TA3 (TAAR9) Rabbit Polyclonal Antibody – TA331584 | Origene

Total Page：16

File Type：pdf, Size：1020Kb

TA3 (TAAR9) Rabbit Polyclonal Antibody – TA331584 | Origene

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA331584 TA3 (TAAR9) Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for Anti-TAAR9 Antibody is: synthetic peptide directed towards the C- terminal region of Human TAAR9. Synthetic peptide located within the following region: RVAKRERKAAKTLGIAMAAFLVSWLPYLVDAVIDAYMNFITPPYVYEILV Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 39 kDa Gene Name: trace amine associated receptor 9 (gene/pseudogene) Database Link: NP_778227 Entrez Gene 134860 Human Q96RI9 Background: TAAR9 is a member of a large family of rhodopsin G protein-coupled receptors (GPCRs, or GPRs). GPCRs contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins. Synonyms: TA3; TAR3; TAR9; TRAR3 Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% Protein Families: Druggable Genome This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 TA3 (TAAR9) Rabbit Polyclonal Antibody – TA331584 Protein Pathways: Neuroactive ligand-receptor interaction Product images: Host: Rabbit; Target Name: TAAR9; Sample Tissue: Fetal Liver lysates; Antibody Dilution: 1.0ug/ml This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 2.

Copy Link

Recommended publications

Discovery of Novel Imidazolines and Imidazoles As Selective TAAR1
Discovery of Novel Imidazolines and Imidazoles as Selective TAAR1 Partial Agonists for the Treatment of Psychiatric Disorders Giuseppe Cecere, pRED, Discovery Chemistry F. Hoffmann-La Roche AG, Basel, Switzerland Biological Rationale Trace amines are known for four decades Trace Amines - phenylethylamine p- tyramine p- octopamine tryptamine (PEA) Biogenic Amines dopamine norepinephrine serotonin ( DA) (NE) (5-HT) • Structurally related to classical biogenic amine neurotransmitters (DA, NE, 5-HT) • Co-localised & released with biogenic amines in same cells and vesicles • Low concentrations in CNS, rapidly catabolized by monoamine oxidase (MAO) • Dysregulation linked to psychiatric disorders such as schizophrenia & 2 depression Trace Amines Metabolism 3 Biological Rationale Trace Amine-Associated Receptors (TAARs) p-Tyramine extracellular TAAR1 Discrete family of GPCR’s Subtypes TAAR1-TAAR9 known intracellular Gs Structural similarity with the rhodopsin and adrenergic receptor superfamily adenylate Activation of the TAAR1 cyclase receptor leads to cAMP elevation of intracellular cAMP levels • First discovered in 2001 (Borowsky & Bunzow); characterised and classified at Roche in 2004 • Trace amines are endogenous ligands of TAAR1 • TAAR1 is expressed throughout the limbic and monoaminergic system in the brain Borowsky, B. et al., PNAS 2001, 98, 8966; Bunzow, J. R. et al., Mol. Pharmacol. 2001, 60, 1181. Lindemann L, Hoener MC, Trends Pharmacol Sci 2005, 26, 274. 4 Biological Rationale Electrical activity of dopaminergic neurons + p-tyramine
[Show full text]
Olfactory Expression of Trace Amine-Associated Receptors
ARTICLE https://doi.org/10.1038/s41467-021-23824-3 OPEN Olfactory expression of trace amine-associated receptors requires cooperative cis-acting enhancers ✉ Ami Shah1,5, Madison Ratkowski1,5, Alessandro Rosa 2,3, Paul Feinstein2,3 & Thomas Bozza 1,4 Olfactory sensory neurons express a large family of odorant receptors (ORs) and a small family of trace amine-associated receptors (TAARs). While both families are subject to so- called singular expression (expression of one allele of one gene), the mechanisms underlying ﬁ 1234567890():,; TAAR gene choice remain obscure. Here, we report the identi cation of two conserved sequence elements in the mouse TAAR cluster (T-elements) that are required for TAAR gene expression. We observed that cell-type-speciﬁc expression of a TAAR-derived transgene required either T-element. Moreover, deleting either element reduced or abolished expres- sion of a subset of TAAR genes, while deleting both elements abolished olfactory expression of all TAARs in cis with the mutation. The T-elements exhibit several features of known OR enhancers but also contain highly conserved, unique sequence motifs. Our data demonstrate that TAAR gene expression requires two cooperative cis-acting enhancers and suggest that ORs and TAARs share similar mechanisms of singular expression. 1 Department of Neurobiology, Northwestern University, Evanston, IL, USA. 2 The Graduate Center Programs in Biochemistry, Biology and CUNY Neuroscience Collaborative, New York, NY, USA. 3 Department of Biological Sciences, Hunter College, City University of New York, New York, NY, USA. 4 Chemistry of Life Processes Institute, Northwestern University, Evanston, IL, USA. 5These authors contributed equally: Ami Shah, Madison Ratkowski.
