PET100 (NM 001171155) Human Tagged ORF Clone Product Data

Total Page:16

File Type:pdf, Size:1020Kb

Load more

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RG229497 PET100 (NM_001171155) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: PET100 (NM_001171155) Human Tagged ORF Clone Tag: TurboGFP Symbol: PET100 Synonyms: C19orf79; MC4DN12 Vector: pCMV6-AC-GFP (PS100010) E. coli Selection: Ampicillin (100 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RG229497 representing NM_001171155 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGGGGTGAAGCTGGAGATATTTCGGATGATAATCTACCTCACTTTCCCTGTGGCTATGTTCTGGGTTT CCAATCAGGCCGAGTGGTTTGAGGACGATGTCATACAGCGCAAGAGGGAGCTGTGGCCACCTGAGAAGCT TCAAGAGATAGAGGAATTCAAAGAGAGGTTACGGAAGCGGCGGGAGGAGAAGCTCCTTCGCGACGCCCAG CAGAACTCC ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA Protein Sequence: >RG229497 representing NM_001171155 Red=Cloning site Green=Tags(s) MGVKLEIFRMIIYLTFPVAMFWVSNQAEWFEDDVIQRKRELWPPEKLQEIEEFKERLRKRREEKLLRDAQ QNS TRTRPLE - GFP Tag - V Restriction Sites: SgfI-MluI This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 PET100 (NM_001171155) Human Tagged ORF Clone – RG229497 Cloning Scheme: Plasmid Map: ACCN: NM_001171155 ORF Size: 219 bp This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 PET100 (NM_001171155) Human Tagged ORF Clone – RG229497 OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_001171155.2 RefSeq Size: 349 bp RefSeq ORF: 222 bp Locus ID: 100131801 UniProt ID: P0DJ07 Gene Summary: Mitochondrial complex IV, or cytochrome c oxidase, is a large transmembrane protein complex that is part of the respiratory electron transport chain of mitochondria. The small protein encoded by this gene plays a role in the biogenesis of mitochondrial complex IV. This protein localizes to the inner mitochondrial membrane and is exposed to the intermembrane space. Mutations in this gene are associated with mitochondrial complex IV deficiency. This gene has a pseudogene on chromosome 3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014] This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3.
Recommended publications
  • Mackenzie's Mission Gene & Condition List

    Mackenzie's Mission Gene & Condition List

    Mackenzie’s Mission Gene & Condition List What conditions are being screened for in Mackenzie’s Mission? Genetic carrier screening offered through this research study has been carefully developed. It is focused on providing people with information about their chance of having children with a severe genetic condition occurring in childhood. The screening is designed to provide genetic information that is relevant and useful, and to minimise uncertain and unclear information. How the conditions and genes are selected The Mackenzie’s Mission reproductive genetic carrier screen currently includes approximately 1300 genes which are associated with about 750 conditions. The reason there are fewer conditions than genes is that some genetic conditions can be caused by changes in more than one gene. The gene list is reviewed regularly. To select the conditions and genes to be screened, a committee comprised of experts in genetics and screening was established including: clinical geneticists, genetic scientists, a genetic pathologist, genetic counsellors, an ethicist and a parent of a child with a genetic condition. The following criteria were developed and are used to select the genes to be included: • Screening the gene is technically possible using currently available technology • The gene is known to cause a genetic condition • The condition affects people in childhood • The condition has a serious impact on a person’s quality of life and/or is life-limiting o For many of the conditions there is no treatment or the treatment is very burdensome for the child and their family. For some conditions very early diagnosis and treatment can make a difference for the child.
  • Rcf2 Revealed in Cryo-EM Structures of Hypoxic Isoforms of Mature Mitochondrial III-IV Supercomplexes

    Rcf2 Revealed in Cryo-EM Structures of Hypoxic Isoforms of Mature Mitochondrial III-IV Supercomplexes

