtra 400 098 (IN) INFECTION, ACADEMIC PRESS, LONDON, GB, vol.
    [Show full text]
  • Sugars and Plant Innate Immunity
    Journal of Experimental Botany Advance Access published May 2, 2012 Journal of Experimental Botany, Page 1 of 10 doi:10.1093/jxb/ers129 REVIEW PAPER Sugars and plant innate immunity Mohammad Reza Bolouri Moghaddam and Wim Van den Ende* KU Leuven, Laboratory of Molecular Plant Biology, Kasteelpark Arenberg 31, B-3001 Leuven, Belgium * To whom correspondence should be addressed. E-mail: [email protected] Received 27 January 2012; Revised 25 March 2012; Accepted 30 March 2012 Abstract Sugars are involved in many metabolic and signalling pathways in plants. Sugar signals may also contribute to Downloaded from immune responses against pathogens and probably function as priming molecules leading to pathogen-associated molecular patterns (PAMP)-triggered immunity and effector-triggered immunity in plants. These putative roles also depend greatly on coordinated relationships with hormones and the light status in an intricate network. Although evidence in favour of sugar-mediated plant immunity is accumulating, more in-depth fundamental research is required to unravel the sugar signalling pathways involved. This might pave the way for the use of biodegradable http://jxb.oxfordjournals.org/ sugar-(like) compounds to counteract plant diseases as cheaper and safer alternatives for toxic agrochemicals. Key words: immunity, pathogen, priming, signal, sugar. Introduction by guest on March 24, 2016 Sugars such as glucose, fructose, and sucrose are recognized Chisholm et al., 2006). Sugars are well known to activate as signalling molecules in plants (Rolland et al., 2006; various pattern recognition genes (Herbers et al., 1996a,b; Bolouri-Moghaddam et al., 2010), in addition to their Johnson and Ryan, 1990).
    [Show full text]
  • FDA Finalizes Allulose Guidance and Requests Information on Other Sugars Metabolized Differently Than Traditional Sugars
    FDA Finalizes Allulose Guidance and Requests Information on Other Sugars Metabolized Differently Than Traditional Sugars October 19, 2020 Food, Drug, and Device FDA has taken two notable actions regarding the sugars declaration in the Nutrition Facts Label (NFL) and Supplement Facts Label (SFL). On Friday, the agency released a final guidance regarding the declaration of allulose, confirming that this monosaccharide need not be included in the declaration of “Total Sugars” or “Added Sugars,” though it must be included in the “Total Carbohydrates” declaration in the NFL. Today, FDA published a Federal Register notice requesting information about and comments on the nutrition labeling of other sugars that are metabolized differently than traditional sugars. We briefly summarize both documents below to help inform stakeholder comments on the notice, which are due to FDA by December 18, 2020. Allulose Final Guidance Allulose, or D-psicose, is a monosaccharide that can be used as a substitute for traditional sugar in food and beverage products. For purposes of nutrition labeling, FDA has generally 1 defined nutrients based on their chemical structure.0F Accordingly, when FDA updated its NFL and SFL regulations in 2016, the agency reiterated the definition of “Total Sugars” as the sum of 2 all free monosaccharides and disaccharides (e.g. glucose, fructose, and sucrose).1F FDA also added to these regulations a definition of “Added Sugars” – sugars added during the processing 3 of food, or packaged as such – and required their declaration in the NFL and SFL.2F Although the agency recognized that there are sugars that are metabolized differently than traditional sugars, FDA did not make a determination at that time as to whether allulose should be excluded from “Total Carbohydrate,” “Total Sugars,” or “Added Sugars” Declarations.
    [Show full text]
  • Low Fructose Diet
    Low Fructose Diet What is Fructose? Fructose is a naturally occurring simple sugar found in fruit, vegetables, and honey. Fructose intolerance can occur in people with irritable bowel syndrome and other GI disorders. Fruits and fruit juices with higher levels of fructose may cause gas, bloating, abdominal cramping, and diarrhea. Glucose is also a naturally occurring sugar. The more glucose than fructose in a product, the more “intestinal friendly” the fruit or fruit juice may be. High Fructose Corn Syrup (HFCS) **** HFCS is made up of almost half glucose and half fructose and may be absorbed just as well as sucrose (regular table sugar). Therefore, items with HFCS such as soft drinks, may be tolerated well when limited to 12 oz per day and with a meal. HFCS can also be found in canned, baked, or processed foods. **** In some patients, even a small amount of processed fruit juice or even foods with HFCS may cause as much malabsorption, and/or intestinal discomfort, as eating large quantities of fruit. Sorbitol Sorbitol or Sorbose is a sugar alcohol used as an artificial sweetener and found naturally in fruits and fruit juices. It can also be found in many “diet foods” such as diet soft drinks, sugarless gum, sugar-free jelly/jam, and liquid medications. Sorbitol often creates similar symptoms as fructose – especially when fructose and sorbitol are ingested together. General Guidelines • Eliminate products with ingredients that list fructose, crystalline fructose (not HFCS), honey, and sorbitol on the label. • Avoid sugar alcohols which include sorbitol, isomalt, lactitol, maltitol, mannitol, xylitol, erythrytol, and lactatol.
    [Show full text]
  • Effects of D-Allulose on Glucose Tolerance and Insulin Response to A
    Clinical care/Education/Nutrition Open access Original research BMJ Open Diab Res Care: first published as 10.1136/bmjdrc-2020-001939 on 26 February 2021. Downloaded from Effects of D- allulose on glucose tolerance and insulin response to a standard oral sucrose load: results of a prospective, randomized, crossover study Francesco Franchi ,1 Dmitry M Yaranov,1 Fabiana Rollini,1 Andrea Rivas,1 Jose Rivas Rios,1 Latonya Been,1 Yuma Tani,2 Masaaki Tokuda,3 Tetsuo Iida,2 Noriko Hayashi,2 Dominick J Angiolillo,1 Arshag D Mooradian1 To cite: Franchi F, Yaranov DM, ABSTRACT Rollini F, et al. Effects of D- Introduction Current dietary guidelines recommend Significance of this study allulose on glucose tolerance limiting sugar intake for the prevention of diabetes and insulin response to a mellitus (DM). Reduction in sugar intake may require sugar What is already known about this subject? standard oral sucrose load: substitutes. Among these, D- allulose is a non- calorie rare ► D- allulose is defined one of the rare sugars, results of a prospective, which has been shown in animal and clinical randomized, crossover study. monosaccharide with 70% sweetness of sucrose, which has shown anti- DM effects in Asian populations. However, studies, conducted mostly in Asian populations, BMJ Open Diab Res Care to have postprandial plasma glucose suppres- 2021;9:e001939. doi:10.1136/ there is limited data on the effects of D- allulose in other sive effects with antiobesity and antidiabetic bmjdrc-2020-001939 populations, including Westerners. Research design and methods This was a prospective, effects. copyright. randomized, double- blind, placebo- controlled, crossover What are the new findings? ► Supplemental material is study conducted in 30 subjects without DM.
    [Show full text]