Queensland Government Gazette
PUBLISHED BY AUTHORITY ISSN 0155-9370
Vol. 382] Friday 15 November 2019
Christmas DQG New Year Dates DQG Closing Times for 201-20
Final 201 Gazette ² Published )ULGD\'HFHPEHU 201
Deadlines9DFDQF\$SSRLQWPHQWV
7REHVXEPLWWHGE\QRRQRQ7XHVGD\'HFHPEHU 'HDGOLQHV2WKHU*D]HWWHQRWLFHV
7REHVXEPLWWHGE\QRRQRQ:HGQHVGD\'HFHPEHU )LQDO$SSURYDOVE\FORVHRIEXVLQHVV:HGQHVGD\'HFHPEHU
First 20 Gazette Published FridayJanuary 20
Deadlines9DFDQF\$SSRLQWPHQWV
7REHVXEPLWWHGE\QRRQRQ7XHVGD\'HFHPEHU
'HDGOLQHV2WKHU*D]HWWHQRWLFHV
7REHVXEPLWWHGE\QRRQRQ7XHVGD\'HFHPEHU
)LQDO$SSURYDOVE\FORVHRIEXVLQHVV7XHVGD\'HFHPEHU
,I\RXKDYHTXHULHVUHJDUGLQJWKLVPDWWHUSOHDVHGRQRWKHVLWDWH WRFRQWDFWWKH*D]HWWH7HDP[email protected]
[367]
Queensland Government Gazette Extraordinary PUBLISHED BY AUTHORITY ISSN 0155-9370
Vol. 382] Friday 8 November 2019 [No. 72
Acquisition of Land Act 1967 State Development and Public Works Organisation Act 1971
TAKING OF LAND NOTICE (No. 5) 2019 Short title 1. This notice may be cited as the Taking of Land Notice (No. 5) 2019. Land taken 2. The land described in Schedule 1 is taken by the Coordinator-General pursuant to the State Development and Public Works Organisation Act 1971 for the establishment of the new mental health facility for the Ipswich Hospital Redevelopment Project, and vests as an estate in fee simple in the West Moreton Hospital and Health Service on and from 8 November 2019. SCHEDULE 1 Land Taken Lot 3 on Registered Plan 68044 contained in Title Reference 12546129 Lot 10 on Registered Plan 68044 contained in Title Reference 12507030 ENDNOTES 1. Made by the Governor in Council on 7 November 2019. 2. Published in the Gazette on 8 November 2019. 3. Not required to be laid before the Legislative Assembly. 4. The administering agency is the Department of State Development, Manufacturing, Infrastructure and Planning.
© The State of Queensland 2019 Copyright protects this publication. Except for purposes permitted by the Copyright Act, reproduction by whatever means is prohibited without prior written permission. Inquiries should be addressed to: Gazette Advertising, GPO Box 2457, Brisbane QLD 4001. ______BRISBANE 8 November 2019 368 QUEENSLAND GOVERNMENT GAZETTE No. 72 [8 November 2019
This page has been left blank intentionally [369]
Queensland Government Gazette Extraordinary PUBLISHED BY AUTHORITY ISSN 0155-9370
Vol. 382] Friday 8 November 2019 [No. 73
Disaster Management Act 2003
NOTICE OF DECLARATION OF A DISASTER SITUATION Queensland Fire and Emergency Services Brisbane, 8 November 2019 At 8:05pm on 8 November 2019, the Minister for Fire and Emergency Services approved the declaration of a Disaster Situation under section 64 of the Disaster Management Act 2003 for the area within the Sunshine Coast Disaster District encompassing the Noosa Local Government Area. Hon Craig Crawford MP Minister for Fire and Emergency Services
© The State of Queensland 2019 Copyright protects this publication. Except for purposes permitted by the Copyright Act, reproduction by whatever means is prohibited without prior written permission. Inquiries should be addressed to: Gazette Advertising, GPO Box 2457, Brisbane QLD 4001. ______BRISBANE 8 November 2019 370 QUEENSLAND GOVERNMENT GAZETTE No. 73 [8 November 2019
This page has been left blank intentionally [371]
Queensland Government Gazette Extraordinary PUBLISHED BY AUTHORITY ISSN 0155-9370
Vol. 382] Saturday 9 November 2019 [No. 74
Fire and Emergency Services Act 1990 iii. any fire lit at a sawmill for the purpose of burning sawdust or other residue resulting from the DECLARATION OF STATE OF FIRE EMERGENCY operations of a sawmill; FOR QUEENSLAND iv. any fire lit out-doors for the purpose of cooking, if enclosed in a fireplace so constructed as to Title prevent the escape of fire or any burning material 1. This notification shall be known as the Notification of there from. Declaration of State of Fire Emergency for Queensland . 6. This declaration orders that any person finding a fire burning in the open air take all possible steps to extinguish it and, as Authorising Law soon as is practicable, report the existence and locality of the 2. The law under which this notification is approved is section 87 fire to Queensland Fire and Emergency Services via triple zero. Fire and Emergency Services Act 1990 and section 88 of the . 