AND the HEALTH of OUR BANKS When I Received the Invita

Total Page:16

File Type:pdf, Size:1020Kb

AND the HEALTH of OUR BANKS When I Received the Invita The State of Nigeria, May 2010 – By Bashorun J. K. Randle THE STATE OF OUR STATE; THE STATE OF OUR NATION; THE STATE OF OUR HEALTH; AND THE HEALTH OF OUR BANKS By BASHORUN J.K. RANDLE, OFR When I received the invitation to be the Chairman of this most auspicious occasion I treated the matter with healthy suspicion because I have serious reservations about my credentials regarding health (and by extension medical) matters. It was my grandfather Dr. J.K. Randle who was one of Nigeria’s pioneer medical doctors having qualified at Edinburgh University, Scotland where he won the Gold Medal for surgery in 1888 and practiced for many years at his mansion cum surgery at 31 Marina, Lagos and an annex that was actually his back garden which stretched all the way to Broad Street. He died in 1928 at the age of 73. What is relevant is that much of his life was devoted to public health, public service and philanthropy. Perhaps I should add that he also founded Nigeria’s first political party – The People’s Union in 1908!! My first choice as the topic for my address was : “WHEN WILL THE PAIN CEASE ?” Because many of the challenges we are still grappling with were very much in evidence when my grandfather practised medicine. Granted that the scourge in my grandfather’s generation was the “Black Death” – fierce and lethal combination of scurvy; malaria; water-borne infections; jaundice etc. the “Black Death” is still very much with us. The only difference is that both the symptoms and the cure have found hibernation and manifestation in: • Cancer • Heart / Cardio-vascular diseases • Diabetes • HIV / AIDs Those of you who are more clinically minded would no doubt insist that special mention must be made of prostrate cancer which has been ravaging the Black male adult population in Africa and the diaspora with ruthless and relentless savagery. Perhaps I should add what has been widely reported on the internet: “Nigeria’s Minister of Women Affairs and Social Development, Mrs. Salamatu Hussaini (who is a Chartered Accountant) has raised the alarm over the rate of infant and maternal mortality in the country. Speaking during her two-day advocacy to Ondo State, the Minister who spoke in Akure, blamed inadequate health facilities, non-incentives for health personnel, ignorance and cultural taboos for the situation. She said: “Nigeria has one of the highest maternal mortal rate with about 800 to 1500 per 100,000 live births, which contributes 10 per cent of the world’s maternal deaths. By implication, every 10 minutes, a woman dies from pregnancy related complications in Nigeria with high prevalence in the rural areas. Infact mortality is also high at 105 lives per (1000) births (sic) with under-give mortality rate at 178 per 1000.” I am a Chartered Accountant like the Minister who has provided us with those chilling statistics. One of the kernels of our profession is that figures do not lie. Unlike doctors, we do not have the self-indulgence of burying our mistakes!!. At this juncture, I would like to seize this opportunity to thank the Governor of Lagos State, Mr. Babatunde Raji Fashola S.A.N. for re-naming the Randle General Hospital at Randle Road, Surulere after my late father Chief J.K. Randle, Lisa of Lagos who died on 17 th December 1956 at the age of only 47. If he were still alive, he would have been celebrating his 100 th birthday alongside his friends Chief Obafemi Awolowo, the first Premier of Western Nigeria; and Alhaji Ahmadu The State of Nigeria, May 2010 – By Bashorun J. K. Randle Bello, the Sarduana of Sokoto and the First Premier of Northern Nigeria. My father’s involvement with the health sector was largely influenced by the selfless and patriotic contributions of his close friends – Chief (Dr.) M.A. Majekodunmi who became Minister of Health under Sir Abubakar Tafawa Balewa and is still full of vigour at the ripe old age of 93; as well as late Dr. Oladele Ajose; Dr. Oni Akerele; Dr. Flavious Abiola Akerele; Dr. (Mrs.) Abimbola Awoliyi; and Dr. “Joki” Taylor-Cole (who delivered me!) The list would not be complete without mention