[Show full text]
File Download
Anatomical and functional evidence for trace amines as unique modulators of locomotor function in the mammalian spinal cord Elizabeth A. Gozal, Emory University Brannan E. O'Neill, Emory University Michael A. Sawchuk, Emory University Hong Zhu, Emory University Mallika Halder, Emory University Chou Ching-Chieh , Emory University Shawn Hochman, Emory University Journal Title: Frontiers in Neural Circuits Volume: Volume 8 Publisher: Frontiers | 2014-11-07, Pages 134-134 Type of Work: Article | Final Publisher PDF Publisher DOI: 10.3389/fncir.2014.00134 Permanent URL: https://pid.emory.edu/ark:/25593/mr95r Final published version: http://dx.doi.org/10.3389/fncir.2014.00134 Copyright information: © 2014 Gozal, O'Neill, Sawchuk, Zhu, Halder, Chou and Hochman. This is an Open Access article distributed under the terms of the Creative Commons Attribution 4.0 International License ( http://creativecommons.org/licenses/by/4.0/), which permits distribution of derivative works, making multiple copies, distribution, public display, and publicly performance, provided the original work is properly cited. This license requires credit be given to copyright holder and/or author, copyright and license notices be kept intact. Accessed September 27, 2021 11:18 AM EDT ORIGINAL RESEARCH ARTICLE published: 07 November 2014 NEURAL CIRCUITS doi: 10.3389/fncir.2014.00134 Anatomical and functional evidence for trace amines as unique modulators of locomotor function in the mammalian spinal cord Elizabeth A. Gozal , Brannan E. O’Neill , Michael A. Sawchuk , Hong Zhu , Mallika Halder , Ching-Chieh Chou and Shawn Hochman* Physiology Department, Emory University, Atlanta, GA, USA Edited by: The trace amines (TAs), tryptamine, tyramine, and β-phenylethylamine, are synthesized Brian R.
[Show full text]
G Protein-Coupled Receptors
S.P.H. Alexander et al. The Concise Guide to PHARMACOLOGY 2015/16: G protein-coupled receptors. British Journal of Pharmacology (2015) 172, 5744–5869 THE CONCISE GUIDE TO PHARMACOLOGY 2015/16: G protein-coupled receptors Stephen PH Alexander1, Anthony P Davenport2, Eamonn Kelly3, Neil Marrion3, John A Peters4, Helen E Benson5, Elena Faccenda5, Adam J Pawson5, Joanna L Sharman5, Christopher Southan5, Jamie A Davies5 and CGTP Collaborators 1School of Biomedical Sciences, University of Nottingham Medical School, Nottingham, NG7 2UH, UK, 2Clinical Pharmacology Unit, University of Cambridge, Cambridge, CB2 0QQ, UK, 3School of Physiology and Pharmacology, University of Bristol, Bristol, BS8 1TD, UK, 4Neuroscience Division, Medical Education Institute, Ninewells Hospital and Medical School, University of Dundee, Dundee, DD1 9SY, UK, 5Centre for Integrative Physiology, University of Edinburgh, Edinburgh, EH8 9XD, UK Abstract The Concise Guide to PHARMACOLOGY 2015/16 provides concise overviews of the key properties of over 1750 human drug targets with their pharmacology, plus links to an open access knowledgebase of drug targets and their ligands (www.guidetopharmacology.org), which provides more detailed views of target and ligand properties. The full contents can be found at http://onlinelibrary.wiley.com/doi/ 10.1111/bph.13348/full. G protein-coupled receptors are one of the eight major pharmacological targets into which the Guide is divided, with the others being: ligand-gated ion channels, voltage-gated ion channels, other ion channels, nuclear hormone receptors, catalytic receptors, enzymes and transporters. These are presented with nomenclature guidance and summary information on the best available pharmacological tools, alongside key references and suggestions for further reading.