7. The use of the follow appliances, materials or substances Period of state or fire emergency OR Commencement of state is prohibited: or fire emergency (a) Fireworks and pyrotechnic devices of any kind, (b) Use of devices which incorporate a naked flame, and 3. This declaration will commence from 1700 hours on the any other similar activities that can be a source of date of 9 November 2019 and will remain in force until ignition when flammable material is present, or can such time as it is cancelled, amended or revoked. become a fire hazard regardless of the presence of flammable material. Area to which the state or fire emergency applies (c) The operation of steam trains or similar apparatus. 4. This declaration of a state of fire emergency applies to the 8. The following activities or operations are suspended for State of Queensland. (As indicated on the attached map) period of this declaration. (a) Welding, grinding, the use of oxy acetylene cutting or Effect of declaration heating, use of naked flames and other similar operations 5. This declaration ceases the effect of all previous authorities that can be a source of ignition when flammable material given under Fire and Emergency Services Act 1990 or any is present or can become a fire hazard regardless of the other Act to light a fire, whether given before or during this presence of flammable material. state of emergency while this state of emergency remains in Failure to comply with this declaration force. This cessation of authority includes: (a) The lighting of any fire in accordance with a Permit to 9. Any person who fails to comply with a declaration of a state of Light Fire issued pursuant to section 65 of the Fire and fire emergency or with any requisition made pursuant to Emergency Services Act 1990. section 91(2) commits an offence against this Act having a penalty of up to 25 penalty units or 2 years imprisonment. (b) The lighting of any fire in accordance with the Notification issued on 30 July 2010 issued pursuant Mike Wassing AFSM Fire and Emergency Services Act to section 63 of the Acting Commissioner 1990 being: Queensland Fire and Emergency Services i. any fire in which neither the height, width nor the length of the material to be consumed exceeds 2metres; ii. any fire lit for the purpose of burning the carcass of a beast; 372 QUEENSLAND GOVERNMENT GAZETTE No. 74 [9 November 2019
Declared State of Emergency Local Government Areas Gympie Regional Noosa Shire ! Major City NORTH COAST
Declared LGA South Burnett Regional Local Government Area Sunshine Coast QFES Region Regional
Somerset Regional Moreton Bay Regional Torres Shire Toowoomba Regional BRISBANE
Brisbane City Redland Lockyer City Valley Napranum Ipswich City Aboriginal Regional Logan Shire City Gold Lockhart River Aboriginal Shire SOUTH Coast City WESTERN Scenic Rim Aurukun Shire Regional SOUTH Southern EASTERN Downs Cook Shire Regional Pormpuraaw Aboriginal Shire Kowanyama Aboriginal Shire FAR NORTHERN Douglas Shire Mornington Shire Yarrabah Carpentaria Mareeba Shire Aboriginal Shire Shire Cairns Doomadgee Tablelands Regional Aboriginal Regional Cassowary Shire Croydon Coast Regional Burke Shire Shire Etheridge Shire Hinchinbrook Shire
Townsville City
Charters Burdekin Mount Towers Shire Isa City Regional NORTHERN Richmond Whitsunday Mckinlay Shire Regional Shire Cloncurry Flinders Shire Shire Mackay Regional
Isaac Winton Shire Regional Boulia Shire Livingstone Shire Barcaldine Regional Rockhampton Regional Longreach CENTRAL Regional Central Highlands Woorabinda Regional Gladstone Aboriginal Regional Diamantina Blackall Shire Bundaberg Shire Tambo Regional North Regional Barcoo Shire Burnett Fraser Banana Shire Regional Coast Regional NORTH COAST
South Burnett Gympie Not to Scale Murweh Shire Regional Regional ² Maranoa 0100200 Quilpie Shire Regional Western Sunshine Kilom etres Downs Coast Regional Regional Map Produced: 9/11/2019 W:\Operations\2019\11_November_Fires\Maps SOUTH WESTERN BRISBANE A4 declared emergency.mxd SOUTH Toowoomba Bulloo Shire Paroo Shire Regional EASTERN Goondiwindi Southern Balonne Shire Regional Downs Disclaimer This product has been prepared for the Queensland Fire and Regional Emergency Services. Other users must satisfy themselves it is accurate and suitable for their purpose. QFES does not accept any liability for any loss or damage that may arise from the use of or reliance on this inform ation. 9 November 2019] QUEENSLAND GOVERNMENT GAZETTE No. 74 373