of Sir Kofo Abayomi; Dr. Charles Norman-Williams and Sir Samuel Manuwa whose greatness and scholarship were acknowledge beyond the shores of Nigeria. My own involvement with medicine and health policy or delivery of healthcare/services are somewhat limited and circumspect. I rely on the testimony of my elder brother and friend, the quietly spoken Dr. Gabi Williams who served with great distinction as the Chief Medical Officer of Lagos before shifting his allegiance to the Federal Government where he served under the inimitable Professor Olikoye Ransome Kuti. I stand to be corrected, but I vividly recall that it used to be the practice that the Chief Medical Officer was obliged to publish an annual report on Lagos for wide circulation. Indeed, I used to read Dr. Gabi Williams’ report with great interest. Sadly, those reports have gone into oblivion like most of the best things in Lagos!! Let me digress by recalling that about three years ago, at a London Restaurant, Professor Bolaji Kuti; Dr. Bolaji Ajenifuja; Alhaji Femi Okunnu S.A.N; and I spent an entire evening discussing the problems and challenges of Lagos; and how our beloved city of Lagos was being stripped of dignity and sanctity (of life and property). We talked far into the night and I walked all the way home – Knightsbridge; Sloane Street, King’s Road etc without the slightest concern for my safety even though it was well past midnight. It brought back fond memories of what Lagos used to be – clean streets; peaceful environment, well equipped hospitals; silent vehicular traffic; constant electricity supply; law-abiding citizens and most significantly a total absence of any sense of danger as one walked along the waterfront from Ebute Elefun, Okesuna (where I went to school, Lagos Government School), all along the foreshore of Isale-Eko and the option of turning into Ebute Ero followed by the Marina all the way to Cowrie Bridge and ultimately the Bar Beach. You could even trek all the way to Ebute Metta, Yaba and beyond. Since the Governor of Lagos State is an old boy of Igbobi College, permit me to add that Igbobi was not considered part of Lagos. As its name confirms –“Igbo Obi” translates as The Cola nut forest” – in the outer wilds of civilization!! The ultimate irony is that it is not King’s College which is located right in the centre of Lagos, at the Race Course now known as Tafawa Balewa Square, that has produced an outstanding leader in the person of Governor Babatunde Raji Fashola S.A.N. That honour belongs to Igbobi College. For the avoidance of doubt (to quote lawyers) it bears repetition that “Igbobi” was forest !! Thankfully, the Governor’s DNA confirms that he was already a Lagosian, going by his Fashola / Animashaun antecedents before wandering into the forest. It is all in the genes and pedigree. This is not the appropriate forum for delving into what strange diet and concoctions young Babatunde was forced to consume in order to survive in the jungle or forest. We can only speculate that at regular intervals his diet was supplemented with the staple food of Lagos – “Agbodo” (fish); “Akan” (crab); “Yoyo” (whitebait); “ede” (prawns); “epa” (groundnuts); “guguru” (popcorn); “agbado” (boiled/roasted corn); “boli” (roasted plantain); etc. Perhaps we should add “ice pokey-pokey” which defies translation. Published with permission on www.proshareng.com 2 The State of Nigeria, May 2010 – By Bashorun J. K. Randle Anyway, you must forgive me for adhering to the tradition of Lagos. Our culture does not permit or take kindly to gratuitous praise-singing or self-serving adulation of those who are in power. As “sons of the soil” we are not permitted to curry favours or reduce ourselves to court- jesters, opportunists or sycophants. Regardless, Governor Fashola’s record particularly in the health sector speaks for itself. With vigour and tenacity of purpose he has been tackling most of those issues which Professor Bolaji Kuti; Dr. Bolaji Ajenifuja; Alhaji Femi Okunnu S.A.N. and I agonized over that long night of anguish which almost ruined our enjoyment of our dinner in a Chinese Restaurant in London - “The Good Earth.” Indeed, Lagos is slowly returning to “The Good Earth” – the paradise on earth which the Almighty