[Show full text]
[ I]-3-Iodothyronamine in Mouse in Vivo: Relationship with Trace Amine-Associated Receptors
223 Distribution of exogenous [125I]-3-iodothyronamine in mouse in vivo: relationship with trace amine-associated receptors Grazia Chiellini1, Paola Erba2, Vittoria Carnicelli1, Chiara Manfredi2, Sabina Frascarelli1, Sandra Ghelardoni1, Giuliano Mariani2 and Riccardo Zucchi1 1Dipartimento di Scienze dell’Uomo e dell’Ambiente and 2Dipartimento di Oncologia, University of Pisa, Via Roma 55, 56126 Pisa, Italy (Correspondence should be addressed to G Chiellini; Email: [email protected]) Abstract 3-Iodothyronamine (T1AM) is a novel chemical messenger, intestine, liver, and kidney. Tissue radioactivity decreased structurally related to thyroid hormone, able to interact with exponentially over time, consistent with biliary and urinary G protein-coupled receptors known as trace amine-associated excretion, and after 24 h, 75% of the residual radioactivity was receptors (TAARs). Little is known about the physiological detected in liver, muscle, and adipose tissue. TAARs were role of T1AM. In this prospective, we synthesized expressed only at trace amounts in most of the tissues, the 125 [ I]-T1AM and explored its distribution in mouse after exceptions being TAAR1 in stomach and testis and TAAR8 injecting in the tail vein at a physiological concentration in intestine, spleen, and testis. Thus, while T1AM has a (0.3 nM). The expression of the nine TAAR subtypes was systemic distribution, TAARs are only expressed in certain 125 evaluated by quantitative real-time PCR. [ I]-T1AM was tissues suggesting that other high-afﬁnity molecular targets taken up by each organ. A signiﬁcant increase in tissue vs besides TAARs exist. blood concentration occurred in gallbladder, stomach, Journal of Endocrinology (2012) 213, 223–230 Introduction the physiological role of T1AM is still uncertain, this compound has recently been detected also in human blood The term thyroid hormone (TH) refers to 3,5,30,50- (Saba et al.
[Show full text]
Supporting Information
Supporting Information Yoon et al. 10.1073/pnas.1506058112 SI Materials and Methods Fisher Scientific); Cy3-conjugated donkey anti-rat IgG (Jackson RNA in Situ Hybridization. Mice were perfused with 4% (wt/vol) ImmunoResearch). paraformaldehyde (fix) and the interior of the snout removed and Sections were next incubated for 10 min at 37 °C in PBS soaked in fix overnight. The tissue was decalcified by incubation containing 1 mM EGS (Sigma) and 0.1% Tween20 and then for 3 d in 0.25 M EDTA/2% (wt/vol) paraformaldehyde and then washed three times for 5 min in PBS. They were next incubated embedded in OCT (Sakura). Serial coronal cryostat sections in 0.1 M HCl for 7 min to fragment DNA, washed for 5 min in (14 μm) were obtained and stored at −80 °C. PBS, and then treated with RNase A (100 mg/mL in 2× SSC) for Digoxigenin-labeled cRNA probes were prepared using cloned 30 min at 37 °C. After two 5-min washes in 2× SSC, sections were coding regions of individual Taar genes or the Nqo1 gene as equilibrated in 50% (vol/vol) formamide/2× SSC, pH 7.0. Probe templates. In situ hybridization to OE sections was performed as mix [15 μL containing 50–100 ng BAC DNA probe and 10 μg described (1), except that up to 30 μg/mL proteinase K was used mouse Cot-1 DNA in 50% formamide/2× SSC/10% (wt/vol) to permeabilize tissue sections before hybridization. If needed, dextran sulfate] was applied to each slide, and the slides were proteinase K activity was then eliminated by washing in PBS for coverslipped, sealed with rubber cement, and then incubated at 5 min at 85 °C.