    Rcf2 revealed in cryo-EM structures of hypoxic isoforms of mature mitochondrial III-IV supercomplexes Andrew M. Hartleya, Brigitte Meunierb, Nikos Pinotsisa, and Amandine Maréchala,c,1 aInstitute of Structural and Molecular Biology, Birkbeck College, WC1E 7HX London, United Kingdom; bInstitute for Integrative Biology of the Cell (I2BC), CNRS, Commissariat à l’Énergie Atomique et aux Énergies Alternatives, Université Paris-Saclay, 91198 Gif-sur-Yvette, France; and cInstitute of Structural and Molecular Biology, University College London, WC1E 6BT London, United Kingdom Edited by Harry B. Gray, California Institute of Technology, Pasadena, CA, and approved March 12, 2020 (received for review November 25, 2019) The organization of the mitochondrial electron transport chain formed by CI, III, and IV in varying stoichiometries (11–14) and I– proteins into supercomplexes (SCs) is now undisputed; however, III2 SCs (11, 14). Overall, they reveal a conserved arrangement of their assembly process, or the role of differential expression CI and CIII across species, including strong protein–protein inter- isoforms, remain to be determined. In Saccharomyces cerevisiae, actions. Slightly different orientationsofCIIIrelativetoCIwithin cytochrome c oxidase (CIV) forms SCs of varying stoichiometry the respirasome have been reported that have been linked to in- bc with cytochrome 1 (CIII). Recent studies have revealed, in stability of the SC during the purification procedure, although the normoxic growth conditions, an interface made exclusively by possibility of a subpopulation of respirasomes in which CI is in the Cox5A, the only yeast respiratory protein that exists as one of deactivated state could not be excluded (9, 14). However, when two isoforms depending on oxygen levels.
  • Directional TOPO® Expression Kits

    Directional TOPO® Expression Kits

    Champion™ pET Directional TOPO® Expression Kits Five-minute, directional TOPO® Cloning of blunt-end PCR products into vectors for high-level, inducible expression in E. coli Catalog nos. K100-01, K101-01, K102-01, K151- 01, K200-01 Rev. Date 7 June 2010 Manual part no. 25-0400 MAN0000214 User Manual ii Table of Contents TOPO® Cloning Procedure for Experienced Users .......................................................................................... v Kit Contents and Storage.................................................................................................................................... vi Accessory Products................................................................................................................................................x Introduction ................................................................................................................... 1 Overview.................................................................................................................................................................1 How Directional TOPO® Cloning Works ...........................................................................................................3 T7-Regulated Expression......................................................................................................................................4 BL21 Star™ E. coli Strains.......................................................................................................................................6 Thioredoxin
  • Regulation of COX Assembly and Function by Twin CX9C Proteins—Implications for Human Disease

    Regulation of COX Assembly and Function by Twin CX9C Proteins—Implications for Human Disease

    cells Review Regulation of COX Assembly and Function by Twin CX9C Proteins—Implications for Human Disease Stephanie Gladyck 1, Siddhesh Aras 1,2, Maik Hüttemann 1 and Lawrence I. Grossman 1,2,* 1 Center for Molecular Medicine and Genetics, Wayne State University School of Medicine, Detroit, MI 48201, USA; [email protected] (S.G.); [email protected] (S.A.); [email protected] (M.H.) 2 Perinatology Research Branch, Division of Obstetrics and Maternal-Fetal Medicine, Division of Intramural Research, Eunice Kennedy Shriver National Institute of Child Health and Human Development, National Institutes of Health, U.S. Department of Health and Human Services, Bethesda, Maryland and Detroit, MI 48201, USA * Correspondence: [email protected] Abstract: Oxidative phosphorylation is a tightly regulated process in mammals that takes place in and across the inner mitochondrial membrane and consists of the electron transport chain and ATP synthase. Complex IV, or cytochrome c oxidase (COX), is the terminal enzyme of the electron transport chain, responsible for accepting electrons from cytochrome c, pumping protons to contribute to the gradient utilized by ATP synthase to produce ATP, and reducing oxygen to water. As such, COX is tightly regulated through numerous mechanisms including protein–protein interactions. The twin CX9C family of proteins has recently been shown to be involved in COX regulation by assisting with complex assembly, biogenesis, and activity. The twin CX9C motif allows for the import of these proteins into the intermembrane space of the mitochondria using the redox import machinery of Mia40/CHCHD4. Studies have shown that knockdown of the proteins discussed in this review results in decreased or completely deficient aerobic respiration in experimental models ranging from yeast to human cells, as the proteins are conserved across species.
  • Role of Cytochrome C Oxidase Nuclear-Encoded Subunits in Health and Disease