divinely bequeathed to our ancestors who in turn handed it to us for safe custody until our own children are ready to take over. Somehow along the way or down the line the soldiers and politicians conspired to turn our beloved haven of peace and tranquility into hostage territory where fear and pain reign supreme - and a sanctuary for criminals who are hell bent on intimidation, rage and vengeance against innocent citizens. They claim that democracy is a game of numbers – hence the criminals are free to overwhelm the shrinking number of Lagosians. Lest I be accused, by lawyers, of suppression of vital information and even obstruction of justice, I am obliged to direct your attention to the internet website; “Omo eko pataki www.com where the record of Governor Fashola’s interventions in the health sector are listed as follows: (1) LAGOS STATE MINISTRY OF HEALTH PRIMARY HEALTH CARE 1. Upgrade of Primary Health Care facilities in all the Local Government Areas / Wards in the State. 2. Introduction of Mobile Clinics. • Mobile Dental Clinics • Medical Clinics. (2) SECONDARY HEALTH CARE 1. Refurbishment and re-equipment of all the General Hospitals in the State.
Recommended publications
  • Inclusive Banking: Where
    21st September, 2020 DAILY NEWSLETTER Text PHOTO NEWS FROM THE FIRST SESSION AT THE 13TH ANNUAL BANKING AND FINANCE CONFERENCE WITH THEME "INCLUSIVE BANKING: WHERE WE ARE AND THE WAY FORWARD" CHAIRED BY OTUNBA FEMI PEDRO, FCIB, FORMER DEPUTY GOVERNOR, LAGOS STATE & CHAIRMAN, SMALL AND MEDIUM ENTERPRISE DEVELOPMENT AGENCY OF NIGERIA (SMEDAN) WHICH HELD ON TUESDAY, SEPTEMBER 15, 2020. PHOTO NEWS FROM THE CIBN STAKEHOLDERS ENGAGEMENT VISIT TO MALAM NURA DAURA, AG. MANAGING DIRECTOR/CEO & EDITOR IN CHIEF, DAILY TRUST NEWSPAPER (MEDIA TRUST LIMITED) IN ABUJA WHICH HELD ON TUESDAY, SEPTEMBER 15, 2020. FINANCE NEWS CBN sees $29.9b to CBN probes 71 for World Bank targets $34.3b reserves by suspected forex deals green, resilient year-end economic growth in THE Central Bank of The Central Bank of Nigeria Nigeria (CBN) has Africa (CBN) at the weekend said launched a massive investigation into foreign The World Bank Group the degree of external exchange transactions by yesterday released the reserves accumulation 71 companies after Next Generation Africa Climate Business Plan would drop as outflows are preliminary reviews raised suspicions of possible (NG-ACBP), which sets out expected to outweigh infractions and a blueprint to help Sub- inflows in the remaining contravention of extant Saharan African (SSA) economies achieve a low part of this year. foreign exchange laws and rules. carbon, and climate- resilient outcomes.. Read More + Read More + Read More + Foreign reserves rise Lender seeks DPR: $1.5 billion by $140.9m, now impactful role in World
    [Show full text]
  • Finar Brochure Design for 2020 Banking & Finance
    THE CHARTERED INSTITUTE OF BANKERS OF NIGERIA Theme: Facilitating a Sustainable Future: The Role of Banking and Finance September 15 – 16, 2020 THE BANKERS CREED Hugh McCulloch's Advice to Bankers of 1863 (Hugh McCulloch (1808 – 1895) was an American Banker who helped launch the American National Banking System and was Secretary of the Treasury during the civil war and reconstruction) t upon the payment of all papers at stakeholders THE CHARTERED INSTITUTE OF BANKERS OF NIGERIA PC 19, Adeola Hopewell Street, Victoria Island, Lagos . @ www.cibng.org cibnigeria cibnigeria cibnigeria cibngorg theCIBN cibnigeria CIBN ANTHEM Verse 1 C-I-B-N Chartered Institute of Bankers of Nigeria The Bankers' guiding light It's the Nation's joy and pride We aim for Integrity in the Industry Upholding Ethics and Professionalism Great! Great CIBN Citadel of Excellence Great! Great CIBN Built on Trust and Honesty Verse 1 C-I-B-N Chartered Institute of Bankers of Nigeria The wheel of economic growth Competency is our goal Creating value and building capacity Fostering confidence in the industry Great! Great! CIBN The Bankers' guiding light Great! Great! CIBN Built on Trust and Honesty 3 THE CHARTERED INSTITUTE OF BANKERS OF NIGERIA Vision To be a global reference point for skills and conduct in the banking and finance industry Core Values Integrity Professionalism Innovation Ethics Objectives 5 Distinguished Guest of Honour His Excellency President Muhammadu Buhari, GCFR President & Commander-in-Chief of the Armed Forces, Federal Republic of Nigeria 7 Special Guest of Honour His Excellency President Nana Addo Dankwa Akufo-Addo President of the Republic of Ghana 8 Guest of Honour His Excellency Senator Ahmad Lawan Senate President of the Federal Republic of Nigeria 9 Guest of Honour Hon.
