deviate from thatgiveninthispublication. Additional informationcanbeobtained atwww.opel.de andfromyourOpel partner.” only anapproximation oftheactual colours.Outside Germany, the productrange,technologyandequipment ofourvehiclescan contentsreflectthesituationat timeofprinting.“The Alldesignsand equipmentaresubjecttochange.Theprinted coloursare GENERAL DISCLAIMER: Adam OpelAG —allrightsreserved.No partofthispublicationmaybereprinted orreproducedwithoutthepermissionofAdam OpelAG. Gunnar Knechtel(30–31,33,46–53),Sorin Morar(32,56–63), Volker Lammers, Photography:NatalieBothur(pp.6–12,31–32),Ramon Haindl (pp. 16,39,41),BenjaminPichelmann20–30,32), of HoffmannundCampe Verlag GmbH, EversfrankBerlinGmbH, Illustrations: Hamburg PRINTING: Ballinstraße15,12359BerlinCREDITS: Management Board),WilliamF. Bertagni(MemberoftheManagementBoard) PUBLISHER: IMPRINT Adam OpelAG, Bahnhofsplatz,65423Rüsselsheim amMain,Germany. Authorisedrepresentatives:UlrichSchumacher(Speakerofthe Terroir cookbook(p.58)Translation: TransForm GmbH, Cologne©2016 Accessories thatmake your Opeleven better
OPEL PUBLISHING COMPANY: HOFFMANNUNDCAMPEX—abrand +
ISSUE 1 OPEL + ACCESSORIES THAT MAKE YOUR OPEL EVEN BETTER Accessories thatmake your Opeleven better ISSUE 1 FOR YOUR CAR
OPEL +
CONTENTS OPEL + 44 34 18 04 54 your vehicle. Opel when rainanddirt attackyourcar, And whenthegoing getstough, PROTECTION OPEL Driving willbecomeapleasure. car easierandmorecomfortable,especiallyforfrequentdrivers. Good ideasforpracticalaccessoriesfromOpel COMFORT &CARE OPEL make yourcarevensafer. Special accessoriessuchastheexhaustivelytestedchildseats All Opel SAFETY OPEL space inthevehicle. Roof boxesorbikeracksmaketransporteasierandcreatenew Your carwillbeevenmorepracticalwithOpel TOURING OPEL Your carwillbeunique. car itsownveryspecialandtotallyindividualstyle. Opel STYLE OPEL + + + + + + + accessories helptoprotect accessoriesareperfectlydesignedtogiveyour + accessoriesundergoOpel’sstrictsafetytests. + + accessories. makelifeinthe 64 T CHOICE 42 30
Opel fans. T F accessories. — theirtopOpel choice Celebrities’ FAVOURITES are alwaysanadvantage. Opel Why THE BES en items forreal AN SITE + accessories +
3 OPEL+ ACCESSORIES Opel+ Contents OPEL+ STY- LE OPEL+ accessories give your car a distinctive touch, making it unique. 6 OPEL+ ACCESSORIES Opel+ Style AND STYLE WITH CHARM her personally styledADAM. An Opelbrandambassador, Masha isalwaysaccompaniedby perfect placetoget inspiration forstylingandbeautytrends. For onlinebloggerMasha Feoktistova, 29,Amsterdam isthe THERE ARESURELY “I THOUGHTTHAT MASHA FEOKTISTOVA about herearlydaysas IN THISTOPIC.” WHO AREALSO OTHER WOMEN a beautyblogger INTERESTED for downtownAmsterdam. eyecatcher infrontofthe ADAM isanidealvehicle café whereMashaworks Mineral Greeninterior The sportywheelsand also makethecaran Cloud, agalleryand
on herblog. this duringlunch atthehipDroogdesignerhotel. been named“Businesswomanof theYear.” Shetells us Saturdays,” saysMashaFeoktistova, whohasalready on upload anewvideotoBeautygloss onceaweek, who wereexcitedaboutherbeauty tips.“Igenerally date. Masharapidlyattracteda hugecrowdoffans viewed byaroundhalfamillion Dutchwomento hasbeen this topic,”saysMasha.Thevideo “Haar” are surelyotherwomenwhoalsointerestedin in theNetherlandsatthattime.Ithoughtthere channel, becausetherewerenootherbeautyexperts YouTube (hair).“Ibeganwiththis video, titled“Haar” she startedtowriteonherbloganduploadfirst Moscow, butisDutch. Whenshewasstillinschool It allbegannineyearsago: — especiallyforteens. her: realtipsandinformationaboutbeautytopics This ispreciselywhatMasha’s readerswantfrom on thelookoutforlatesttrendsandinspirations. saunters throughshops,galleriesandcafés,always lives, toherfavouritecity, Amsterdam,whereshe then drivesherADAM fromTheHague,whereshe followers abitmorecolourfulinotherways.She simply makesherlifeandthelivesoffans and OpelbrandambassadorMashaFeoktistova A msterdam inthespring? such days,apersonlikebeautyblogger sometimes doeshaverainyweather. On don’t wanttobeunjust, butAmsterdam Masha wasbornin Wet tulips.We
7 OPEL+ ACCESSORIES Opel+ Style 8 OPEL+ ACCESSORIES Opel+ Style uses toeditthe videos. delay,her dailylifewithonlyaone-week whichshe andletsher fansparticipatein poses withher“finds” lot ofroutine,shecharminglytakes centrestage, and videocameraalongwherever shegoes.Witha things sheexperiences.Shealways takesheriPhone the thingsshedoes, she seesandthe Masha andnothingbutMasha. Mashablogsabout presence atVloggloss,Mashareportsdailyabout many followersasherbeautyblog ful onlinepresencethatnowattractstwiceas neighbourhoods andherdailylifeintoasuccess through Amsterdam’s colourfulandtrendy Masha wouldn’t beMashaifshedidn’t turnstrolls fashion designers. new accessoriesorstylishclothingfromwell-known by thedesignerTejo Remy, andoftenfindsamusing classic pieceofDroogfurniture,achestdrawers Shop onthehotel’s groundfloor, shecanadmire a with asparagus,snowpeasandspices.IntheDroog snackssuchassalmonsalad her withhome-made likes thetearoom,whereroomservicesupplies hall withitsceilingfullofbluebirds.Sheespecially celebrated severaleventshere,inthehotel’s white The stylingiconoftheDutchonlinecommunityhas Shop (belowright). hotel andintheDroog of theDroogdesigner thoroughly whitehall films herselfinthe For hervlog, Masha . Inthisonline - The YouTube star about hersecretofsuccess MASHA FEOKTISTOVA WAY YOU ARE.” STAY THE BIGGEST FAN. AND YOUR OWN “YOU SHOULDBE
A canal-viewgalleryandcafé club withaviewoftheskyline A conceptstorewithacafé A spectacularcrane hotel A restaurantandbeach A cooldesignerhotel A cosmeticsboutique www.cloudartcoffee.nl www.hoteldroog.com www.shop.sprmrkt.nl HOTEL DROOG www.faralda.com with abistro www.skins.nl www.pllek.nl TIPS FARALDA SPRMRKT CLOUD SKINS PLLEK
very successful. patron andthespecialMashaeyelashesarenow past, Mashagainedaneyelashmanufacturerasa demand forartificialeyelashesinHollandthe cosmetics. Althoughthereusedtobealmostno However, sheneverthelessmakesmoneywith so withoutchargingafee,”shesays. only writeaboutproductsthatIlikemyself, andIdo bloggers, whowanttogetpaidforpositivereviews,I so thatshecantestthem.“Unlikesomeother Masha issentalloftheproductsenmasseforfree the Netherlands’mostcelebratedbeautyblogger, lipsticks. Shedoesn’t havetobuyanythingherself. As and beauty elementasshetriesoutmake-up delicate scents.Here,Mashaiscompletelyinher in herADAM toSkins,acosmeticsshopfullof of thedashboard. as replaceableparts panelling, whichisjust Masha lovesthedoor tre concept storeandcaféinanoldbrickhall. (bicycles). SheheadstoSPRMRKT, a450-square-me cyclists ontheirfamousblackDutch“fiets” of touristsandagroupextremely self-confident downtown Amsterdam,weavingbetweenhordes Masha driveshersmall,agileADAM through shaped likefishuptothecamera. as sheholdsapairofunusualsocksthatare followers aboutthisroom.Intheshop, shesmiles Masha turnsaroundinacircleandtalkstoher In theDrooghallwithbirdsonceiling, trip takesherthroughthecity, alongpicturesque
She thendrives
The -
Opel+ Style 10 OPEL+ ACCESSORIES Opel+ Style that herfollowersarebiggest asset. problem forMashaFeoktistova, whoknowsverywell is oftenrecognisedbyherfans. Butthat’s no again intheintricatemazeofalleyways. posts areinDutch andthereforeonlyaccessible very welleventhoughallher videosandblog After all,Mashacanliveoff her onlineactivities products. designer furniture,art, candles, andnewbeauty fashions butalsolotsofinspirationintheform At SPRMRKT, Mashafindsnotonlythelatest would fitverywellwithherMineralGreenseats. fallen inlovewiththenewPaisley pattern,which 30 differentcoloursandpatterns.Mashahasjust owner’s preferences.Motoristscanchoosebetween be quicklyandeasilyreplacedinlinewiththe that wayforverylong. IntheADAM, suchpartscan love ofexperimentationknowsthattheywon’t stay also StardustGrey, but anyonefamiliarwithMasha’s seats. Thedashboardandthedoorpanellingare Stardust GreyandfeaturesMineralGreenleather first ADAM wasBurgundyRed,itssuccessoris for freeandadaptedittohertastes. As anOpelbrandambassador, Mashagotthecar space, andthe ensures thatMashaalmostalwaysfindsaparking streets.Thecaralso labyrinth ofnarrowone-way small, dextrousADAM istheperfectcarforsucha canals andacrossnostalgic-lookingbridges.The Whenshe’s atthe store,theYouTube star OnStar app helpsMashafindhercar