[Show full text]
TAAR5) Knockout Mice
International Journal of Molecular Sciences Article Minor Changes in Erythrocyte Osmotic Fragility in Trace Amine-Associated Receptor 5 (TAAR5) Knockout Mice Ilya S. Zhukov 1,2 , Larisa G. Kubarskaya 2,3, Inessa V. Karpova 2 , Anastasia N. Vaganova 1, Marina N. Karpenko 2 and Raul R. Gainetdinov 1,4,* 1 Institute of Translational Biomedicine, Saint Petersburg State University, 199034 Saint Petersburg, Russia; [email protected] (I.S.Z.); [email protected] (A.N.V.) 2 Institute of Experimental Medicine, 197376 Saint Petersburg, Russia; [email protected] (L.G.K.); [email protected] (I.V.K.); [email protected] (M.N.K.) 3 Institute of Toxicology of Federal Medical-Biological Agency, 192019 Saint Petersburg, Russia 4 Saint Petersburg State University Hospital, Saint Petersburg State University, 199034 Saint Petersburg, Russia * Correspondence: [email protected] Abstract: Trace amine-associated receptors (TAARs) are a group of G protein-coupled receptors that are expressed in the olfactory epithelium, central nervous system, and periphery. TAAR family generally consists of nine types of receptors (TAAR1-9), which can detect biogenic amines. During the last 5 years, the TAAR5 receptor became one of the most intriguing receptors in this subfamily. Recent studies revealed that TAAR5 is involved not only in sensing socially relevant odors but also in the regulation of dopamine and serotonin transmission, emotional regulation, and adult neurogenesis by providing signiﬁcant input from the olfactory system to the limbic brain areas. Such results indicate that future antagonistic TAAR5-based therapies may have high pharmacological Citation: Zhukov, I.S.; Kubarskaya, potential in the ﬁeld of neuropsychiatric disorders.
[Show full text]
Pattern of TAAR5 Expression in the Human Brain Based on Transcriptome Datasets Analysis
International Journal of Molecular Sciences Article Pattern of TAAR5 Expression in the Human Brain Based on Transcriptome Datasets Analysis Anastasia N. Vaganova 1 , Ramilya Z. Murtazina 1 , Taisiia S. Shemyakova 1 , Andrey D. Prjibelski 1 , Nataliia V. Katolikova 1 and Raul R. Gainetdinov 1,2,* 1 Institute of Translational Biomedicine, St. Petersburg State University, Universitetskaya nab. 7/9, 199034 St. Petersburg, Russia; [email protected] (A.N.V.); [email protected] (R.Z.M.); [email protected] (T.S.S.); [email protected] (A.D.P.); [email protected] (N.V.K.) 2 St. Petersburg University Hospital, St. Petersburg State University, Universitetskaya nab. 7/9, 199034 St. Petersburg, Russia * Correspondence: [email protected] Abstract: Trace amine-associated receptors (TAAR) recognize organic compounds, including primary, secondary, and tertiary amines. The TAAR5 receptor is known to be involved in the olfactory sensing of innate socially relevant odors encoded by volatile amines. However, emerging data point to the involvement of TAAR5 in brain functions, particularly in the emotional behaviors mediated by the limbic system which suggests its potential contribution to the pathogenesis of neuropsychiatric diseases. TAAR5 expression was explored in datasets available in the Gene Expression Omnibus, Allen Brain Atlas, and Human Protein Atlas databases. Transcriptomic data demonstrate ubiquitous low TAAR5 expression in the cortical and limbic brain areas, the amygdala and the hippocampus, Citation: Vaganova, A.N.; the nucleus accumbens, the thalamus, the hypothalamus, the basal ganglia, the cerebellum, the Murtazina, R.Z.; Shemyakova, T.S.; substantia nigra, and the white matter. Altered TAAR5 expression is identiﬁed in Down syndrome, Prjibelski, A.D.; Katolikova, N.V.; Gainetdinov, R.R.