PUBLIC NOTIFICATION STRATEGY – Far • Cassowary Coast • Carpentaria Shire VIA LOCAL GOVERNMENT AREAS (LGA’S) Northern Regional •Mareeba Shire • Tablelands Regional Region: LGA’s Included: LGA’s Not Included: •Douglas Shire • Cairns Regional • Wujal Wujal Aboriginal Shire South • Gold Coast City - • Yarrabah Aboriginal •Cook Shire Eastern Council Shire • Kowanyama Aboriginal Shire •Logan City • Croydon Shire • Pormpuraaw Aboriginal Shire • Scenic Rim Regional • Etheridge Shire •Ipswich City • Hope Vale Aboriginal Shire • Lockyer Valley • Aurukun Shire Regional • Lockhart River Aboriginal Shire • Somerset Regional • Napranum Aboriginal Shire • Mapoon Aboriginal Shire Brisbane • Moreton Bay - • Northern Peninsula Area Regional Council Regional • Redland City Council • Torres Shire • Brisbane City • Torres Straight Island Council •Weipa North • Sunshine Coast - Coast Regional Council Total Councils Included: • Noosa Shire 1. Gold Coast City Council • Gympie Regional 2. Logan City • Fraser Coast Regional 3. Scenic Rim Regional • Bundaberg Regional 4. Ipswich City • North Burnett 5. Lockyer Valley Regional Regional 6. Somerset Regional • South Burnett 7. Moreton Bay Regional Council Regional 8. Redland City Council • Cherbourg 9. Brisbane City Council Aboriginal Shire 10. Sunshine Coast Regional Council South • Southern Downs •Balonne Shire 11. Noosa Shire Western Regional •Paroo Shire 12. Gympie Regional • Goondiwindi •Bulloo Shire Regional • Maranoa Regional 13. Fraser Coast Regional • Toowoomba •Murweh Shire 14. Bundaberg Regional Regional • Quilpie Shire 15. North Burnett Regional • Western Downs 16. South Burnett Regional Regional 17. Cherbourg Aboriginal Shire • Banana Shire 18. Southern Downs Regional Central • Banana Shire • Barcaldine Regional 19. Goondiwindi Regional • Gladstone Regional • Longreach Regional 20. Toowoomba Regional • Rockhampton •Barcoo Shire 21. Western Downs Regional Regional • Winton Shire • Central Highlands 22. Banana Shire Regional 23. Gladstone Regional • Woorabinda 24. Rockhampton Regional Aboriginal Shire 25. Central Highlands Regional • Livingstone Shire 26. Woorabinda Aboriginal Shire • Isaac Regional 27. Livingstone Shire • Mackay Regional 28. Isaac Regional • Blackall Tambo Regional 29. Mackay Regional • Whitsunday 30. Blackall Tambo Regional Regional 31. Whitsunday Regional Northern • Burdekin Shire • Richmond Shire 32. Burdekin Shire • Townsville City • McKinlay Shire 33. Townsville City • Hinchinbrook Shire • Cloncurry Shire 34. Hinchinbrook Shire • Charters Towers • Diamantina Shire 35. Charters Towers Regional Regional •Boulia Shire 36. Flinders Shire • Flinders Shire •Mount Isa City 37. Cassowary Coast Regional •Burke Shire 38. Tablelands Regional • Doomadgee Aboriginal Shire 39. Cairns Regional • Mornington Shire 40. Yarrabah Aboriginal Shire • Palm Island Aboriginal Shire • Carpentaria Shire 41. Croydon Shire 42. Etheridge Shire
© The State of Queensland 2019 Copyright protects this publication. Except for purposes permitted by the Copyright Act, reproduction by whatever means is prohibited without prior written permission. Inquiries should be addressed to: Gazette Advertising, GPO Box 2457, Brisbane QLD 4001. ______BRISBANE 9 November 2019 374 QUEENSLAND GOVERNMENT GAZETTE No. 74 [9 November 2019
This page has been left blank intentionally [375]
Queensland Government Gazette Extraordinary PUBLISHED BY AUTHORITY ISSN 0155-9370
Vol. 382] Saturday 9 November 2019 [No. 75
Disaster Management Act 2003
NOTICE OF DECLARATION OF DISASTER SITUATION Queensland Fire and Emergency Services Brisbane, 9 November 2019 At 8:45 pm on 9 November 2019, the Minister for Fire and Emergency Services approved the declaration of a Disaster Situation under section 64 of the Disaster Management Act 2003 for the area within the Rockhampton Disaster District comprising the area bounded by the Livingstone Shire Local Government Area. Hon Craig Crawford MP Minister for Fire and Emergency Services