    [Show full text]
  • 1 September 2008 Reporters Without
    1 September 2008 Reporters Without Borders Contact: Jean-François Julliard Tel: (33) 1 4483-8484 E-mail: [email protected] Language: English Human Rights Council – Universal Periodic Review Fourth session – February 2009 Contribution of Reporters Without Borders (a non-governmental organisation in special consultative status) about press freedom in NIGERIA Introduction: Overview of press freedom situation A complex jigsaw on the scale of a continent, the federal state of Nigeria is often a violent place for the press. They suffer frequent beatings, unfair arrests, police raids and seizures both in the provinces and in Abuja. But, paradoxically, the 36 states and its federal district are also a boom area for scores of privately-owned newspapers, radio and television stations, which take delight in revealing the immorality of a corrupt and capricious political class. And as a result run the risks of Nigerians the government considers to be too disrespectful. The federal government often relies on the feared internal intelligence, the State Security Service (SSS). Provider of the government’s brutal shock tactics, the SSS was once again this year condemned by Reporters Without Borders as a “press freedom predator”, a designation which it has held since 2005. The SSS which preys on the media is not the only group perpetrating almost daily brutality against Nigerian journalists. Over-excited groups of political militants, the many uniformed corps in the country and governors’ private militias also represent a threat to the world of the press, from publication directors down to news vendors, particularly in the provinces. The West African giant rejoices in a privately-owned, plentiful and irreverent press, eager to expose the intrigues of an often corrupt political class.
    [Show full text]
  • Opening Remarks by Uche Olowu, Ph.D., Fcib President
    OPENING REMARKS BY UCHE OLOWU, PH.D., FCIB PRESIDENT/CHAIRMAN OF COUNCIL, THE CHARTERED INSTITUTE OF BANKERS OF NIGERIA AT THE 2019 ENTREPRENEURSHIP DEVELOPMENT PROGRAMME (EDP)/PUBLIC PRESENTATION OF PRACTICE LICENSES HELD WEDNESDAY, DECEMEBR 4, 2019 AT THE BANKERS HOUSE, VICTORIA ISLAND, LAGOS Protocols Distinguished Guests, Ladies and gentlemen, it is my singular honor to officially declare open the 2019 Entrepreneurship Development Programme (EDP) and Public Presentation of Practice License. As my colleague and friend Mr. Bayo Olugbemi, FCIB has done justice to welcoming you all, I would still like to once again say a big welcome to everyone present here today. This edition of the Entrepreneurship Development Programme marks the 8th year since it was introduced. This innovative programme was introduced to enable members of this revered institute practice banking outside the confines of the banks. The License will enable the holder to consult and render services in banking, finance and allied matters except financial intermediation. I would therefore like to use this medium to congratulate and celebrate with our members who are going to be presented with their Practice Licenses and Seal in the course of this programme. Esteemed guests, permit me to applaud the efforts of the Board of Fellows and Practice License ably chaired by Mr. Bayo Olugbemi, the 1st Vice President of our great Institute and Managing Director/Chief Executive, First Registrars & Investor Services Limited for their commitment and effort towards producing such deserving members. Sirs and Ma, your commitment is worthy of emulation. Distinguished Audience, for today’s programme, we have engaged seasoned professionals who are versed particularly in the area of entrepreneurship to tackle today’s theme titled Entrepreneurship for Inclusive Growth: Opportunities and Sustainability Strategies.