    Role of Cytochrome C Oxidase Nuclear-Encoded Subunits in Health and Disease

    Physiol. Res. 69: 947-965, 2020 https://doi.org/10.33549/physiolres.934446 REVIEW Role of Cytochrome c Oxidase Nuclear-Encoded Subunits in Health and Disease Kristýna ČUNÁTOVÁ1, David PAJUELO REGUERA1, Josef HOUŠTĚK1, Tomáš MRÁČEK1, Petr PECINA1 1Department of Bioenergetics, Institute of Physiology, Czech Academy of Sciences, Prague, Czech Republic Received February 2, 2020 Accepted September 13, 2020 Epub Ahead of Print November 2, 2020 Summary [email protected] and Tomáš Mráček, Department of Cytochrome c oxidase (COX), the terminal enzyme of Bioenergetics, Institute of Physiology CAS, Vídeňská 1083, 142 mitochondrial electron transport chain, couples electron transport 20 Prague 4, Czech Republic. E-mail: [email protected] to oxygen with generation of proton gradient indispensable for the production of vast majority of ATP molecules in mammalian Cytochrome c oxidase cells. The review summarizes current knowledge of COX structure and function of nuclear-encoded COX subunits, which may Energy demands of mammalian cells are mainly modulate enzyme activity according to various conditions. covered by ATP synthesis carried out by oxidative Moreover, some nuclear-encoded subunits possess tissue-specific phosphorylation apparatus (OXPHOS) located in the and development-specific isoforms, possibly enabling fine-tuning central bioenergetic organelle, mitochondria. OXPHOS is of COX function in individual tissues. The importance of nuclear- composed of five multi-subunit complexes embedded in encoded subunits is emphasized by recently discovered the inner mitochondrial membrane (IMM). Electron pathogenic mutations in patients with severe mitopathies. In transport from reduced substrates of complexes I and II to addition, proteins substoichiometrically associated with COX were cytochrome c oxidase (COX, complex IV, CIV) is found to contribute to COX activity regulation and stabilization of achieved by increasing redox potential of individual the respiratory supercomplexes.
  • Pet Directional TOPO® Expression Kits

    Pet Directional TOPO® Expression Kits

    Champion™ pET Directional TOPO® Expression Kits Five-minute, directional TOPO® Cloning of blunt-end PCR products into vectors for high-level, inducible expression in E. coli Catalog nos. K100-01, K101-01, K102-01, K151- 01, K200-01 Rev. Date 7 June 2010 Manual part no. 25-0400 MAN0000214 User Manual ii Table of Contents TOPO® Cloning Procedure for Experienced Users .......................................................................................... v Kit Contents and Storage.................................................................................................................................... vi Accessory Products................................................................................................................................................x Introduction ................................................................................................................... 1 Overview.................................................................................................................................................................1 How Directional TOPO® Cloning Works ...........................................................................................................3 T7-Regulated Expression......................................................................................................................................4 BL21 Star™ E. coli Strains.......................................................................................................................................6 Thioredoxin
  • Mitochondrial Structure and Bioenergetics in Normal and Disease Conditions

    Mitochondrial Structure and Bioenergetics in Normal and Disease Conditions

    International Journal of Molecular Sciences Review Mitochondrial Structure and Bioenergetics in Normal and Disease Conditions Margherita Protasoni 1 and Massimo Zeviani 1,2,* 1 Mitochondrial Biology Unit, The MRC and University of Cambridge, Cambridge CB2 0XY, UK; [email protected] 2 Department of Neurosciences, University of Padova, 35128 Padova, Italy * Correspondence: [email protected] Abstract: Mitochondria are ubiquitous intracellular organelles found in almost all eukaryotes and involved in various aspects of cellular life, with a primary role in energy production. The interest in this organelle has grown stronger with the discovery of their link to various pathologies, including cancer, aging and neurodegenerative diseases. Indeed, dysfunctional mitochondria cannot provide the required energy to tissues with a high-energy demand, such as heart, brain and muscles, leading to a large spectrum of clinical phenotypes. Mitochondrial defects are at the origin of a group of clinically heterogeneous pathologies, called mitochondrial diseases, with an incidence of 1 in 5000 live births. Primary mitochondrial diseases are associated with genetic mutations both in nuclear and mitochondrial DNA (mtDNA), affecting genes involved in every aspect of the organelle function. As a consequence, it is difficult to find a common cause for mitochondrial diseases and, subsequently, to offer a precise clinical definition of the pathology. Moreover, the complexity of this condition makes it challenging to identify possible therapies or drug targets. Keywords: ATP production; biogenesis of the respiratory chain; mitochondrial disease; mi-tochondrial electrochemical gradient; mitochondrial potential; mitochondrial proton pumping; mitochondrial respiratory chain; oxidative phosphorylation; respiratory complex; respiratory supercomplex Citation: Protasoni, M.; Zeviani, M.
  • High-Resolution, Genome-Wide Mapping of Positive Supercoiling in Chromosomes Monica S Guo1†*, Ryo Kawamura2, Megan L Littlehale1, John F Marko2,3, Michael T Laub1,4*

    High-Resolution, Genome-Wide Mapping of Positive Supercoiling in Chromosomes Monica S Guo1†*, Ryo Kawamura2, Megan L Littlehale1, John F Marko2,3, Michael T Laub1,4*