Whereas her BLOG ABOUT MASHA FEOKTISTOVA I REALLY “I ONLY THINGS LIKE.” Vlogger city’s skyline. city’s tique andthe in theSkinsbou- is bythescents clothing asshe spired bythis Masha isasin- young designers. of clothingfrom SCHUIT’s show ion gallery thefash- host’s Droog Hotel weeks ayear, the For several
way youare.” You shouldbeyourownbiggestfan.Andstaythe channel wouldYOU subscribeto?Thinkabout it. watch ifyouweretheperfectviewer. Whatkindof You havetoaskyourselfwhatYOU wouldliketo you havetomakevideosthattheywantwatch. success, weaskMasha.“Inordertoattractviewers, as witharecentnegativepregnancytest. recording ofhermoveintoownhome,aswell was alsothecasewithcomprehensivevideo one ofherself-marketingstories, ofcourse.This She recentlygotengaged,andthiseventwasalso to alimitedaudience. she doesn’t eventakehervideocameraalong. to feeltheseabreezeonherface–andsometimes fantastic viewofAmsterdam’s skylineandthechance hotel. ButwhatMashaenjoysthemosthereis cool beachclubssuchasPllekandtheFaralda crane features amixtureofcontainers,studenthousing, on theothershoreofIJ. Thisformerdockland and quietinstead,shedrivesovertotheNDSMzone loving onlinestarandshewantstohavesomepeace it allbecomestoomuchforthenormallypublicity- What isthesecrettoher Whenever
decoration package are availableforthe vehicle adistinctive order togivethe ADAM’s different colours 30 touch. interior
in in
11 OPEL+ ACCESSORIES Opel+ Style 12 OPEL+ ACCESSORIES Opel+ Style / Interior A PERSONALTOUCH GIVE YOUR CAR that makedrivingevenmorefunthanitalreadyis. Opel yourfavouritelook withstylingproducts Hop intoyourdestination!Givetheinteriorof STYLING
/
INTERIOR Suitable fortheADAM, Corsa,Astra detailed instructions. includes therequiredfasteningmaterials and panel andtwodoortriminserts.Inaddition, it attachable partsforthelowerinstrument installed andremoved.Thekitcontains two in awiderangeofcoloursandcanbeeasily and anywhichwayyouwant.Itisavailable kit letsyouredesignyourcar’s interiorquickly Individuality iswritlargeintheADAM! Thistrim STYLISH LOOK DRIVE WITHACLASSYAND INTERIOR TRIMKIT NEW NOW ADAM THE FOR INTERIOR TRIMKIT Available fortheADAM, Corsa,Astra trim. Justattachandenjoy! interior trimpartsfortheinstrumentpanelanddoor and enjoydrivingtothemax.Thekitcontainsfour Trimpeach-coloured Kitissuretomakeyoufeel good Would you liketohaveareallytastyambience?The LET’S HAVE PEACH TODAY
STYLE
OPEL REAR VIEWMIRRORCOVER Suitable fortheADAM, Corsa designs andcolours. Moreover, it’s availableinawiderange ofexciting can beremovedwithoutleavinganyresidue. elegant look.Thecoverisveryeasytoattachand eyecatcher andgivesyourcar’s interiorasporty, The exchangeablerearviewmirrorcoverisareal Give yourcarafewsmall,buteleganttouches! A VERY EFFECTIVEEYECATCHER
+ Suitable forthe ADAM, Corsa shifting gears! express theirpersonalityevenwhen want somethingspecialsothatthey can install. It’s justthethingfordriverswho colour intoyourcarandisveryeasy to impossible tomiss.Itbringsatouch of stick. It’s arealeyecatcherand when youseetheJamesBlondegear You’re suretobeputinagoodmood HIGHLIGHT CAR ACHEERFUL GIVE YOUR JAMES BLONDE LEATHER GEARSTICK, Astra Available fortheADAM, Corsa, trim andthecentreconsole. parts fortheinstrumentpanel,door kit consistsoffiveattachableplastic make drivingevenmorediverse!Each Enjoy thewidevarietyofdesignsthatwill change thelookofyourcar’s interior. variety oftrimkitsthatletyoueasily your Opelanewdesign?offers Would youliketogivetheinteriorof WHILE DRIVING NEVER BEBOREDAGAIN INTERIOR TRIMKIT
13 OPEL+ ACCESSORIES Opel+ Style / Interior 14 OPEL+ ACCESSORIES Opel+ Style / Exterior will lovethiskit. the customer’s request.Driverswholikeasportyfeel primed andcanbepaintedinanyvehiclecolourat rear lowerskirtsaswellsidesills.Thepartsare expression ofdynamism.Thekitincludesfrontand The OPClineexteriorpackkitisaveritable A TURBOLOOK A DYNAMIC KITWITH OPC LINEEXTERIORPACK KIT, PRIMED STYLE out thebestinyourOpel. right accessoriesyoucanquicklybring Become verystylishfast:With the
/
EXTERIOR
Available fortheADAM, Corsa,Astra little effort. their Opelslookevenmoredistinctive with perfect partsforpeoplewhowantto make without leavinganyresidue.Theseare the which areeasytoattachandcanbe removed kit containsbothleftandrightmirrorcaps, elegant individualityandasportynature.The carbon outsidemirrorcapsstandfordiscreet, Featuring greatattentiontodetail,theblack SMALL BUTEFFECTIVE CARBON DESIGN OUTSIDE MIRRORCAPS, Available fortheADAM, Corsa irresistible colours! behind. It’s availableinmany removed withoutleavinganyresidue attached totheradiatorgrilleandalso foilthat canbeeasily deep-drawn application ismadeofadurable enhance thefront’s character. The ADAM averydistinctivelookand The colouredlogobarwillgiveyour ATTENTION CATCH PEOPLE’S WITH COLOURED FOILAPPLICATION OPEL LOGO
Available fortheCorsa,Astra come insetsoftwoforthefrontdoors. you needaretheadhesivepadsthatcomewithplates.TheLEDtreadplates door isopened.However, nowiringordrillingisneededtoattachthepart —all and giveyourOpelaverydistinctivetouch.TheLEDlampisactivatedwhenthe Please getin!Theilluminateddoorsillplatesimmediatelygrabpeople’s attention A STUNNINGLIGHT ILLUMINATED LEDDOORSILLPLATES into apersonalised gem possibilities toindividu- They turnevery ADAM ALMOST combining various alise yourADAM by ∞ . accessories. of acar.
Mokka X Similar decalkitsareavailablefortheADAM, Astraand residue. easily appliedandarealsoeasytoremovewithoutleavingany dynamic andindividualisedlook.Thedecalscanbequickly you togivethebonnetandrearhatchofyourOpelCorsaa This kitputsyourOpelintoasportylight!Thedecalenables A NEWLOOK AT THEFLICKOFAWRIST HOOD &TAILGATE, CASABLANCAWHITE EXTERIOR FOILDECALKITSPORT, MOTORSPORT FOILKIT Similar decalkits arealsoavailablefortheAstra separately. andacorrespondingsillplatekit are available Motorsport decalsfortheB-pillar and thesidesprovidesyourOpelwith adynamicmotorsportlookwithlittleeffort. Turn yourADAM intoastylishracing car!Thisdecalkitforthebonnet, thedoors A SPORTY DESIGNFORORDINARY ROADS
15 OPEL+ ACCESSORIES Opel+ Style / Exterior 16 OPEL+ ACCESSORIES Opel+ Style / Wheels, Tyres and Rims 4-DOUBLE-SPOKE DESIGN 4-DOUBLE-SPOKE ALLOY 16INCH, WHEEL, WITH Suitable fortheAstra finish. bi-colour titanium andfeatureadistinctive designaremadeofshiny ble-spoke alloy wheelswiththeir10-dou- drivers wholoveuniqueness.These An individualisedappearanceforall DUO LOOK DREAM WHEELSWITHA (depending ontheengine) Suitable fortheCorsaE centre capshavetobeorderedseparately. three super-exciting colours.Thecorrespondingvalvecoversand perfectly withtyresthataren’t toowide.Thewheelsareavailablein people’s attentionwhereveryougo.Thewheel’s dimensionsfit As youtravelathighspeed,thesealloywheelsaresuretograb TWICE ASDYNAMIC, TWICEASELEGANT STYLE character ofthevehicleanditsdriver. introduction. Theydemonstratethe Well-styled rimsareacar’s letterof BI-COLOUR FINISH BI-COLOUR DESIGN,10-DOUBLE-SPOKE ALLOY 18INCH, WHEEL,
/
WHEELS, TYRESANDRIMS
WITH
Available forthe ADAM, Corsa,Astra, KARL,Cascada perfectionists —valves can’t becoveredmore decoratively! attached andremovedagainjustas quickly. Amustfor Opel logoonablackbackground. The coverscanberapidly four covers,theyhaveanelegantchrome coatinganddisplaythe your ADAM, stylingitdowntothelastdetail.Availableinsetsof The valvecoversbearingtheOpellogo roundoutthelookof PERFECT OVERALL IMPRESSION VALVE COVERS WITHOPELLOGO the engine) Suitable fortheInsignia(dependingon ordered separatelyforallwheels. the valvecoversandcentrecapshavetobe tyres andarereallyeyecatching. Pleasenote: are trulydistinctive.Theyperfectforwide feature anextravagant6-Y-spoke designand polishedtitanium.Thewheels high-quality and expressivealloywheelsmadeofelegant, Make astylishappearancewiththesesporty TURN HEADSASYOU DRIVE ALLOY 19INCH WHEEL, MEET THESAME Head ofPersonalization and STANDARDS AS HIGH QUALITY ACCESSORIES Accessory Development OUR CARS.” JOCHEN GLOCK HAVE TO “OUR
(depending ontheengine) Suitable fortheADAM wheel nuts. Does notincludethecentrecapandlocking will giveyourOpeladynamicappearance. finishand wheels boastatrendybi-colour Tradition meetssportiness:Thesealloy DIFFERENT POWERFUL, DYNAMIC, IN AROULETTEDESIGN ALLOY 17INCH, WHEEL, THE STYLINGACCESSORIES FROMOPEL FOR COMPLETEINFORMATION ABOUTALL TO WWW.OPEL-ACCESSORIES.COM/GB YOUR NEARESTDEALERSHIP, GO OPEL-ACCESSORIES. COM/GB WWW.