    [Show full text]
  • Abstract Introduction Background of the Study
    CJSMS Vol. 5, No 1, 2020. https://doi.org/10.26772/CJSMS2020050205 GODFATHERISM AND PUBLIC POLICY IMPLEMENTATION IN LAGOS STATE, 1999-2020 Bello, Olaide Wasiu1 PhD Kehinde, Oladapo Ayoola2 Abstract The discourse of godfatherism gained much attention at the present time as a result of its need forms of articulation. To sum this up, this study examined the effects of godftherism on good governance and provision of essential services in Lagos state. To actualize this, quantitative method through survey research design was used and twenty-four (24) online questionnaires were raised for the respondents within the Alimosho local government area of Lagos state. For further analysis, two hypotheses were raised and regression analysis was adopted. At the end of the statistical analysis, all the two hypotheses agreed with the alternative hypotheses and the findings revealed that godfatherism occurs in Lagos state, due to high corruption rate, centralized nature of Nigeria federalism, and monetization of political offices. To address the problem above, the study recommends that the anti-corruption crusade of government should be intensified vigorously, and the independent of the judiciary should be stabilized. Keywords: Godfatherism, Good governance, Social Amenities, Public Policy Implementation, Introduction Background of the study With the return of the country to democratic rule in 1999 after a long period of military regimes (the country has had 31 years of civilian government to 29 years of military rule since independence in 1960. The issues of public policy implementation (in terms of good roads, good governance and infrastructural facilities) have become a major problem in 1 Department of Political Science and International Relations, College of Arts, Management and Social Sciences, Chrisland University, Abeokuta, Ogun State.
    [Show full text]
  • Global Journal of Human Social Science
    Online ISSN : 2249-460X Print ISSN : 0975-587X DOI : 10.17406/GJHSS The Politics of Labeling An Appraisal of Voters National Election of Ethiopia Implications on Nigeria Democracy VOLUME 17 ISSUE 1 VERSION 1.0 Global Journal of Human-Social Science: F Political Science Global Journal of Human-Social Science: F Political Science Volume 17 Issue 1 (Ver. 1.0) Open Association of Research Society Global Journals Inc. *OREDO-RXUQDORI+XPDQ (A Delaware USA Incorporation with “Good Standing”; Reg. Number: 0423089) Sponsors:Open Association of Research Society Social Sciences. 2017. Open Scientific Standards $OOULJKWVUHVHUYHG 7KLVLVDVSHFLDOLVVXHSXEOLVKHGLQYHUVLRQ Publisher’s Headquarters office RI³*OREDO-RXUQDORI+XPDQ6RFLDO ® 6FLHQFHV´%\*OREDO-RXUQDOV,QF Global Journals Headquarters $OODUWLFOHVDUHRSHQDFFHVVDUWLFOHVGLVWULEXWHG 945th Concord Streets, XQGHU³*OREDO-RXUQDORI+XPDQ6RFLDO Framingham Massachusetts Pin: 01701, 6FLHQFHV´ 5HDGLQJ/LFHQVHZKLFKSHUPLWVUHVWULFWHGXVH United States of America (QWLUHFRQWHQWVDUHFRS\ULJKWE\RI³*OREDO USA Toll Free: +001-888-839-7392 -RXUQDORI+XPDQ6RFLDO6FLHQFHV´XQOHVV USA Toll Free Fax: +001-888-839-7392 RWKHUZLVHQRWHGRQVSHFLILFDUWLFOHV 1RSDUWRIWKLVSXEOLFDWLRQPD\EHUHSURGXFHG Offset Typesetting RUWUDQVPLWWHGLQDQ\IRUPRUE\DQ\PHDQV HOHFWURQLFRUPHFKDQLFDOLQFOXGLQJ G lobal Journals Incorporated SKRWRFRS\UHFRUGLQJRUDQ\LQIRUPDWLRQ 2nd, Lansdowne, Lansdowne Rd., Croydon-Surrey, VWRUDJHDQGUHWULHYDOV\VWHPZLWKRXWZULWWHQ SHUPLVVLRQ Pin: CR9 2ER, United Kingdom 7KHRSLQLRQVDQGVWDWHPHQWVPDGHLQWKLV ERRNDUHWKRVHRIWKHDXWKRUVFRQFHUQHG
    [Show full text]
  • Legislature-Executive Relations in the Presidential System: a Study of Lagos and Ogun States, Nigeria, 1999-2011