    RESEARCH ARTICLE High-resolution, genome-wide mapping of positive supercoiling in chromosomes Monica S Guo1†*, Ryo Kawamura2, Megan L Littlehale1, John F Marko2,3, Michael T Laub1,4* 1Department of Biology, Massachusetts Institute of Technology, Cambridge, United States; 2Department of Molecular Biosciences, Northwestern University, Evanston, United States; 3Department of Physics and Astronomy, Northwestern University, Evanston, United States; 4Howard Hughes Medical Institute, Massachusetts Institute of Technology, Cambridge, United States Abstract Supercoiling impacts DNA replication, transcription, protein binding to DNA, and the three-dimensional organization of chromosomes. However, there are currently no methods to directly interrogate or map positive supercoils, so their distribution in genomes remains unknown. Here, we describe a method, GapR-seq, based on the chromatin immunoprecipitation of GapR, a bacterial protein that preferentially recognizes overtwisted DNA, for generating high-resolution maps of positive supercoiling. Applying this method to Escherichia coli and Saccharomyces cerevisiae, we find that positive supercoiling is widespread, associated with transcription, and particularly enriched between convergently oriented genes, consistent with the ‘twin-domain’ model of supercoiling. In yeast, we also find positive supercoils associated with centromeres, *For correspondence: cohesin-binding sites, autonomously replicating sites, and the borders of R-loops (DNA-RNA [email protected] (MSG); hybrids). Our results suggest that GapR-seq is a powerful approach, likely applicable in any [email protected] (MTL) organism, to investigate aspects of chromosome structure and organization not accessible by Hi-C or other existing methods. Present address: †Department of Microbiology, University of Washington School of Medicine, Seattle, United States Introduction Competing interest: See The DNA inside every cell can adopt a wide range of topologies.
  • Underexpression of HOXA11 Is Associated with Treatment Resistance and Poor Prognosis in Glioblastoma

    Underexpression of HOXA11 Is Associated with Treatment Resistance and Poor Prognosis in Glioblastoma

    pISSN 1598-2998, eISSN 2005-9256 Cancer Res Treat. 2017;49(2):387-398 https://doi.org/10.4143/crt.2016.106 Original Article Open Access Underexpression of HOXA11 Is Associated with Treatment Resistance and Poor Prognosis in Glioblastoma Young-Bem Se, MD1 Purpose Seung Hyun Kim, MD2 Homeobox (HOX) genes are essential developmental regulators that should normally be in the silenced state in an adult brain. The aberrant expression of HOX genes has been asso- Ji Young Kim, MS1 ciated with the prognosis of many cancer types, including glioblastoma (GBM). This study PhD1 Ja Eun Kim, examined the identity and role of HOX genes affecting GBM prognosis and treatment 1 Yun-Sik Dho, MD resistance. Jin Wook Kim, MD, PhD1 Yong Hwy Kim, MD1 Materials and Methods The full series of HOX genes of five pairs of initial and recurrent human GBM samples were Hyun Goo Woo, MD, PhD3 screened by microarray analysis to determine the most plausible candidate responsible for MD, PhD4 Se-Hyuk Kim, GBM prognosis. Another 20 newly diagnosed GBM samples were used for prognostic vali- 5 Shin-Hyuk Kang, MD, PhD dation. In vitro experiments were performed to confirm the role of HOX in treatment resist- 6 Hak Jae Kim, MD, PhD ance. Mediators involved in HOX gene regulation were searched using differentially Tae Min Kim, MD, PhD7 expressed gene analysis, gene set enrichment tests, and network analysis. Soon-Tae Lee, MD, PhD8 Results MD, PhD9 Seung Hong Choi, The underexpression of HOXA11 was identified as a consistent signature for a poor prog- 10 Sung-Hye Park, MD, PhD nosis among the HOX genes.
  • Cytochrome C Oxidase Deficiency