+
AND
IN ABOOMERANGDESIGN ALLOY 16INCH, WHEEL, Suitable forthe ADAM (depending ontheengine) ordered separately. the crowd.Thecentrecapandlocking wheelnutshavetobe boomerang designandaresureto make yourcarstandoutfrom These alloywheelsarerealeyecatchers. Theyfeatureastriking STYLING FORINDIVIDUALISTS (depending ontheengine) Suitable fortheADAM design. and bi-colour alloy wheelswiththeirhighlypolishedlook cial, youcan’t gowrongifyougetthese If youarelookingforsomethingextra-spe- CATCHER EYE A RED-AND-BLACK WITH ALLOY 17INCH, WHEEL,
SWISS BLADEDESIGN
-
17 OPEL+ ACCESSORIES Opel+ Style / Wheels, Tyres and Rims OPEL+ TOUR- ING The accessories from Opel+ are extremely handy and make your car even more practical. We offer suitable equipment for every hobby and every task, all designed to give you added flexibility. Whether you choose a roof box or a bike rack, Opel+ makes things easier. 20 OPEL+ ACCESSORIES Opel+ Touring TOTHE BEACH BRING MORE still roomforeverything—alltheextragearistransportedoutside. of Sylt, theytakeeverythingbutthekitchensink.Nonetheless,there’s Jessica Winter andherfamilytravelfromHamburgtotheholidayisland They wanttoridebikes,kitesurforbuildhugesandcastles—when It’s aritual.” Ärzte. “As soon aswehittheautobahn,Iputiton. explains, to gobackWesterland.” That’s oursong, she followed byguitarsandfinallythelyrics:“…Iwant pulsating beatfromtheonboardloudspeakersis got everything but thekitchensinkwithus,”says “In thepastweusedtohitchhike; thesedayswe’ve coming toSyltatleastfouror fivetimesayear. For thepast16years, theWintershavebeen display andthenleansbackwithagrin. W Westerland bytheGermanbandDie smartphone holder, touchesthe Hamburg, putsheriPhoneinits Jessica Winter, anartdirectorfrom atch out!Thisismyfavouritebit!” your Opelevenmorepractical. any additionalluggage.Thatmakes create spaceforbikes, sportsgearand your Opelevenmoreversatileand Touring accessoriesfromOpel A + make
21 OPEL+ ACCESSORIES Opel+ Touring 22 OPEL+ ACCESSORIES Cosy restaurantandwinelounge Trendy VIPbeachrestaurantin Cakeandshrimprollsinthe Legendary caféinKampen www.kleineteestube-sylt.de www.altes-zollhaus-sylt.de www.kupferkanne-sylt.de LISTER AUSTERNPERLE Mannemorsumtal, List Friesenhaus inKeitum Beach restaurantat KLEINE TEESTUBE ALTES ZOLLHAUS KUPFERKANNE www.sansibar.de in Westerland SANSIBAR TIPS Rantum Sports Tourer. new OpelAstra refuge inthesmart wild. Lenitakes relatives inthe than hisreal-life Sheep ontheiPad Better Shaunthe Art directorandOpeldriver JESSICA WINTER STARTS WITHTHEDRIVETHERE.” I SLOW THINGSDOWN. AGOODTRIP “MARCUS STEPS ONTHEGAS, kiteboard, hanging ontothewindandploughing love speed,”saysMarcus.“Climbing ontoa hardly noticetheirpresence. Leni andmutteredcursesfromtheboys,youwould Were itnotforspontaneousfitsofgigglesfrom LTE connection; Leni iswatchingShauntheSheep. ments,” hesays.“Ilikethat.” solutions. “We cantailorittoourpreciserequire situation.” Asanengineer, Marcuslikessmart needs, asandwhenrequired.It’s anideal straight forthewater—atlast, kitesurfing! with LeniandLucas.Marcus andLinushead the island,visitsanoldschool friendtogether of saltintheair:Sylt!Jessica, whowasbornon Two hourslater, thesoundofseagulls, thetang roof box lines, notjustsomethingfunctional.Withthenew Sports Tourer, “a carwithabitofpowerand nice something sporty,” says MarcusofhisOpelAstra a perfectcombination,”saysJessica.“Iwanted “Marcus stepsonthegas,Islowthingsdown:it’s to Sylt; outside,thecountryside flashesby. Inside, DieÄrztesingoftheirlongingtoreturn provided bythe boys aregamingonlineviatheWi-Fi hotspot engrossed intheirtabletsorsmartphones.The Lucas (12)andLeni (7),allwithheadphones on, glance behindher. InthebackareLinus(14), entire AppleStoreaswell,”addsJessicawitha her husbandMarcuswithagrin.“Yes, andthe and bike rack OnStar System
, wecanadaptittoour withitsultrafast
“I “I -
23 OPEL+ ACCESSORIES Opel+ Touring 24 OPEL+ ACCESSORIES Opel+ Touring floor matsinhisnewOpelAstra. solutions suchasthedoublyanchored Marcus Winterlovesneatdesign With gripandsmarts:Kitesurfer Kitesurfer andOpeldriver MARCUS WINTER OF FREEDOM.” ME, THAT’S THEESSENCE THE WAVES —FOR PLOUGHING THROUGH ONTO THEWINDAND KITEBOARD, HANGING “CLIMBING ONTO A
she willbeabletobuildupagoodspeed. bike.Hereontheisland, an ultralightsingle-speed — Jessica, meanwhile,isgoingtorideher“fixie” build sandcastles,Lucas andLinustoflytheirkites. on thebeach.Leni andMarcusareplanningto List, Linusandhisfatherjointherestoffamily water. holiday. Andwiththat, fatherandson taketothe the car—andmoreflexibilityinwhattheytakeon The roofboxhasgiventheWintersmoreroomin home. That’s nolongeranissue,thankheavens.” skateboard, Leni’s bicycle—thathadtobeleftat —akite, always something‘superimportant’ waswere oftenrowsaboutwhattotake.“There more stowageroom.Inthepast, headmits,there Opel roofbox!”saysMarcus.Crucially, itmeans aerodynamic design:everything’s rightaboutthe from Opel.“Easytofit, sturdyconstruction, much morewith themtothebeach. with alaugh.Especially nowthattheycanbring so should comeupheremoreoften!” saysJessica have failedtobuildherconfidence. “Maybewe Evidently allthoseepisodesof ShauntheSheep brothers makefriendswiththe woollymonsters. where shecanwatchfromasafe distancehowher afraid ofthesheep, runsandhidesinthecar, no opportunityforagroupphoto.Leni, who’s curiosity. sheep, whowatchthehumanactivitieswith Unloading thebikesattractsasmallflockof grass. sun breaksthroughandlightsupthedune By theafternoon,windhasdieddown.The room inthecar. was whenhisparentsknewtheyneededmore Linus discoveredkitesurfinglastautumn.That air. Thetwoofthemfetchtheirkitfromthe park. “Idealconditions,”saysLinuswithaknowing northwesterly windwhipsacrossthedesertedcar for beginnersandexpertsalike.Astiff, cold create asuperbbaywithclear, shallowwater, ideal Sylt. Heretheislandbendssharplyeastwardsto them drivetoaspitoflandatthenortherntip son, Linus,hasalreadysuccumbed.Thetwoof Marcus’ enthusiasmisinfectious,andhiselder through thewaves—that’s myideaoffreedom.” box andchangeclothesinthecarpark.