    Legislature-Executive Relations in the Presidential System: A Study of Lagos and Ogun States, Nigeria, 1999-2011 By ONI, Samuel Olorunmaiye CUGP070188 A Thesis Submitted to the Department of Political Science and International Relations, School of Social Sciences, College of Development Studies, Covenant University, Ota, Nigeria in Partial Fulfillment of the Requirements for the Award of Ph.D Degree in Political Science May, 2013 i CERTIFICATION This is to certify that this study titled “Legislature-Executive Relations in the Presidential System: A Study of Lagos and Ogun States, Nigeria, 1999-2011” was carried out by Oni Samuel O. under our supervision and that the thesis has not been submitted for the award of any degree in this or any other university. Professor Remi Anifowose Department of Political Science Signature and Date University of Lagos (Supervisor) Professor Kayode Soremekun Department of Political Science Signature and Date & International Relations College of Development Studies Co-Supervisor ii DECLARATION It is hereby declared that this thesis titled “Legislature-Executive Relations in the Presidential System: A Study of Lagos and Ogun States, Nigeria, 1999-2011” was undertaken me, Oni Samuel O. The thesis is based on my original study in the Department of Political Science and International Relations, School of Social Sciences, College of Development Studies, Covenant University, Ota. The views of other researchers have been acknowledged. It is further restated that this work has not been submitted for the award of degree in this or any other institution. Oni Samuel O. Researcher Signature and Date The above declaration is attested to by: Professor Remi Anifowose Supervisor Signature and Date Professor Kayode Soremekun Co-Supervisor Signature and Date Dr.
    [Show full text]
  • Women Marginalization in Electoral Politics in Nigeria: a Historical Perspective
    Arabian Journal of Business and Management Review (Nigerian Chapter) Vol. 2, No. 7, 2014 WOMEN MARGINALIZATION IN ELECTORAL POLITICS IN NIGERIA: A HISTORICAL PERSPECTIVE Eme Okechukwu Innocent Onyishi Anthony O. Department of Public Administration and Local Government Studies University of Nigeria, Nsukka, Nwaoha, Chimaraoke Department of History, Alvan Ikoku College of Education Owerri Abstract Global patriarchy has given ascendancy to men in politics, authority and decision-making in and outside the family. Under such a male-centred system without a female face, women lack access to politics and decision-making and are highly under-represented at most levels of government. This paper analyses marginalization of women in decision-making and the challenges encountered by female politicians on their way to political participation in Nigeria. It also, contends that the power relations that have prevented women from political activism operate in many levels of society, from the most personal to the highly public. It argues that the gender uneven electoral politics in Nigeria is as a result of men’ majority in the political party hierarchy, which places them at a vantage position to influence party’s internal politics in terms of selecting or electing candidates for electrons, and political patronage .The paper notes that socio-cultural, economic, political, organizational, legal and political factors have combined to shape the “home-centred’ perception of Nigerian women ,and explains the level of participation of women in political and bureaucratic decision- making positions. To reverse the historical under-represented Nigerian women in politics, and decision-making in governance, the paper proposes a triad strategy for women empowerment.