© The State of Queensland 2019 Copyright protects this publication. Except for purposes permitted by the Copyright Act, reproduction by whatever means is prohibited without prior written permission. Inquiries should be addressed to: Gazette Advertising, GPO Box 2457, Brisbane QLD 4001. ______BRISBANE 9 November 2019 376 QUEENSLAND GOVERNMENT GAZETTE No. 75 [9 November 2019
This page has been left blank intentionally [377]
Queensland Government Gazette Extraordinary PUBLISHED BY AUTHORITY ISSN 0155-9370
Vol. 382] Monday 11 November 2019 [No. 76
Planning Act 2016
NOTICE OF AMENDMENT TO THE DEVELOPMENT ASSESSMENT RULES UNDER THE PLANNING ACT 2016, SECTIONS 69 and 11 I, the Honourable Cameron Dick MP, Minister for State Development, Manufacturing, Infrastructure and Planning, do hereby notify that, pursuant to sections 69 and 11 of the Planning Act 2016, I made minor amendments to the Development Assessment Rules on 11 November 2019. In accordance with section 69(2) of the Planning Act 2016, the Development Assessment Rules as amended, do not have effect until: (a) the chief executive of the Department of State Development, Manufacturing, Infrastructure and Planning publishes both the amendment, and the rules as amended, on the department’s website; and (b) the rules as amended are prescribed by regulation. The amended Development Assessment Rules document is available from the Department of State Development, Manufacturing, Infrastructure and Planning’s website at https://planning.dsdmip.qld.gov.au/. Cameron Dick MP Minister for State Development, Manufacturing, Infrastructure and Planning
© The State of Queensland 2019 Copyright protects this publication. Except for purposes permitted by the Copyright Act, reproduction by whatever means is prohibited without prior written permission. Inquiries should be addressed to: Gazette Advertising, GPO Box 2457, Brisbane QLD 4001. ______BRISBANE 11 November 2019 378 QUEENSLAND GOVERNMENT GAZETTE No. 76 [11 November 2019
This page has been left blank intentionally [379]
Queensland Government Gazette Extraordinary PUBLISHED BY AUTHORITY ISSN 0155-9370
Vol. 382] Tuesday 12 November 2019 [No. 77
Queensland
Constitution of Queensland 2001
PROCLAMATION I, CATHERINE ENA HOLMES, Chief Justice of Queensland, acting under section 41 of the Constitution of Queensland 2001, having previously made the prescribed affirmations, have today assumed the administration of the Government of the State as Acting Governor because His Excellency the Honourable Paul de Jersey AC, Governor, is absent from the State. [L.S.] CATHERINE HOLMES Acting Governor
Signed and sealed on 12 November 2019.
By Command
Annastacia Palaszczuk
God Save the Queen
ENDNOTES 1. Made by the Acting Governor on 12 November2019. 2. Published in an Extraordinary Government Gazette on 12 November2019. 3. The administering agency is the Department of the Premier and Cabinet.
© The State of Queensland 2019 Copyright protects this publication. Except for purposes permitted by the Copyright Act, reproduction by whatever means is prohibited without prior written permission. Inquiries should be addressed to: Gazette Advertising, GPO Box 2457, Brisbane QLD 4001. ______BRISBANE 12 November 2019 380 QUEENSLAND GOVERNMENT GAZETTE No. 77 [12 November 2019
This page has been left blank intentionally [381]
Queensland Government Gazette Extraordinary PUBLISHED BY AUTHORITY ISSN 0155-9370
Vol. 382] Tuesday 12 November 2019 [No. 78
Fire and Emergency Services Act 1990 i. any fire in which neither the height, width nor the length of the material to be consumed exceeds DECLARATION OF STATE OF FIRE EMERGENCY 2metres; FOR QUEENSLAND ii. any fire lit for the purpose of burning the carcass Title of a beast; iii. any fire lit at a sawmill for the purpose of burning 1. This notification of an amendment to the Declaration of sawdust or other residue resulting from the State of Fire Emergency gazetted on 9 November 2019 operations of a sawmill; shall be known as the Notification of Declaration of State of Fire Emergency for Queensland (Amendment 1). 8. The use of the following appliances, materials or substances is prohibited: Authorising Law (a) Outdoor fireworks and pyrotechnic devices of any 2. The law under which this amendment to the declaration kind takes effect is section 87(2)(h) and section 88 of the Fire (b) Use of devices which incorporate a naked flame, any and Emergency Services Act 1990. other similar activities that can be a source of ignition when flammable material is present or can become a Commencement of amendment to the Declaration of State or fire hazard regardless of the presence of flammable Fire Emergency material. (c) The operation of steam trains or similar apparatus. 