PET100 (NM 001171155) Human Tagged ORF Clone Product Data

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RG229497

PET100 (NM_001171155) Human Tagged ORF Clone Product data:

Product Type: Expression Plasmids Product Name: PET100 (NM_001171155) Human Tagged ORF Clone Tag: TurboGFP Symbol: PET100 Synonyms: C19orf79; MC4DN12 Vector: pCMV6-AC-GFP (PS100010) E. coli Selection: Ampicillin (100 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RG229497 representing NM_001171155 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC

ATGGGGGTGAAGCTGGAGATATTTCGGATGATAATCTACCTCACTTTCCCTGTGGCTATGTTCTGGGTTT CCAATCAGGCCGAGTGGTTTGAGGACGATGTCATACAGCGCAAGAGGGAGCTGTGGCCACCTGAGAAGCT TCAAGAGATAGAGGAATTCAAAGAGAGGTTACGGAAGCGGCGGGAGGAGAAGCTCCTTCGCGACGCCCAG CAGAACTCC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA Protein Sequence: >RG229497 representing NM_001171155 Red=Cloning site Green=Tags(s)

MGVKLEIFRMIIYLTFPVAMFWVSNQAEWFEDDVIQRKRELWPPEKLQEIEEFKERLRKRREEKLLRDAQ QNS

TRTRPLE - GFP Tag - V Restriction Sites: SgfI-MluI

This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 PET100 (NM_001171155) Human Tagged ORF Clone – RG229497

Cloning Scheme:

Plasmid Map:

ACCN: NM_001171155 ORF Size: 219 bp

This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 PET100 (NM_001171155) Human Tagged ORF Clone – RG229497

OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_001171155.2 RefSeq Size: 349 bp RefSeq ORF: 222 bp Locus ID: 100131801 UniProt ID: P0DJ07 Gene Summary: Mitochondrial complex IV, or cytochrome c oxidase, is a large transmembrane protein complex that is part of the respiratory electron transport chain of mitochondria. The small protein encoded by this gene plays a role in the biogenesis of mitochondrial complex IV. This protein localizes to the inner mitochondrial membrane and is exposed to the intermembrane space. Mutations in this gene are associated with mitochondrial complex IV deficiency. This gene has a pseudogene on chromosome 3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014]