After aquicksnackinthetinyporttownof
Marcus pullsouthiscamera,butthere’s They optedforawhite roof box roof
school. can showoffhercatchat and dirt.Tomorrow Leni compartment fromsand protects theluggage handy hardcargotray from theseashore.The sunshine, windandshells A dayatthebeach,with
25 Touring THULE ROOF BIKE CARRIER PRORIDE 591 Touring + + UP ON THE ROOF
Opel THERE’S ROOM TO TAKE Whether it’s a weekend tour or a vacation trip, Opel with quick-release straps and an easily adjustable frame holder (frame sizes: 22 to 80 mm tubular ALL THE THINGS YOU LOVE or 80 to 100 mm, oval), your bike will be secured on the roof in no time. Made of aluminium, the roof bike carrier can be removed as a compact system from the base carrier. It is lockable and fits all tyre sizes.
Whether it’s a short trip or a long journey, your car has more room Suitable for the ADAM, Corsa, Mokka, than you think. With these perfectly tailored transport solutions in Zafira and Insignia the form of perfect customised accessories from Opel+, you can be versatile on holiday, at the weekend and every day of the week
OPEL+ TOURING TOP FOR THE THULE ROOF BOX MOTION 800 THULE SKI/SNOWBOARD CARRIER TIP CREATE SPACE XTENDER When you’re going on holiday, room can get ON THE PISTE MOKKA tight. Luckily the Thule Roof Box Motion 800 With six pairs of skis or four snowboards up features an enhanced design and an optimal use on top, you can safely head for the hills on of space. The Power-Click quick-mount system board the Mokka. Quick and easy to unlatch ensures simple fitting, and outside handles with large push buttons that can be operated on both sides guarantee easy loading and with gloved hands. Loading width of 60 cm; unloading. Safety too is a key feature: the key mounted on the base carrier. of the central-locking system can only be Similar products also available for the removed if all locking points are securely closed. ADAM, Corsa, Mokka, Zafira and Insignia Suitable for the ADAM, Corsa, Astra, Meriva, Insignia, Zafira and Mokka ACCESSORIES ACCESSORIES + + FLEXRAIL® DIVIDER BAR
OPEL DIVIDE AND RULE OPEL Reconfigure your cargo area to your exact requirements with just a few simple moves. The divider bar will ensure that everything remains exactly where it should. Combinable with other cargo area dividers, luggage nets and storage containers.
Suitable for the Astra K ST, Insignia ST and Zafira 26 27 28 Opel+ Touring Kitesurfer andOpeldriver MARCUS WINTER “THE NEWROOF BOX UPGRADE THECAR.” MEANS WECANEASILY Zafira andInsignia Suitable fortheADAM, Corsa,Mokka, also includestwo275 cmstraps. on andremovefromthebasecarrier. It board andtwomastsisveryeasytomount this lightweightaluminiumcarrierforone Take yourboardwithyouwherevergo: WINDSURFERS DEVELOPED BY THULE SURFBOARD CARRIER833
www.navigation.com/opel www.opel.de order todownloadtheappropriateupdate. model, productionyearandthenavigationsystemin or www.navigation.com/opel andenteryourvehicle material thereforemakegoodsense.Gotowww.opel.de average 12percentlessfuel.Regularupdatesofmap but alsoreachtheirdestinationfasteranduseon Satnav driversarenotonlymorerelaxedatthewheel ALWAYS ONTRACK NAVIGATION MAPUPDATES and Insignia Corsa, Mokka, Zafira Suitable fortheADAM, thanks toacentral-lockingsystem. to loadandunload,butalsooffers maximumsecurity to meetallyourneeds.Itisnotonlyeasyfitandsimple and aloadingcapacityof50 kg—morethanadequate with aglossyblacklid,thisroofboxhasvolumeof420 l Featuring astreamlinedshapeandanattractivedesign HIGHLIGHT INHIGH-GLOSS THULE ROOFBOX TOURING 780
subwoofers, a full-size sparewheeloranLPGtank subwoofers, afull-size Suitable fortheOpelInsigniaSportsTourer, butnotformodelswith cargo. TheblackFlexFloor The back-friendly solutionforpeoplewhoregularlyneedtoloadandunloadheavy TAKING THE STRAIN FLEXFLOOR 40 cm withaloadcapacityof120 kg. interior liningofthecargoareaInsigniaSportsTourer. It’s extendibleby COMPLETE INFORMATION ONTHEFULLRANGEOF TOURING ACCESSORIES FROMOPEL NEAREST DEALERSHIP CANBEFOUNDAT WWW. ® SLIDINGLOAD FLOOR OPEL-ACCESSORIES.COM/GB OPEL-ACCESSORIES. ® hasavelourscoveringthatperfectlymatchesthe COM/GB WWW.
+ ANDYOUR with atowinghitch Suitable forallvehicles to fourbicycles. also hasbikecarrierscapableoftransporting up for goingonholiday. For largerfamilies,Opel conventional bicycles,thisbikecarrierisperfect ortwo Suitable fortransportingtwoe-bikes BIKES ONHOLIDAY THULE BIKECARRIEREASYFOLD931 ST andZafira Suitable fortheAstraST, Insignia (26 equipment, thishandybox products, glovesandotheruseful Ideal forstoringcareandcleaning NEAT ANDTIDY fits ontotheFlexOrganizer in thecargoarea.Itiswaterproofand FLEXORGANIZER FlexOrganizer
x
12
x
9c) ep miti order maintain helps 19 cm)
® rail hooks(seebelow). ® STORAGE BOX ® rails and
29 OPEL+ ACCESSORIES Opel+ Touring 30 OPEL+ ACCESSORIES Opel+ The Best Choice CHOICE THE BEST OPEL Be inspired! easier. Andmorestylish.safe. Accessories fromOpel + + makeyourlife it’s alsoastatement.Astatementaboutyou! here arethe customised solutionsofferingmaximumsafety. Typical best waytointegrateouraccessories.Thisresultsin vehicles, engineersalreadythoughthardaboutthe signing theADAM, OpelAstra,Corsaandourother cases wellbeyondthelegalrequirements.Whende Each productisrigorouslytestedbyOpel—insome uncompromising standardsasourvehiclesthemselves. als andproduction,ouraccessoriesboastthesame ries complement oneanother—inbothdesign Opel takesanintegratedapproach: ouraccesso- less obvioussituations. It’s asafetyapproachthatalsoprovesitsworthin right downtothelastdetail. offers youahostofoptionswithguaranteedquality trustworthy transportandcarriersystems—Opel Top certifiedchildseats, preciseparkpilotsystems, alloy wheels perfect matchforyourlifestyle. With accessoriesfromOpelyourcarbecomesthe exciting designsandcleverfunctions.Try outourstylish comfortable aspossible.Discoverourfreshcolours, car asindividualyouwant—andsafe you yourself. freedom tomakeyourcarasuniqueandindividual And thesameappliestoour model. It’s anextraprecautionthatmakesgoodsense. also speciallytestedandauthorisedforeachvehicle protectionrequirements,butare internal side-impact comply withthelatestEUsafetystandards,including al. al. tune ofafloormatslippingunder theacceleratorped- ed byanyonewhohaseverexperienced themisfor —afeaturethatwillbeappreciat absolutely non-slip tion tosafety. Withtheir doubleanchorpoints,theyare interior carpetsbutalsomakeanimportantcontribu- example. Theynotonlyofferelegantprotectionforthe brushed on track in even the most difficult conditions. on trackineventhemostdifficultconditions. of completewinterwheelsthatwillreliablykeepyou does itsowntests.Thismeanswecanofferyoutheset Not everytyreissuitableforcar;that’s whyOpel A stainless-steel pedalcovers stainless-steel racing machine and a guardian angel. But racing machineandaguardianangel.But nications wizard,alovenest, apackhorse, means oftransport.It’s anoasis,acommu- car nowadaysissomuchmorethanjusta child seats , trendy outside mirrorcaps Take theOpelfloormats, for from Opel. They not only fromOpel.Theynotonly complete winterwheels
In termsofbothmateri- You canmakeyour . Discover the . Discoverthe and and - - - .