3. The amendment to the declaration takes effect from the date of gazettal or notification under section 88(2) of the Fire and Emergency Services Act 1990 9. The following activities or operations are suspended in . areas where flammable vegetation is present within 10 meters or can become a fire hazard regardless of the 4. The declaration, as amended herein, will remain in force presence of flammable vegetation, until such time as it is until such time as it is amended or revoked. amended or revoked; Amendment to the content and application of the Declaration (a) welding of State of Fire Emergency (b) grinding (c) the use of oxy acetylene cutting or heating 5. The declaration is amended to apply to the parts of the (d) use of naked flames State of Queensland as indicated in the attached amended (e) other similar operations that can be a source of map and table. ignition. 6. The declaration is further amended by replacing Effect of declaration – Activities that are not prohibited paragraphs 5, 6, 7, 8 and 9 of the Declaration of State of Fire Emergency gazetted on 9 November 2019, with the 10. In accordance with section 90(2) of the Fire and Emergency below paragraphs 7, 8, 9, 10, 11 and 12. Services Act 1990, this declaration does not cease the effect of the following authorities: Effect of declaration – Activities that are prohibited (a) A fire lit in accordance with the Notification for 7. This declaration ceases the effect of all previous Burning of Sugar Cane as published in the gazette on authorities given under the Fire and Emergency Services 31 May 2019; save that if a fire permit is required it Act 1990 or any other Act to light a fire, whether given must be issued by the Regional Manager, Rural Fire before or during this state of emergency while this state of Service, Queensland Fire and Emergency Services, for emergency remains in force, subject to the remaining the relevant region; provisions of this declaration. This cessation of authority (b) A fire lit in accordance with the Notification issued on includes: 30 July 2010 pursuant to section 63 of the Fire and (a) The lighting of any fire in accordance with a Permit to Emergency Services Act 1990, under clause b, item iv- Light Fire issued pursuant to section 65 of the Fire and any fire lit out-doors for the purpose of cooking, if Emergency Services Act 1990 enclosed in a fireplace so constructed as to prevent (b) The lighting of any fire in accordance with the the escape of fire or any burning material there from; Notification issued on 30 July 2010 pursuant to and section 63 of the Fire and Emergency Services Act (c) Any powers exercisable pursuant to section 53, 55 or 1990 being: 83 of the Fire and Emergency Services Act 1990. 382 QUEENSLAND GOVERNMENT GAZETTE No. 78 [12 November 2019
11. This declaration orders that any person finding a fire burning in the open air take all possible steps to extinguish it and, as soon as is practicable, report the existence and locality of the fire to Queensland Fire and Emergency Services via triple zero. Failure to comply with this declaration 12. Any person who fails to comply with a declaration of a state of fire emergency or with any requisition made pursuant to section 91(2) commits an offence against this Act having a penalty of up to 250 penalty units or 2 years imprisonment. Mike Wassing AFSM Acting Commissioner Queensland Fire and Emergency Services 12 November 2019] QUEENSLAND GOVERNMENT GAZETTE No. 78 383
Declared State of Fire Emergency Local Government Areas Gympie Regional Noosa Current as of 11/11/2019 NORTH COAST Shire South Burnett Regional ! Major City Sunshine Coast Declared LGA Regional Local Government Area
QFES Region Somerset Regional Moreton Bay Regional Torres Shire Toowoomba Regional BRISBANE