    Cytochrome C Oxidase Deficiency

    Cytochrome c oxidase deficiency Description Cytochrome c oxidase deficiency is a genetic condition that can affect several parts of the body, including the muscles used for movement (skeletal muscles), the heart, the brain, or the liver. Signs and symptoms of cytochrome c oxidase deficiency usually begin before age 2 but can appear later in mildly affected individuals. The severity of cytochrome c oxidase deficiency varies widely among affected individuals, even among those in the same family. People who are mildly affected tend to have muscle weakness (myopathy) and poor muscle tone (hypotonia) with no other related health problems. More severely affected people have problems in multiple body systems, often including severe brain dysfunction (encephalomyopathy). Approximately one-quarter of individuals with cytochrome c oxidase deficiency have a type of heart disease that enlarges and weakens the heart muscle (hypertrophic cardiomyopathy). Another possible feature of this condition is an enlarged liver (hepatomegaly), which may lead to liver failure. Most individuals with cytochrome c oxidase deficiency have a buildup of a chemical called lactic acid in the body (lactic acidosis), which can cause nausea and an irregular heart rate, and can be life-threatening. Many people with cytochrome c oxidase deficiency have a specific group of features known as Leigh syndrome. The signs and symptoms of Leigh syndrome include loss of mental function, movement problems, hypertrophic cardiomyopathy, eating difficulties, and brain abnormalities. Cytochrome c oxidase deficiency is one of the many causes of Leigh syndrome. Many individuals with cytochrome c oxidase deficiency do not survive past childhood, although some individuals with mild signs and symptoms live into adolescence or adulthood.
  • Functions of Cytochrome C Oxidase Assembly Factors

    Functions of Cytochrome C Oxidase Assembly Factors

    International Journal of Molecular Sciences Review Functions of Cytochrome c Oxidase Assembly Factors Shane A. Watson and Gavin P. McStay * Department of Biological Sciences, Faculty of School of Life Sciences and Education, Staffordshire University, Science Centre, Leek Road, Stoke-on-Trent ST4 2DF, UK; [email protected]ffs.ac.uk * Correspondence: gavin.mcstay@staffs.ac.uk; Tel.: +44-01782-295741 Received: 17 September 2020; Accepted: 23 September 2020; Published: 30 September 2020 Abstract: Cytochrome c oxidase is the terminal complex of eukaryotic oxidative phosphorylation in mitochondria. This process couples the reduction of electron carriers during metabolism to the reduction of molecular oxygen to water and translocation of protons from the internal mitochondrial matrix to the inter-membrane space. The electrochemical gradient formed is used to generate chemical energy in the form of adenosine triphosphate to power vital cellular processes. Cytochrome c oxidase and most oxidative phosphorylation complexes are the product of the nuclear and mitochondrial genomes. This poses a series of topological and temporal steps that must be completed to ensure efficient assembly of the functional enzyme. Many assembly factors have evolved to perform these steps for insertion of protein into the inner mitochondrial membrane, maturation of the polypeptide, incorporation of co-factors and prosthetic groups and to regulate this process. Much of the information about each of these assembly factors has been gleaned from use of the single cell eukaryote Saccharomyces cerevisiae and also mutations responsible for human disease. This review will focus on the assembly factors of cytochrome c oxidase to highlight some of the outstanding questions in the assembly of this vital enzyme complex.
  • Clinical and Genetic Studies in Paediatric Mitochondrial Disease

    Clinical and Genetic Studies in Paediatric Mitochondrial Disease

    Clinical and Genetic Studies in Paediatric Mitochondrial Disease Yehani N.G.G. Wedatilake Genetics and Genomic Medicine Programme UCL Great Ormond Street Institute of Child Health University College London January 2017 A thesis submitted for the degree of Doctor of Philosophy awarded by University College London 1 Declaration I, Yehani N.G.G Wedatilake, confirm that the work presented in this thesis is my own. Where information has been derived from other sources, I confirm that this has been indicated in the thesis. Signed ______________________________________________________________ 2 Abstract Paediatric mitochondrial disease is a clinically and genetically heterogeneous group of disorders. Prior to the advent of next generation sequencing, many patients did not receive a genetic diagnosis. Genetic diagnosis is important for prognostication and prenatal diagnosis. The aim of this thesis was to study the genetic aetiology of paediatric mitochondrial disease. Paediatric patients with suspected mitochondrial disease were grouped to facilitate studying the genetic aetiology. This included grouping patients by respiratory chain enzyme deficiency, by affected end-organ type (cardiomyopathy) or by collectively investigating patients presenting with a similar, genetically undefined clinical syndrome. Whole exome sequencing (WES) was used to investigate genetic causes in patients with suspected mitochondrial disease associated with cytochrome c oxidase (COX) deficiency. In another paediatric cohort with mitochondrial cardiomyopathy, mitochondrial DNA sequencing, candidate gene sequencing or WES were used to identify genetic causes. Two families with a unique syndrome (febrile episodes, sideroblastic anaemia and immunodeficiency) were investigated using WES or homozygosity mapping. Candidate genes were functionally evaluated including the use of animal models. Furthermore a natural history study was performed in a monogenic mitochondrial disease (SURF1 deficiency) using clinical data from 12 centres.