31 OPEL+ ACCESSORIES Opel+ The Best Choice 32 OPEL+ ACCESSORIES Opel+ The Best Choice hanger Opel! we therealready?Smartsolutions arestandardat journey. Sodon’t besurprisedtohearagroan: Are passengers remainentertained throughout the therebyensuringthateventheyoungest mini-cinema, guards but alsoprotectthevalueofyour car. Splash Accessories fromOpelnotonly sootheyournerves And italsomakeslifeeasier. and safety. versatile Opel alsohasagreatsolutionforlongertrips:our need toberemovedwhenthewindowsareopen. offers custom-fit PVC the bootafterasackofcomposttipsover?Opel minor, ofdailylife. Let’s face it:whowantstovacuum clever solutionstodealwiththestress,bothmajorand it’s child’s playtoclean.Our load fromslipping. Andifamishapshouldhappen, guarantees yoursafety. fromasinglesource:Opelquality know-how way oftheairbags.Take advantageofourunique that the block sunlight, our tailor-made seat, willhelpprevent crumpledblazers.Designedto and , attachedsimplytotheheadrestofafront smartphone holder tablet holders
In theeventofacrashit’s vitaltoknow body sidemouldings hard cargotrays willturntherearseatintoa isnotgoingtogetinthe FlexConnect coat Because itprovides privacy shades helpprevent tostopyour don’t vehicle isareasonforpride! recesses andourrearviewmirrorcovers.Aflawless something thatOpeltakesveryseriously. Being uptodatewithallthelatesttechnologyis transparent tar. aworthwhileinvestment—asareour They’re annoying paintdamageduetochippings,saltand to makeyourcarunique. new oneeveryday. Beinspired!Discoverthefreedom lic andCoffeeBean.Soifyoulike,canchoosea from GalaxyYellow andMidnightBlacktoRoseMetal- ment suchasa colour schemesforthecool with them.For theADAM, thereare22different trends. Tastes maychange,butyourOpelwillchange master newchallengesandtakeadvantageof you keepupwithallthelatestvehicledevelopments, your needs.Ourextensiverangeofaccessorieshelps models andcantellyouwhichsolutionbestmeets knowledgeofallour dealership. Theyhavein-depth cables. JustaskthesalespeopleatyourOpel resolution canalsoberetrofittedwithoutanyunsightly Director, InteriorDesign KARIM GIORDIMAINA THEM.” CHANGE WITH YOUR OPELWILL CHANGE, BUT “ TASTES MAY body-protective film rear viewcamera interior trim fordoor-handle withdigitalHD , ranging Equip-
33 OPEL+ ACCESSORIES Opel+ The Best Choice OPEL+ SAFETY
The reliable OPEL+ accessories make driving even safer. Your car will protect you if a critical situation should ever arise. 36 OPEL+ ACCESSORIES Opel+ Safety ON RISK FOCUSING A reportfromtheOpelSafetyCentre. the automakerdoingsothatyouandyourfamilycantravelsafely? How isOpelmakingitschildseatsevensafer?Andwhat Director GMEVehicle Safety EACH PART BEFORE AN ACCESSORY.” GÜNTHER SCHMALL OR OFFERED AS INSTALLED IN OUR CARS “WE TEST Integration IT IS
how importanttestsare. Martina Adameckknow Anatol Krausand Painstaking preparation: offered asan accessory,” saysSchmall. Theseparts individual partbeforeitisinstalled inourcarsor cutting-edge computertechnology. “We testeach various experimentalsetups,huge machinesand puts onsafetyisdownrighttangible hereamidthe labs andworkshops.Thehigh prioritythatOpel passing notonlyacrashtrack butalsodozensof Centre inRüsselsheim.It’s avastfacility, encom a crashtestdummy tions andthesmall,shakenpassengerisinreality Opel. The“accidents” occuratoneofhisworksta Integration, Schmallistheleadingsafetyexpertat his job.AstheDirectorGMEVehicle Safety the accident.Andhedoessoregularly, becauseit’s The man’s nameisGüntherSchmall.Hecaused a fewmetresaway. with satisfactionasheobservestheaccidentonly it backintothechildseat.Atall,slimmannods restrains thesmallbodyaninstantlaterandpulls A
are catapultedforwarduntiltheseatbelt the air cle, causingadullbangtoripthrough intoanobsta- vehicle crasheshead-on . Theoccupant’s headandarms . We areintheOpelSafety -
-
37 OPEL+ ACCESSORIES Opel+ Safety 38 OPEL+ ACCESSORIES Opel+ Safety the body’s weight. the body’s correspond toabout25times forces actingonahumanbody occurs atonly50km/h,the collision Even ifahead-on tests areconducted approved forsale. child seats different safety with Opel 14 they are before +
Moreover, Opeldeliberatelytestsitschildseats seats thatperfectlymatchtheir cars,”saysSchmall. the rearseat’s tabletholder,forexample. accidents don’t causethechildseat tocollidewith together withotheraccessories tomakesure only 50km/h,theforcesactingonahumanbody collisionoccursatly violent.“Evenifahead-on per hour, thecollision hereinthehallissurprising vehicle againsttheobstacleatjust50kilometres that arebeingtestedtoday. vehicle model. seats areseparatelytestedand approvedforeach To ensuremaximumlevelsofsafety, Opel’s child automotive accidentsin2014. alone, 10,765childpassengerswereinvolvedin common outsidethetestlabaswell.InGermany thus itsseriousness.Suchsituationsarealltoo says Schmallabouttheintensityofcrashand weight,”correspond toabout25timesthebody’s striking. The imagesoftheactualcrashareparticularly says Schmall. beyond theminimumlevelsrequiredbylaw,” standardsweuseforourtestsgofar“The customizable alloywheels andthechildseats assistant toavarietyofroofracktraysystems, range fromafrontcamerawithtraffic-sign data canbeevaluatedinthelab. inside thevehicle.Aftertestiscompleted, the datafromsensorstoameasuringsystem “accident” downtothelastdetail.Cablestransmit images perseconddocumenteveryaspectofthe special digitalcamerasthattakeupto2,000 chest,head, neck, spineandpelvisaswell Even thoughthecablewinchpulled Ultrafinesensorsonthedummy’s “As aresult, customersgetchild
- GO FAR BEYOND THE MINIMUM Director GMEVehicle Safety ARDS WEUSE REQUIRED BY “THE STAND- GÜNTHER SCHMALL LEVELS LAW.” Integration
consequences, particularlyinthefieldofsafety. involved, unjustifiedcompromisescanhavefatal Although amassiveamountofuniqueworkis the SafetyCentre. unhurt andbackatitsusualplace onabenchin happened tothesmallcrashtest dummy?It’s the crashtestswithflyingcolours. Andwhat show thatallofthechildseat’s componentspassed design, materialandworkmanship, theresults results ofthelatestseriestests. Safety specialistSchmallisverysatisfiedwiththe With regardto children”. of his“test takes goodcare Anatol Kraus
39 OPEL+ ACCESSORIES 40 OPEL+ ACCESSORIES Opel+ Safety 24/7 SAFETY FIRST, SAFETY night, aloneorwithyourfamily, andineverykindofweather. benefit fromthereliablesafetyaccessoriesofyourOpeldayand Don’t leaveanythingtochancewhenyou’re ontheroad.You will a high-resolutioncolourimage.Assoonasitgets noeuvre moreeasily. Duringtheday, it showsyou Available fortheAstra ture thatproducesblack-and-white images. the systemswitchesonanightvisionfea dark, can seeeverythingbehindyouclearlyandma that ismountedontherearbumpersoyou Your thirdeyeforparkingconsistsofacamera MANOEUVRING WITHREARVISION REAR VIEWCAMERA - -
SAFETY
OPEL
+ PREMIUM K-SUMMIT KÖNIG SNOW CHAINS — Suitable foravariety ofmodels long-lasting. be used,makingthemespecially snow andice.Bothsidesofthechains can tensioned sothatyoucandrivesafely on These snowchainsareeasilyfitted and COLD COMING INFROMTHE
depending onthe child’s age Available forall vehiclemodels, childrenweighingupto36 kg.school-age and 9–18 kg totheKIDforolderpre-school 13 kg andtheDUO(left)forchildren weighing BAB ard. Theyrangefromthestartermodel cordance withtheEuropeaninspection stand- Opel SAFETY FORCHILDRENOFALLAGES CHILD SEATS DUO, KID, BABY-SAFE relevant ECEandDINrequirements. legally prescribedfirstaidequipmentthatmeetsall triangle, asafetyvestandfirstaidkitcontainingthe European roads.Thepackagegivesyouawarning Safety accessoriesareanabsolutemustonmost IN CASEOFEMERGENCIES SAFETY KIT Available foravarietyofmodels sound sensorsthatdetectallobstacles. any mishaps.Thesystemhasfourultra into evennarrowspacesinreversewithout yourself, asthePark Pilothelpsyoupark You nowonlyhavetofindaparkingspace SQUEEZE INTO ANYGAP UNIVERSAL PARK PILOT Y-SAFE (right)forchildrenweighingupto + childseatsoffercertifiedsafetyin ac- CHILD SEATS THAT PERFECTLY MATCH “CUSTOMERS GET Head GMEVehicle Safety THEIR CARS.” GÜNTHER SCHMALL Integration - Suitable foravarietyofmodels colours white,blue,green,yellowandpink. the typicalxenoneffectbutarealsoavailablein Philips halogenheadlamps,whichnolongeronlyhave You candemonstratestylishnessandhighclasswith STRONG LIGHT HALOGEN HEADLAMPS TOWING ROPE gently andjolt-free. lets yourcarbetowedaway tensile loadsofupto3,000kg outside help, this towing ropefor If youeverneedtomoveforwardwith GREAT PULLINGPOWER
41 OPEL+ ACCESSORIES Opel+ Safety 42 OPEL+ ACCESSORIES Opel+ Favourites ITES FAVOUR OPEL Here aresomeexamples… a favouriteaccessory. brand ambassadorsalsohas Every oneofOpel’s famous + Fashion model,regardingtheinteriortrimkitfor Actor, regardingtheski/snowboard carrier KEN DUKEN JUMP.” FOR EVERY WELL-EQUIPPED “IT ENSURESI’M OWN PERSONALSTYLE.” “THIS WAY, ICANALSO FURNISH MY CARINMY Eva Padberg the ADAM RIMS MAKETHE OPEL INSIGNIA “THE 20-INCH regarding thePowerFlex AirWellness fragrance diffuser PERSONALISED ATMOSPHERE LOOK EVEN SPORTIER.” about thealloywheelswiththeir “I LOVE THE FRESH, Trainer ofLiverpoolF.C., 7-turbine-spoke design 7-turbine-spoke IN MY CAR.” NADJA UHL JÜRGEN KLOPP Actress,
DEALERSHIP AT WWW.OPEL-ACCESSORIES.COM/GB YOU CANFINDCOMPLETEINFORMATION ABOUT OPEL smartphone holder Actress, regardingtheuniversal Bettina Zimmermann ALL TIMES.” SMARTPHONE AT EYE ONMY “IT LETSMEKEEPAN + ACCESSORIES ANDYOUR NEAREST OPEL-ACCESSORIES. COM/GB WWW.