[Show full text]
Adenylyl Cyclase 2 Selectively Regulates IL-6 Expression in Human Bronchial Smooth Muscle Cells Amy Sue Bogard University of Tennessee Health Science Center
University of Tennessee Health Science Center UTHSC Digital Commons Theses and Dissertations (ETD) College of Graduate Health Sciences 12-2013 Adenylyl Cyclase 2 Selectively Regulates IL-6 Expression in Human Bronchial Smooth Muscle Cells Amy Sue Bogard University of Tennessee Health Science Center Follow this and additional works at: https://dc.uthsc.edu/dissertations Part of the Medical Cell Biology Commons, and the Medical Molecular Biology Commons Recommended Citation Bogard, Amy Sue , "Adenylyl Cyclase 2 Selectively Regulates IL-6 Expression in Human Bronchial Smooth Muscle Cells" (2013). Theses and Dissertations (ETD). Paper 330. http://dx.doi.org/10.21007/etd.cghs.2013.0029. This Dissertation is brought to you for free and open access by the College of Graduate Health Sciences at UTHSC Digital Commons. It has been accepted for inclusion in Theses and Dissertations (ETD) by an authorized administrator of UTHSC Digital Commons. For more information, please contact [email protected]. Adenylyl Cyclase 2 Selectively Regulates IL-6 Expression in Human Bronchial Smooth Muscle Cells Document Type Dissertation Degree Name Doctor of Philosophy (PhD) Program Biomedical Sciences Track Molecular Therapeutics and Cell Signaling Research Advisor Rennolds Ostrom, Ph.D. Committee Elizabeth Fitzpatrick, Ph.D. Edwards Park, Ph.D. Steven Tavalin, Ph.D. Christopher Waters, Ph.D. DOI 10.21007/etd.cghs.2013.0029 Comments Six month embargo expired June 2014 This dissertation is available at UTHSC Digital Commons: https://dc.uthsc.edu/dissertations/330 Adenylyl Cyclase 2 Selectively Regulates IL-6 Expression in Human Bronchial Smooth Muscle Cells A Dissertation Presented for The Graduate Studies Council The University of Tennessee Health Science Center In Partial Fulfillment Of the Requirements for the Degree Doctor of Philosophy From The University of Tennessee By Amy Sue Bogard December 2013 Copyright © 2013 by Amy Sue Bogard.
[Show full text]
The Origin and Molecular Evolution of Two Multigene Families: G-Protein Coupled Receptors and Glycoside Hydrolase Families
University of Nebraska - Lincoln DigitalCommons@University of Nebraska - Lincoln Dissertations and Theses in Biological Sciences Biological Sciences, School of Fall 9-25-2013 THE ORIGIN AND MOLECULAR EVOLUTION OF TWO MULTIGENE FAMILIES: G-PROTEIN COUPLED RECEPTORS AND GLYCOSIDE HYDROLASE FAMILIES Seong-il Eyun University of Nebraska - Lincoln, [email protected] Follow this and additional works at: https://digitalcommons.unl.edu/bioscidiss Part of the Bioinformatics Commons, and the Evolution Commons Eyun, Seong-il, "THE ORIGIN AND MOLECULAR EVOLUTION OF TWO MULTIGENE FAMILIES: G-PROTEIN COUPLED RECEPTORS AND GLYCOSIDE HYDROLASE FAMILIES" (2013). Dissertations and Theses in Biological Sciences. 57. https://digitalcommons.unl.edu/bioscidiss/57 This Article is brought to you for free and open access by the Biological Sciences, School of at DigitalCommons@University of Nebraska - Lincoln. It has been accepted for inclusion in Dissertations and Theses in Biological Sciences by an authorized administrator of DigitalCommons@University of Nebraska - Lincoln. THE ORIGIN AND MOLECULAR EVOLUTION OF TWO MULTIGENE FAMILIES: G- PROTEIN COUPLED RECEPTORS AND GLYCOSIDE HYDROLASE FAMILIES by Seong-il Eyun A DISSERTATION Presented to the Faculty of The Graduate College at the University of Nebraska In Partial Fulfillment of Requirements For the Degree of Doctor of Philosophy Major: Biological Sciences Under the Supervision of Professor Etsuko Moriyama Lincoln, Nebraska August, 2013 THE ORIGIN AND MOLECULAR EVOLUTION OF TWO MULTIGENE FAMILIES: G- PROTEIN COUPLED RECEPTORS AND GLYCOSIDE HYDROLASE FAMILIES Seong-il Eyun, Ph.D. University of Nebraska, 2013 Advisor: Etsuko Moriyama Multigene family is a group of genes that arose from a common ancestor by gene duplication. Gene duplications are a major driving force of new function acquisition.