Brisbane City Redland Lockyer City Valley Napranum Ipswich City Aboriginal Regional Logan Shire City Gold Lockhart River Aboriginal Shire SOUTH Coast City WESTERN Scenic Rim Aurukun Shire Regional SOUTH Southern EASTERN Downs Cook Shire Regional Pormpuraaw Aboriginal Shire Kowanyama Aboriginal Shire FAR NORTHERN Douglas Shire Mornington Shire Yarrabah Carpentaria Mareeba Shire Aboriginal Shire Shire Cairns Doomadgee Regional Aboriginal Tablelands Regional Cassowary Shire Croydon Coast Regional Shire Burke Shire Etheridge Shire Hinchinbrook Shire
Townsville City
Charters Mount Burdekin Towers Shire Isa City Regional NORTHERN Richmond Whitsunday Mckinlay Shire Regional Shire Cloncurry Flinders Shire Shire Mackay Regional
Isaac Winton Shire Regional Boulia Shire Livingstone Shire Barcaldine Regional Rockhampton Regional Longreach CENTRAL Regional Central Highlands Woorabinda Regional Gladstone Aboriginal Regional Diamantina Blackall Shire Bundaberg Shire Tambo Regional North Regional Barcoo Shire Burnett Fraser Banana Shire Regional Coast Regional NORTH COAST
South Burnett Gympie Not to Scale Murweh Shire Regional Regional ² Maranoa 0100200 Quilpie Shire Regional Western Sunshine Kilom et res Downs Coast Regional Regional Map Produced: 11/11/2019 W:\Operations\2019\11_November_Fires\Maps SOUTH WESTERN BRISBANE A4 declared emergency.mxd SOUTH Toowoomba Bulloo Shire Paroo Shire Regional EASTERN Goondiwindi Southern Balonne Shire Regional Downs Disclaimer This product has been prepared for the Queensland Fire and Regional Emergency Services. Other users must satisfy themselves it is accurate and suitable for their purpose. QFES does not accept any liability for any loss or damage that may arise from the use of or reliance on this inform ation. 384 QUEENSLAND GOVERNMENT GAZETTE No. 78 [12 November 2019
PUBLIC NOTIFICATION STRATEGY – Far • Cassowary Coast • Carpentaria Shire VIA LOCAL GOVERNMENT AREAS (LGA’S) Northern Regional • Mareeba Shire • Tablelands Regional Region: LGA’s Included: LGA’s Not Included: •Douglas Shire • Cairns Regional • Wujal Wujal Aboriginal Shire South •Gold Coast City - • Yarrabah Aboriginal •Cook Shire Eastern Council Shire • Kowanyama Aboriginal Shire •Logan City • Croydon Shire • Pormpuraaw Aboriginal Shire • Scenic Rim Regional • Etheridge Shire •Ipswich City • Hope Vale Aboriginal Shire •Lockyer Valley • Aurukun Shire Regional • Lockhart River Aboriginal Shire • Somerset Regional • Napranum Aboriginal Shire • Mapoon Aboriginal Shire Brisbane • Moreton Bay - Regional Council • Northern Peninsula Area Regional • Redland City Council •Torres Shire • Brisbane City Council •Torres Straight Island •Weipa North • Sunshine Coast - Coast Regional Council Total Councils Included: • Noosa Shire 1. Gold Coast City Council • Gympie Regional 2. Logan City • Fraser Coast Regional 3. Scenic Rim Regional • Bundaberg Regional 4. Ipswich City • North Burnett 5. Lockyer Valley Regional Regional 6. Somerset Regional • South Burnett 7. Moreton Bay Regional Council Regional 8. Redland City Council • Cherbourg Aboriginal Shire 9. Brisbane City Council 10. Sunshine Coast Regional Council South • Southern Downs •Balonne Shire Western Regional •Paroo Shire 11. Noosa Shire • Goondiwindi • Bulloo Shire 12. Gympie Regional Regional • Maranoa Regional 13. Fraser Coast Regional • Toowoomba • Murweh Shire 14. Bundaberg Regional Regional • Quilpie Shire 15. North Burnett Regional • Western Downs Regional 16. South Burnett Regional • Banana Shire 17. Cherbourg Aboriginal Shire Central • Banana Shire • Barcaldine Regional 18. Southern Downs Regional • Gladstone Regional • Longreach Regional 19. Goondiwindi Regional • Rockhampton •Barcoo Shire 20. Toowoomba Regional Regional • Winton Shire 21. Western Downs Regional • Central Highlands 22. Banana Shire Regional 23. Gladstone Regional • Woorabinda Aboriginal Shire 24. Rockhampton Regional • Livingstone Shire 25. Central Highlands Regional • Isaac Regional 26. Woorabinda Aboriginal Shire • Mackay Regional 27. Livingstone Shire • Blackall Tambo 28. Isaac Regional Regional 29. Mackay Regional • Whitsunday 30. Blackall Tambo Regional Regional 31. Whitsunday Regional Northern • Burdekin Shire • Richmond Shire 32. Burdekin Shire • Townsville City • McKinlay Shire • Hinchinbrook Shire • Cloncurry Shire 33. Townsville City • Charters Towers • Diamantina Shire 34. Hinchinbrook Shire Regional •Boulia Shire 35. Charters Towers Regional • Flinders Shire •Mount Isa City 36. Flinders Shire •Burke Shire 37. Cassowary Coast Regional • Doomadgee Aboriginal Shire 38. Tablelands Regional • Mornington Shire 39. Cairns Regional • Palm Island Aboriginal Shire 40. Yarrabah Aboriginal Shire • Carpentaria Shire 41. Croydon Shire 42. Etheridge Shire