43 OPEL+ ACCESSORIES Opel+ Favourites OPEL+ COM- FORT & CARE Accessories from Opel+ make driving a delight. People who spend lots of time in their cars are especially likely to appreciate the clever accessories that make life be- hind the steering wheel more comfortable. 46 OPEL+ ACCESSORIES Opel+ Comfort & Care RELAXED MOBILE AND time. inside thecarcanturndriver’s workingdayintoquality details half thedaybehindwheel.Thewell-conceived Pharmaceutical consultantslikeJuanCarlosMartínezspend boss usesaniPad to explain thelatest customer visitsin Carlos Martínez’ Barcelona: Juan regarding the Final details and around results. S Martínez, who is now 47, will have spent four hours Martínez, whois now47,willhavespentfourhours Cambrils. Whenhecomeshome intheevening, that hehastovisitcustomersinBarcelona, Sitgesand When Martínezcheckshisappointment book, addresses andtips. tem canalsohelpMartínezbygiving himinformation, Insignia evenmorereliable.Inan emergency, thissys OnStar system,whosevehiclediagnosesmakethe tendible cargofloorand,evenmoreimportantly, the its manyconvenientfeaturessuchastheFlexFloor ex - design. However, he alsochosethevehiclebecauseof company carwasthevehicle’s elegantcontemporary sons whyhisbossoptedforanOpelInsigniaasa pearance ishalfthebusiness,”hesays.Oneofrea- er visitthemwearingawrinkledjacket.“A goodap informal “tú” withmostofhiscustomers,hewouldnev- datory eveninmidsummer. AlthoughMartínezusesthe sector hasastrictdresscode,andsuittieareman- hangs uphissuitjacketbehindthedriver’s seat.The hatch closeswithaquietclickwhileMartínezcarefully tomers arealmostlikevisitstofriends.Thevehicle’s Salvat. Aftersuchalongtime,appointmentswithcus consultant fortheSpanishpharmaceuticalcompany For thepast15years,Martínezhasbeenacustomer boss byslappinghimontheback. briefcase next totheboxes andsaysfarewelltohis of hisOpelInsigniaSportsTourer, putshis of medicine and brochures into the cargo area verve JuanCarlosMartínezliftstwoboxes full ay ‘hello’ forme!” —“Yep, willdo!”With he sees hesees - - -
47 OPEL+ ACCESSORIES 48 OPEL+ ACCESSORIES Opel+ Comfort & Care NEW CUSTOMERS WHEN YOU HAVE TO DEALWITH STAYS YOUNG “YOUR MIND EVERY DAY.” JUAN CARLOS MARTÍNEZ Customer consultant requirements everyday,” hesays. when youhavetodealwithnewcustomersandtheir gretted hischoiceofacareer. “Your mindstaysyoung scientist throughandthrough.Martínezhasneverre respect, Martínez,whohasaPh.D. inchemistry, isa again tomakesurehedoesn’t forgetanything. Inthis and approvalofeachproduct.Buthechecksitall results, becausehecarefullymonitorsthedevelopment the factsandfigures,ofcourse,aswellresearch new dietarysupplementfortinnituspatients.Heknows he canonceagaingothroughthepresentationof customer oftheday, MartíneztakesouthisiPad sothat in theEixampledistrict.Beforemeetingwithhisfirst centre, thentheopulentfaçadesofresidentialbuildings first seesthefuturisticofficetowersofexhibition town Barcelona.Inthecar’s rearviewmirror, Martínez moving sluggishlyalongtheGranViatowardsdown- much timeinacarwantstofeelwellthere.Trafficis motorways andcountryroads.Anyonewhospendsso behind thewheelandcoveredover310kilometreson the motorway. Aftergettingsomecoffeeandbaked appointment, Martínezstopsatafillingstationalong Because hestillhassometimeuntilhisnext customer driver’s seat. driver’s behind the coat hanger the FlexConnect on wrinkle-free His jackethangs folding table. FlexConnect coffee onthe him isacupof coast. Infrontof break atthe Martínez takesa Juan Carlos - and livingroom. family tofeelaswellhedoesinhismobileoffice way there.Martínezsayswithagrinthathewantshis and his11-year-old sonwantstowatchvideosonthe Tomorrow, hewillvisithisgrandparentsinthecountry, attachment atthedriver’s seatwithatabletholder. front door, hereplacestheFlexConnect coathangar “Bingo!” says his colleague at headquarters. “Bingo!” sayshiscolleagueatheadquarters. system. again?” asksMartínezthroughthehands-free camp groundmissthebeginningofholidayseason pointment inSalou.“Didthepharmacyatlocal An employeeaskshimwhetherhecaninsertanap steers hisvehiclebackhome. The sunisalreadylowintheskywhenMartínez The phoneringsrightafterhehasdrivenoffagain. coastal roadintoGarrafNaturalPark. goods, hedriveshisOpelInsignia alongawinding more valuablethananentiredayoff,” saysMartínez. the sandybeachofCastelldefels.“Suchabreakis breeze blowsthroughholmoaksandpalmtreesabove has parkedhisvehicleonthesideofroad.Asoft beautiful tositatabarcounter,” saysMartínezafterhe the pharmaceuticalcon- After a short break at a After ashortbreakat filling station,thenavi- sultant tohisnextcus gation system guides gation systemguides Before he unlocks his Before heunlockshis “The day is too dayistoo “The - -
A restaurantwithaharbourview An OldTown barandrestaurant A tapasrestaurant andwinebar www.ultramarinosbarcelona.com A brunchandbreakfastcafé A beergardenonMontjuïc A vermouthandtapasbar www.picnic-restaurant.com LA CASETA DELMIGDIA Ctra. deMiramar, 38 www.baliusbar.com ULTRAMARINOS www.lacaseta.org www.ocana.cat MARTINEZ TIPS OCAÑA PICNIC BALIUS
49 OPEL+ ACCESSORIES Opel+ Comfort & Care POWERFLEX SMARTPHONE HOLDER COMFORT & CARE PHONE CHARGING STATION It’s the perfect place for your mobile if you want to Comfort & Care Comfort & Care make calls, use it to navigate or simply recharge the + + TURN YOUR VEHICLE INTO device. The holder comes with a micro-USB charging cable so that the vehicle’s USB slot can be used for Opel Opel other devices. The PowerFlex adapter is required for A COMFORT ZONE use (see below). Suitable for the Astra K
A comfortable vehicle means a better quality of life.
You can look forward to making every ride in an Opel POWERFLEX ADAPTER a gratifying experience — for drivers and passengers alike. ALWAYS WITHIN REACH PowerFlex — the name says it all. Full of energy and highly flexible, this all-new modular system is based on the adapter in the centre console. It can be combined with a smartphone holder, for example, or with the AirWellness fragrance dispenser.