    [Show full text]
  • 24Th July 2020
    24th July, 2020 DAILY NEWSLETTER Text PHOTOS FROM THE JOINT INAUGURAL CEREMONY OF THE 2020-2022 GOVERNING COUNCIL COMMITTEES WHICH HELD THURSDAY, 23RD JULY, 2020 , VIRTUALLY From Left: Mr. Dele Alabi, FCIB, National Treasurer, CIBN; Dr. Ken Opara, FCIB, 1st Vice President, CIBN; Mr. Bayo Olugbemi, FCIB, President/Chairman of Council, CIBN; Prof Pius Olanrewaju, FCIB, 2nd Vice President, CIBN and Mr. Seye Awojobi, FCIB, Registrar/CEO, CIBN His Excellency Otunba Femi Pedro, FCIB, Former Deputy Governor, Lagos state giving his remarks on the Inauguration Mr. UK Eke, FCIB, Group Managing Director, FBN Holdings Plc giving his remarks on the Inauguration Mr. Femi Ekundayo, FCIB, Past President, CIBN giving his remarks on the Inauguration FINANCE NEWS CBN sets November Naira weakens further Emefiele: Loan 2022 for migration to as dominant Forbearance Will new messaging currencies alter Enable Companies standard pricing decisions Survive Covid-19 The Central Bank of Nigeria With many trade Central Bank of Nigeria (CBN), has directed all transactions benchmarked Governor, Mr. Godwin financial institutions to on or against dominant Emefiele, in this interview currencies like the U.S. after the Monetary Policy before November 2022, dollar, the International Committee meeting spoke migrate to a new standard Monetary Fund (IMF), has about the state of the for exchanging electronic expressed concerns that Nigerian banking sector, the currency movements pose recent exchange rate messages known as great challenges to adjustment as well as the ISO20022.
    [Show full text]
  • Lagos State Governor, Mr. Babajide Olusola Sanwo-Olu’S, Profile This Abridged Account Provides a Glimpse Into His Trajectory of Execellence
    LAGOS STATE GOVERNOR, MR. BABAJIDE OLUSOLA SANWO-OLU’S, PROFILE THIS ABRIDGED ACCOUNT PROVIDES A GLIMPSE INTO HIS TRAJECTORY OF EXECELLENCE Introduction Until his election as the 15th Governor of Lagos State on the platform of the All Progressives Congress (APC) in the 2019 elections, Mr. Babajide Olusola Sanwo-Olu was the Managing Director/CEO of Lagos State Development Property Corporation (LSDPC). He was also a 3-time Commissioner in Lagos State, having served in the Ministries of Economic Planning & Budget, Commerce & Industry and the Ministry of Establishments, Training & Pensions. Education Mr. Sanwo-Olu is an alumnus of the prestigious Harvard Kennedy School of Government, London Business School and the Lagos Business School. He earned a Bachelor’s degree in Surveying & Geo-Informatics and a Master of Business Administration (MBA) from the University of Lagos. He had his early education at Government Demonstration School, Gbaja, Surulere and Ijebu-Ife Grammar School, Ogun State. Professional Associations He is member of the Chartered Institute of Personnel Management (CIPM), Nigerian Institute of Directors (IOD), Chartered Institute of Personnel Management (CIPM) and Fellowship of Nigeria Institute of Training and Development (NITAD). Private Sector Experience Mr. Sanwo-Olu was a Treasurer at former Lead Merchant Bank from 1994 to 1997 before joining United Bank for Africa (UBA) as the Head of Foreign Money Market. He subsequently moved to First Inland Bank Plc (now First City Monument Bank) from where he retired as a Deputy General Manager and Divisional Head. Public Service Experience His public service career began in 2003, when he was appointed Special Adviser on Corporate Matters to the then Deputy Governor of Lagos State, His Excellency, Mr.