© The State of Queensland 2019 Copyright protects this publication. Except for purposes permitted by the Copyright Act, reproduction by whatever means is prohibited without prior written permission. Inquiries should be addressed to: Gazette Advertising, GPO Box 2457, Brisbane QLD 4001. ______BRISBANE 12 November 2019 [385]
Queensland Government Gazette Extraordinary PUBLISHED BY AUTHORITY ISSN 0155-9370
Vol. 382] Wednesday 13 November 2019 [No. 79
Disaster Management Act 2003
NOTICE OF DECLARATION OF A DISASTER SITUATION Queensland Fire and Emergency Services Brisbane, 13 November 2019 At 6:41pm on 13 November 2019, the Minister for Fire and Emergency Services approved the declaration of a Disaster Situation under section 64 of the Disaster Management Act 2003 for the area within the Bundaberg Disaster District comprising the Bundaberg Local Government Area. Hon Craig Crawford MP Minister for Fire and Emergency Services
© The State of Queensland 2019 Copyright protects this publication. Except for purposes permitted by the Copyright Act, reproduction by whatever means is prohibited without prior written permission. Inquiries should be addressed to: Gazette Advertising, GPO Box 2457, Brisbane QLD 4001. ______BRISBANE 13 November 2019 386 QUEENSLAND GOVERNMENT GAZETTE No. 79 [13 November 2019
This page has been left blank intentionally [387]
Queensland Government Gazette Natural Resources, Mines and Energy PUBLISHED BY AUTHORITY ISSN 0155-9370
Vol. 382] Friday 15 November 2019 [No. 80
Acquisition of Land Act 1967 SCHEDULE Native Title Act 1993 (Commonwealth) 6RXWK5HJLRQ%ULVEDQH2൶FH Native Title (Queensland) Act 1993 Land to be Taken TAKING OF NATIVE TITLE RIGHTS AND Lot 11 on SP288378 (to be registered in the Titles Registry), INTERESTS AND NON-NATIVE TITLE RIGHTS AND area 923 m2, part of Title Reference 13188163. INTERESTS NOTICE (1ඈ 06) 2019 Lot 173 on SP288378 (to be registered in the Titles Registry), [S.9(6) OF THE ACQUISITION OF LAND ACT area 1578 m2, part of Title Reference 50019885. 1967, S.24MD OF THE NATIVE TITLE ACT 1993 (COMMONWEALTH) AND S.144 OF THE NATIVE ENDNOTES TITLE (QUEENSLAND) ACT 1993] 1. Made by the Governor in Council on 14 November 2019. Short title 2. Published in the Gazette on 15 November 2019. 1 This notice may be cited as the Taking of Native Title Rights 3. Not required to be laid before the Legislative Assembly. and Interests and Non-Native Title Rights and Interests Notice 4. The administering agency is the Department of Natural (No 06) 2019. Resources, Mines and Energy. Native Title Rights and Interests Taken 5. File Reference – 079/0016160 2. The native title rights and interests, if any, in the land and waters described in the Schedule are taken by Barcoo Shire Council Land Act 1994 for water reticulation and associated public works purposes on and REOPENING OF TEMPORARILY CLOSED ROAD from 15 November 2019. NOTICE (1ඈ 27) 2019 Non-Native Title Rights and Interests Taken and Extinguished Short title 3. All non-native title rights and interests in relation to the land 1. This notice may be cited as the Reopening of Temporarily and waters described in the Schedule are taken by Barcoo Shire Closed Road Notice (No 27) 2019. Council for water reticulation and associated public works purposes Reopening temporarily closed road [s.107 of the Act] on and from15 November 2019. 2. It is declared that the area of land comprised in the former SCHEDULE Road Licence mentioned in the Schedule is reopened as road. &HQWUDO5HJLRQ/RQJUHDFK2൶FH SCHEDULE An area of about 2482 m2 being unnamed road area (contained &HQWUDO5HJLRQ0DFND\2൶FH within stations 3-7-10-4-3) on SP134358 adjoining the south-west An area of about 1.070000 ha shown as Lot A on AP11105 being boundary of Lot 1 on SP134358. the land contained within former Road Licence No. 0/221354. ENDNOTES ENDNOTES 1. Made by the Governor in Council on 14 November 2019. 1. Published in the Gazette on 15 November 2019. 2. Published in the Gazette on 15 November 2019. 2. Not required to be laid before the Legislative Assembly. 3. Not required to be laid before the Legislative Assembly. 