[Show full text]
A Second Class of Chemosensory Receptors in the Olfactory Epithelium
Vol 442|10 August 2006|doi:10.1038/nature05066 ARTICLES A second class of chemosensory receptors in the olfactory epithelium Stephen D. Liberles1 & Linda B. Buck1 The mammalian olfactory system detects chemicals sensed as odours as well as social cues that stimulate innate responses. Odorants are detected in the nasal olfactory epithelium by the odorant receptor family, whose ,1,000 members allow the discrimination of a myriad of odorants. Here we report the discovery of a second family of receptors in the mouse olfactory epithelium. Genes encoding these receptors, called ‘trace amine-associated receptors’ (TAARs), are present in human, mouse and fish. Like odorant receptors, individual mouse TAARs are expressed in unique subsets of neurons dispersed in the epithelium. Notably, at least three mouse TAARs recognize volatile amines found in urine: one detects a compound linked to stress, whereas the other two detect compounds enriched in male versus female urine—one of which is reportedly a pheromone. The evolutionary conservation of the TAAR family suggests a chemosensory function distinct from odorant receptors. Ligands identified for TAARs thus far suggest a function associated with the detection of social cues. The first step in odour perception is the detection of odorants by G which we then used in real-time quantitative PCR (qPCR) reactions protein-coupled odorant receptors on olfactory sensory neurons with primers matching GPCRs not previously implicated in odour, (OSNs) in the nasal olfactory epithelium1–3. In response to odorants, pheromone or taste detection19. cDNAs encoding individual GPCRs OSNs transmit signals to the brain, thereby generating odour were quantified using standard curves obtained from qPCR reactions perceptions2,4.
[Show full text]
Genetic Polymorphisms Affect Mouse and Human Trace Amine-Associated Receptor 1 Function
RESEARCH ARTICLE Genetic Polymorphisms Affect Mouse and Human Trace Amine-Associated Receptor 1 Function Xiao Shi1,2,3, Nicole A. R. Walter1,3, John H. Harkness1,3, Kim A. Neve1,2,3, Robert W. Williams4,LuLu4,5, John K. Belknap1,2,3, Amy J. Eshleman1,3, Tamara J. Phillips1,2,3, Aaron Janowsky1,2,3,6* 1 Veterans Affairs Portland Health Care System, Portland, Oregon, United States of America, 2 The Methamphetamine Abuse Research Center, Oregon Health & Science University, Portland, Oregon, United a11111 States of America, 3 Department of Behavioral Neuroscience, Oregon Health & Science University, Portland, Oregon, United States of America, 4 Department of Genetics, Genomics and Informatics, University of Tennessee Health Science Center, Memphis, Tennessee, United States of America, 5 Jiangsu Key Laboratory of Neuroregeneration, Nantong University, Nantong, Jiangsu, China, 6 Department of Psychiatry, Oregon Health & Science University, Portland, Oregon, United States of America * [email protected] OPEN ACCESS Citation: Shi X, Walter NAR, Harkness JH, Neve KA, Abstract Williams RW, Lu L, et al. (2016) Genetic Polymorphisms Affect Mouse and Human Trace Methamphetamine (MA) and neurotransmitter precursors and metabolites such as tyra- Amine-Associated Receptor 1 Function. PLoS ONE β 11(3): e0152581. doi:10.1371/journal.pone.0152581 mine, octopamine, and -phenethylamine stimulate the G protein-coupled trace amine- associated receptor 1 (TAAR1). TAAR1 has been implicated in human conditions including Editor: Anuja Ghorpade, University of North Texas Health Science Center, UNITED STATES obesity, schizophrenia, depression, fibromyalgia, migraine, and addiction. Additionally TAAR1 is expressed on lymphocytes and astrocytes involved in inflammation and response Received: December 4, 2015 to infection.
[Show full text]