Suitable for the Astra K OPEL+
WWW. COMFORT OPEL-ACCESSORIES. COM/GB & CARE TO OBTAIN COMPLETE INFORMATION ABOUT ALL THE COMFORT & CARE ACCESSORIES FROM OPEL+ AND ABOUT YOUR NEAREST DEALER, GO TO WWW.OPEL-ACCESSORIES.COM/GB
AIRWELLNESS FRAGRANCE DIFFUSER TOP MARKS IN AROMA FRAGRANCE CARTRIDGES You can now refresh yourself in your car as FRESH AROMA ACCESSORIES ACCESSORIES
+ well. When you turn on the AirWellness The replaceable cartridges of the fragrances + fragrance diffuser, the air is filled with one of Energizing Dark Wood and Balancing Green Tea last
OPEL two different pleasant scents: Energizing for 40 hours of operation and are available in refill OPEL Dark Wood is redolent of the powerful packages containing four cartridges each. fragrance of a forest. Balancing Green Tea SMOKER’S PACKAGE Suitable for the AirWellness Fragrance Diffuser provides the interior with a delicate, (left) CONVENIENT DUAL balancing touch. The replaceable fragrance PACKAGE cartridges are available separately, as is the Cigarette lighter and ashtray in a dual pack- PowerFlex adapter, which enables you to use age. The lighter fits into the 12-volt socket; the device (right). the ashtray is designed for the cupholder so that you have both in easy reach. Available for the Astra K Suitable for the Astra, Zafira and other models 50 51 52 OPEL+ ACCESSORIES Opel+ Comfort & Care FLEXCONNECT TABLET HOLDER models Suitable fortheInsignia,Astra,Corsaandothermodels,except OPC Air, for theiPad miniandfortheSamsungGalaxyTab 3/410.1. vehicle. Four differentholdersareavailable:fortheiPad 2,3and4,fortheiPad now usetheirtabletcomputers,thankstoastableWi-Fi connectionwithinthe Passengers youngandoldaresuretobequietinthebackseat, because theycan GOOD ENTERTAINMENT FLEXCONNECT ADAPTER OPC models Corsa andothermodels,except Suitable fortheInsignia,Astra, attachments aresecurelyfastened. headrests andensuresthatthe attachments ismountedonthefront This basecarrierforallFlexConnect ONE FORALL 7 FITS DEVICES DIFFERENT FLEXCONNECT HOOK OPC models Corsa andothermodels,except Suitable fortheInsignia,Astra, bags, shoppingbagsandclothing. convenient solutionforstowingshoulder a singlehookhastobeattached.It’s a also demonstratedbythefactthatonly a varietyofapplications.Itsversatilityis FlexConnect isaneasy-to-use systemfor HOOKED UP OPC models Corsa andothermodels,except Suitable fortheInsignia,Astra, as hotels. use itoutsidethevehicleinplacessuch along withthejacketsothatyoucan more, thehangercanbetakenoff What’syour blazeriswrinkle-free. FlexConnect coathangarensuresthat you needtowearabusinessoutfit?The Do youhaveanappointmentwhere WRINKLE-FREE FLEXCONNECT COAT HANGAR models Available fortheMokka Xandother and easilythankstoaneasy-clip fastener. pouches. Theshadescanbeattached quickly setsthatcomewithstorage two-piece by followingvehicles.Theyareavailable in against thesun’s raysandthedazzlecaused The customisedshadesprotectoccupants A PROTECTED REARVIEW PRIVACY SHADES—REAR WINDOW FLEXCONNECT FOLDINGTABLE except OPCmodels Suitable fortheInsignia,Astra,Corsaandothermodels, securely keepscupsinplace. manner.space-saving Italsohasanintegratedflexiblecupholderthat stable surfaceonwhichtoworkoreat, anditcanbefoldedawayina traylikeonaplane—onlybetter!Thetableoffers A fold-down SET THETABLE models Suitable fortheMokka Xandother from gettinginsidethecar. shades preventmosquitoesandwasps advantage isthatthesetsoffourprivacy windows arerolleddown.Another protect againstthesunevenwhen interior fromheatingup, becausethey shades forsidewindowspreventthe Convenient forhotdaystoo:Theprivacy FACTOR FULL SUNPROTECTION PRIVACY SHADES—SIDEWINDOWS
53 OPEL+ ACCESSORIES Opel+ Comfort & Care OPEL+ PRO- TEC- TION Whether your car has to contend with puddles, four-legged companions or rustic cargo — accessories from Opel+ protect the body and the interior against dirt and moisture and keep your car in perfect condition. 56 Opel+ Protection AND DALE OVER HILL situation andisperfectlyprotectedagainstmuddirt. selves. To doso, theyneedtohaveavehiclethatcanhandleany Harald Irkagointothewoodsandvisitsmallmanufacturersthem- In theirongoingsearchforspecialproducts,youngtopchefssuchas cuisine atSazianiStub’n toques Gault-Millau restaurant became thechefde www.neumeister.cc guide. Healready points andthree Harald Irkainthe when he was19. 18 Mokka X enableshim Whenever hehasthe are awardedto to easilydrivealong goes intothewoods narrow forestpaths. well-protected Opel himself inorderto gather herbsand time, HaraldIrka mushrooms. His T surroundings close totheSlovenianborder. Irkapre The restaurantisnestledinwildly romanticnatural de cuisineattheSazianiStub’n inStraden,Styria. ents thatmeethisrequirements. HaraldIrkaischef knowing howandwherehecan getalltheingredi- has anunerringtasteandinstinct whenitcomesto rise. AnativeofthecityLinz, heisverycasualand Irka himselfissometimesastounded byhismeteoric same agearetheyoungesttopchefsinworld. indeed. At24,heandanItaliancolleagueofthe for somepeople,butHaraldIrkaisaspecialcase the gourmetworldissimplyanexpressionoffolklore tria’s mosttalentedchef.” Thetoughcompetitionin the restaurantguideGault-Millau named him “Aus pinnacle ofAustria’s cateringsectorin2015,when with theverybest.Thispassionpropelledhimto ingredients forculinarydelights,heisonlysatisfied senses. HaraldIrkaissuchaperson.Whenbuying suited tohedonistswhowantgratifyalloftheir Weekly markets,ontheotherhand,aremore others simplycallapizzadeliveryservice. Most peopledrivetothesupermarket, while here aremanywaystoshopforgroceries. - -
57 OPEL+ ACCESSORIES Opel+ Protection 58 OPEL+ ACCESSORIES Opel+ Protection espresso —small butstrong. With thisSUV, Irkacan Thevehiclesoundslikean trips: anOpelMokka X. loyally accompanieshimonhis specialshopping gruelling paths.Irkahasalsochosen apartnerwho woods. To do so, heisalsowillingtotravelalong and manufacturersorhegathers themhimselfinthe many oftheproductsfromneighbouring farmers ingredients forhisingeniouscuisine. with everyonewhocansupplyhimthebest For Irka,it’s onlynaturaltocultivategoodrelations he says. cookingtechniques,” new ideasandstate-of-the-art season. “We’re tryingtoserveAustriancuisinewith fers regionalingredientsthatareinkeepingwiththe Star chef HARALD IRKA NECESSARY.” GIENE AREABSOLUTELY LINESS ANDGOODHY “FOR USCHEFS,CLEAN- Heobtains - fish offthestoveandletitcoolforabout B garnish withtheWelsh onion blossoms. in a non-stick pan.Seasonthefishwith in anon-stick pour themixturethroughasmallsieve. mix thematthehighestsettinguntil sorrel juicemergeswiththebutterand servings. Nowheatsomerapeseedoil white pepperandthenfryitgently. As capers togetherwiththerapeseedoil, soon asthefishisgoldenbrown,add plate. Putthehotfishinmiddleof 1 catfishfillet(250g),whitepepper, 20gbutter, 1 the garlic,thymeandbutter. Take the of theingredientsintoablenderand D juicy andhaveaglassyappearance. A Extract thejuicefromsorrel.Fill all one minute.Thefishshouldnowbe the plateandseasonwithseasalt. C Sprinkle caperoilonthefishand (ed. byAnnaandAlbertNeumeister), Place somesorrelbutteronacold Cut thecatfishfilletintoindividual The recipeisfromthecookerybook Maldon SeaSalt, Welsh onionblossoms photography: MarionLuttenberger After youhavefinelypuréedthe 80g butter, 100gsorrel,20gverjuice 50g capers,rapeseedoil clove ofgarlic,1thymesprig B Terroir byHaraldIrka D –SORRELBUTTER RECIPE C –PREPARATION A the verjuice. – CAPEROIL CATFISH –CATFISH
perfection —and only interestedin well andhelikes ents heuses.He that alsoapplies in thekitchenof to getapplesin Harald Irkaisa culinary genius to theingredi- Straden. Heis suppliers very knows allthe the Saziani Stub’n in person. Irka isfondofautomobiles. wheels preventthatfromhappeninganyway. cross race,butthesplashguardsinfrontof made hisvehiclelooklikeaquadfollowingmoto dles, To behonest, Irkawouldn’t mindifsuchaspin and overdirt-covered lanesfullofpotholesandpud- afraid todrivealongnearlyimpassableforesttrails wrecked. Inordertoobtainfreshherbs,heisnot without havingtoworrythathisvehiclemightget easily reacheverythingandeveryonehewantsto reduction ofall things intofocusedenjoyment. The onlythingthatultimatelymatters istheintelligent technology,the-art whetherinthekitchenorcars. Proskinds relaxingandtrouble-free. likestate-of- Mokka Xaccessoriesmakesshopping tripsofall course,” saysHaraldIrka.The easy handlingofthe This alsoappliestothefoodsupply chain,of are absolutelynecessaryforachieving goodresults. to clean. “For us chefs, cleanliness and good hygiene out ofthevehiclewithaflickwristandiseasy pings? Noproblem!Therubbermatcanbetaken mentation smells.Butwhataboutchickendrop plastic sheetsandnofeltmatswithingrainedfer stack updelicategroceries.Therearenosliding from theOpelProtection seriesletsdriverseasily the loadingarea,astrongyetcompact and fruitjuicesfromcausingscratchesorstains.In perfectly matchingprotectivefilmthatpreventsboxes Theedgesofthebootarecoveredbya Mokka X. careful asheloadsthegoodsintobootofhis vegetable grower, Irkadoesn’t havetobeexcessively a chickenfarmerandtalkingshopwithfruit farmers arealsoalotoffun.Afterhavingchatwith Mokka X ensuresthatHaraldIrka’s tripstoorganic to do, there’s apropertimeforeverything. TheOpel a yeartomaketestdrives.Althoughit’s acoolthing a Ferrari, soheandhisfriendtraveltoModenaonce Heyearnsespeciallyfor rubber mat - -
-