    [Show full text]
  • The Myth and Reality of Womens' Political Marginalization in Nigeria
    International Journal of Humanities and Social Science Invention ISSN (Online): 2319 – 7722, ISSN (Print): 2319 – 7714 www.ijhssi.org ||Volume 4 Issue 12 ||December. 2015 || PP.01-15 The Myth and Reality of Womens’ Political Marginalization In Nigeria 1Mohamed M. Wader, 2Tanko Yusuf Dahiru , 3Mukhtar Imam 1Department of Political Science and International Relations, University Of Abuja, Abuja-Nigeria, 2,3 Department Of General Studies, Federal Polythenic Nasarawa And Department Of Political Science And International Relations, Nigerian Turkish Nile University, Abuja-Nigeria ABSTRACT: Women represent 50% of the Nigerian Population, but in spite of this, their level of political participation and representation is very poor, being largely noticed at the level of voting and latent support. Men are found to have dominated the political arena to the point of total exclusion of women, yet all groups (women inclusive) seek to influence dispensation of power. The research therefore sets out to analytically x-ray the issues and challenges surrounding the political marginalization of women in the society. The research implores the use of empirical data to make sound and logical arguments on the plight of women in the political sphere of the polity. Using variables such as religion cum cultural belief system, virility deficiency syndrome, lack of adequate finance, lack of effective means of implementing the affirmative action and so forth, the researchers conclude that women marginalization in the political cum economic domain is in fact a reality and not a myth. It therefore recommends amongst other things that, it is imperative to develop and enhance the capability of women in the political and economic terrain by uplifting them financially and morally, so as to drastically reduce if not totally eradicate arm-twisting or marginalization of women in the society.
    [Show full text]
  • Report of the Special Rapporteur on Extrajudicial, Summary Or Arbitrary Executions, Philip Alston*
    UNITED NATIONS A General Assembly Distr. GENERAL A/HRC/11/2/Add.1 29 May 2009 ENGLISH/FRENCH/SPANISH ONLY HUMAN RIGHTS COUNCIL Eleventh session Agenda item 3 PROMOTION AND PROTECTION OF ALL HUMAN RIGHTS, CIVIL, POLITICAL, ECONOMIC, SOCIAL AND CULTURAL RIGHTS, INCLUDING THE RIGHT TO DEVELOPMENT Report of the Special Rapporteur on extrajudicial, summary or arbitrary executions, Philip Alston* Addendum SUMMARY OF CASES TRANSMITTED TO GOVERNMENTS AND REPLIES RECEIVED** * Late submission. ** The present report is circulated as received, in the languages of submission only, as it greatly exceeds the word limitation currently imposed by the relevant General Assembly resolutions. GE.09-13662 (E) 290609 A/HRC/11/2/Add.1 page 2 CONTENTS Paragraphs Page Introduction .................................................................................................... 1 3 I. COMMUNICATIONS AND REPLIES .............................................. 2 - 6 3 A. Violation alleged ......................................................................... 3 3 B. Subject(s) of appeal .................................................................... 4 4 C. Character of replies received ...................................................... 5 4 D. Observations of the Special Rapporteur ..................................... 6 4 II. TABULATION OF COMMUNICATIONS AND REPLIES ............. 7 - 11 4 A. “Communications sent” and “Government responses received” ..................................................................................... 8 5 B. “Number and
    [Show full text]