59 OPEL+ ACCESSORIES Opel+ Protection 60 OPEL+ ACCESSORIES Opel+ Protection YOU —PROTECT IT YOUR VEHICLENEEDS and dailyusecannotaffectit. sure thatwindandweather, dirtyordamagedroads for aslongpossible,youshouldmake If youwantyourcartolookgoodandattractive Insignia ST, Zafira Available forthe Mokka X, Astra ST, installed. be foldeddownevenwhenthesafety guardis through thevehicle,becauserear seatscan any way, either. Cargo canstillbeloaded rear seats’headrests.Itdoesn’t restrictyouin The doggridcaneasilybeinstalled behindthe pets safeandsecure. and keepsthefamily’s passenger compartmentfromthecargoarea This customisedfeatureseparatesthe DOG ONBOARD DOG GRID
PROTECTION strain onthewindscreenwipers. The coverensuresaclearfrontalviewandalsoreducesthe have toscrapeiceofftheirwindscreensthenextmorning. When temperaturesdropbelowfreezingatnight, drivers A CRYSTAL-CLEAR VIEW WINDSCREEN PROTECTOR
OPEL
+ Appropriate forallmodels four lockingwheel boltsalongwiththeappropriatewrench. theft ofcovetedlight-alloy wheels.Eachpackage contains and lockingwheelbolts.Locking wheelboltspreventthe and corrosionbyvisuallyappealingcaps forwheelnuts wheelsneedtobeprotectedagainst dirt, High-quality salt PROTECTING AGAINST RISKS LOCKING WHEEL BOLTS CAPS FORWHEELNUTAND ADAM-FLAIR OUTDOORCARCOVER are alsoavailableforothermodels Available fortheKARL.Similarbodysidemouldings the vehiclecolour. primedandpaintablein appearance. Theyareself-adhesive, side mouldingsfurtheraccentuatethevehicle’s athletic The KARLisextremelyeyecatchingbynature,andthebody SPORTY LINES BODY SIDEMOULDINGS and otherexternalinfluences. protects yourvehicleagainsttheweather water-repellent, softandbreathablecovering Bespoke clothingforyourADAM: The SNUGLY COVERED
NEW NOW KARL THE FOR
61 OPEL+ ACCESSORIES Opel+ Protection 62 OPEL+ ACCESSORIES Opel+ Protection CARGO NET Available fortheMokka X andother models suddenly brake.You won’t bebotheredbyclatteringnoisesanymoreeither. area andcouldquicklyturnintodangerous projectilesifthedrivershould that securesalloftheitemswould otherwiseliearoundloseinthecargo You won’t havetoworryaboutslidingcargoanymore,thanksanelasticnet EASY PARKING SPLASH GUARDS Available formanymodels paint job. mud androadsaltfromdamagingthe effectively preventloosechippings, attached withouttheuseoftools,and The splashguardscanbeeasily PURE JOY available forothermodels Similar floormatsarealso make themslip-proof. built-in Opelquick-mount systemto ADAM andcanbeattachedtothe are custom-madeforthenewOpel velour floormatsinbrownandblack Bearing distinctive“ADAM” lettering, the A GOODFOOTING VELOUR FLOOR MATS thoroughly testedona test rigbeforetheyare long accessoriesare weeks —that’s how approved foruse in Opel vehicles. 26 are alsoavailableforothermodels Available fortheMokka X. Similartrays from spillingout. provide additionalsupportandpreventliquids way.and non-damaging Thehighedges enable youtostowcargoinaclearlystructured coating.surface andananti-slip Thetrays stowage trayswithawater-resistant rubber To keepyourbootclean,weoffercustom WONDERFULLY CONVERTIBLE HARD CARGOTRAY for othermodels Similar floormatsarealsoavailable ensures thattheyareslip-proof. Opel’s standardquick-mount systemforfloormats provide thefloorswithperfectandaffordableprotection. The durableandrobustfloormatsforthenewOpelAstra A GOODGRIP ECONOMY FLOOR MATS THE OPEL TO OBTAIN FULLINFORMATION ABOUTALL WWW.OPEL-ACCESSORIES.COM/GB + PROTECTION ACCESSORIES ANDYOUR NEAREST DEALER, GOTONEAREST DEALER, RHD FLOOR MATS available forothermodels Similar rubbermatsarealso from affectingthecarpet. “Astra” preventmoisture,dirtandsnow The rubbermatssportingthename these floormatsinwet(winter)weather. Your vehiclewillespeciallybenefitfrom WEATHER AGAINST WINDAND OPEL-ACCESSORIES. COM/GB WWW.
63 OPEL+ ACCESSORIES Opel+ Protection 64 OPEL+ ACCESSORIES Opel+ Fan Site 1 OPEL CASUAL ELEGANCE The classic polo shirt has always symbolised high-end leisure and casual elegance. This shirt’s + appeal is further enhanced by the discreet Opel logo on the front, making it a real must-have! The shirt is of top quality, consisting of 94 per cent FAN combed cotton and six per cent Lycra, which together ensure an extremely comfortable feel and a truly premium look. The yellow button facing and embossed buttons show how much attention was paid to details. SITE People who drive an Opel know why. Driving pleasure creates devot- ed Opel fans who like to show off their stylish fan merchandise. ENHANCED LISTENING EXPERIENCE To ensure you always get the right sound, we offer high-quality headphones that feature an Opel isn’t just a car brand, it’s also a mindset! This extravagant zipper design. They are perfect travel means that Opel drivers aren’t only interested in top companions, boasting an impressively elegant performance, equipment, technology and styling, look and top sound quality. The headphones are they are also known for their versatility. This flexibil- in a trendy black-and-yellow colour combination ity should also be expressed outwardly by elegant ONE CUP OF COFFEE and are made of high-quality aluminium and accessories that document two other attributes of to WITH CREAM, PLEASE! plastic. A discreet highlight is the day’s Opel drivers: stylishness and modernity. Show Whether you use it in your office or laser-engraved Opel lightning workshop or at the breakfast table, bolt. Experience a perfect sound your individualism and your love of the lightning this elegant cup sporting the Opel logo wherever you want. brand! will surely make your coffee taste twice as good. The cup is made of white porcelain. It is scratch-proof, dishwasher-safe, and has a heat-resistant bottom made of bright yellow silicone. Volume: 0.3 l.
3 - 2
PARTY MOOD ON THE ROAD 4 Do you want to listen to your favourite music with a perfect sound while on the go? If so, get this black-and-yellow Bluetooth loudspeaker with a micro-SD card slot and the Opel lightning bolt. The speaker is made of metal and silicone, offers a hands-free feature and has a Bluetooth range of up to 10 metres. Measuring only 62 this small speaker creates a real club feeling plug it in and start to dance!
PULL OUT 5THE RIGHT CARD IN A FLASH The Opel card holder is the perfect place for your membership, ATM and credit cards. The holder is made of top-quality goat nappa leather and features five convenient compart- ments. In addition, the main compartment has a yellow lining, and the front is graced by the Opel lightning bolt.
x 62 NEVER BE WITHOUT A TABLET CASE! You and your tablet will love this tablet case x 57 mm, made of trendy neoprene. The ten-inch case has the perfect shape for most tablet models. It is . Just slightly narrower at the top so that the tablet cannot fall out easily. The contrasting yellow seam gives the case a distinctive highlight, and the yellow Opel lightning bolt is sure to wow you with its graffiti design. 6
A TIMEPIECE WITH A SPORTY LOOK The black-and-yellow7 Opel Chronograph is an accessory for trendsetters, boasting a high-quality matt-black stainless steel case. With its matt-silver hands, date display and a diameter of 45 mm, the watch looks great on men and women alike and gives every outfit a sporty touch.
65 Opel+ Fan Site WhiteVision
Fan Site Fan Intense white xenon eff ect +
Opel • Maximum visibility, premium look • Maximum white light for greater contrast • Philips original equipment quality • High-quality quartz glass
CASUAL LOOK • 100% road legal Make way for the Opel gang! These T-shirts featuring a contemporary used look will put car and Opel fans into a good mood all year round — not just in summer. The T-shirts for the gang’s girls are enhanced with Swarovski® crystal lettering and are available in the colours taupe and dark grey. The leaders of the gang wear 8 T-shirts in grey and olive green.
ColorVision Add a touch of color
• Innovative coating technology in blue, green, yellow or purple MERCHANDISE AND YOUR NEAREST OPEL + • 60% more white light* on the road TO FIND COMPLETE INFORMATION ABOUT THE OPEL • Philips original equipment quality DEALER, GO TO WWW.OPEL-ACCESSORIES.COM/GB • High-quality quartz glass • 100% road legal
WWW.
9 COM/GB OPEL-ACCESSORIES.
Premium Kits ALWAYS POWERED UP For increased safety Because smartphone batteries tend to be depleted just when you most urgently need your mobile, you can now get a convenient powerbank that will help prevent such situations. The device, which sports ACCESSORIES
+ the Opel lightning bolt, serves as an external rechargeable battery. It has a versatile 3-in-1 cable and ensures that you always have your own power
OPEL source no matter where you are. Despite its light weight of 115 g and a width of only 1.2 cm, the handy component has a phenomenally high capacity: 3,000 mAh. Anyone who gets a Opel power bank is sure to keep it. A PERENNIAL FAVOURITE Many people wouldn’t leave home without a cap. This For increased safety, it is recommended by most European countries that all black baseball cap with a fringy, casual washed-look Opel logo is an especially popular piece of headgear. vehicles be equipped with a homologated spare kit. Compulsory in some European Because it’s solid black, the cap also goes with almost countries, having a homologated spare kit in a vehicle will not only keep drivers any outfit. A nice detail is the embossed metal fastener bearing the Opel lightning bolt. in compliance with the law but will also keep them safer as they will always be prepared to replace a burned-out lamp.
66 10
page 3 GM leaflet A4_korr.indd 2 07.07.16 13:43