3. The administering agency is the Department of Natural 4. The administering agency is the Department of Natural Resources, Mines and Energy. Resources, Mines and Energy. 4. File Reference – 2019/003804 5. File Reference - 079/0022108 Acquisition of Land Act 1967 Land Act 1994 TAKING OF LAND NOTICE (1ඈ 03) 2019 OBJECTIONS TO PROPOSED ROAD CLOSURE Short title NOTICE (1ඈ 41) 2019 1. This notice may be cited as the Taking of Land Notice Short title (No 03) 2019. 1. This notice may be cited as the Objections to Proposed Road Land taken [s.9(6) of the Act] Closure Notice (No 41) 2019. 2. The land described in the Schedule is taken by Brisbane City Application for road closure [s.100 of the Act] Council for road purposes and vests in Brisbane City Council for 2. Applications have been made for the permanent closure of an estate in fee simple on and from15 November 2019. the roads mentioned in the Schedule. 388 QUEENSLAND GOVERNMENT GAZETTE No. 80 [15 November 2019
Objections 3.(1) An objection (in writing) to the proposed road closures mentioned in the Schedule may be lodged with the Regional Service Director, Department of Natural Resources, Mines and Energy, DWWKHUHJLRQDOR൶FHIRUWKHUHJLRQLQZKLFKWKHURDGLVVLWXDWHG (2) Latest day for lodgement of objections is detailed in the schedule below. (3) Any objections received may be viewed by other parties interested in the proposed road closure under the provisions of the Right to Information Act 2009. If you lodge an objection, please include in your objection letter whether you would like to be consulted if this issue becomes the subject of an access request under the Right to Information Act 2009. Plans 4. Inspection of the plans of the proposed road closures may be made at- (a) the Department of Natural Resources, Mines and Energy 2൶FHVDW5RFNKDPSWRQ%HHQOHLJK*\PSLHDQG:DUZLFN and (b) the Local Government Offices of Livingstone Shire Council, Scenic Rim Regional Council, Gympie Regional &RXQFLODQG6RXWKHUQ'RZQV5HJLRQDO&RXQFLO for a particular plan in that district or that local government area. SCHEDULE PERMANENT CLOSURE LATEST DAY FOR LODGEMENT OF OBJECTION IS 25NOVEMBER2019 &HQWUDO5HJLRQ5RFNKDPSWRQ2൶FH 1. Multiple permanent closures of unused and unformed roads in VSHFL¿HGDUHDVEHWZHHQWKH6KRDOZDWHU%D\7UDLQLQJ$UHD&KDURQ Point Conservation Park, the township of Ogmore and the North :HVW&RDVW5DLOZD\/LQHDVVKRZQDVGUDZLQJV6.DQG 6.7KHFORVXUHVZLOOQRWLPSDFWH[LVWLQJSXEOLFDFFHVV URDGVLQFOXGLQJ6WDQDJH%D\5RDG.RROWDQGUD5RDG6WRRGOHLJK Road, Glenprairie Road and Bald Hills Road. (2019/003702, 2019/003073, 2019/003704) LATEST DAY FOR LODGEMENT OF OBJECTION IS 2 JANUARY 2020 6RXWK5HJLRQ%HHQOHLJK2൶FH 2. An area of about 2150 m2 being the unnamed road adjoining the eastern boundary of Lot 2 on RP156472 (locality of Moogerah) and shown as road proposed to be permanently closed on Drawing 19/4134. (2019/004134) 6RXWK5HJLRQ*\PSLH2൶FH 3. An area of about 2920 m2 being part of unnamed road abutting the south eastern boundary of Lot 35 on SP307393 (locality of Amamoor Creek) and shown as road proposed to be permanently closed on Drawing 19/3912. (2019/003912) 6RXWK5HJLRQ:DUZLFN2൶FH 4. An area of about 2870 m2 being an area of road adjoining Lot RQ0/ ORFDOLW\RI.LOODUQH\ DQGVKRZQDVURDGSURSRVHG to be permanently closed on Drawing 19/4335. (2019/004335) 5. Areas totalling about 3.217 ha being an unnamed road adjoining the northern boundaries of Lots 1 and 2 on RP70559 (localities of Murrays Bridge and Junabee) and shown as Parts A and B, road proposed to be permanently closed on Drawing 19/3490 (2019/003490) ENDNOTES 1. Published in the Gazette on 15 November 2019. 2. Not required to be laid before the Legislative Assembly. 3. The administering agency is the Department of Natural Resources, Mines and Energy.
© The State of Queensland 2019 Copyright protects this publication. Except for purposes permitted by the Copyright Act, reproduction by whatever means is prohibited without prior written permission. Inquiries should be addressed to: Gazette Advertising, GPO Box 2457, Brisbane QLD 4001. ______BRISBANE 15 November 2019 [389]
Queensland Government Gazette Transport and Main Roads PUBLISHED BY AUTHORITY ISSN 0155-9370
Vol. 382] Friday 15 November 2019 [No. 81
Transport Infrastructure Act 1994
127,),&$7,212)'(&/$5$7,21$1'5(92&$7,21 2)67$7(&21752//('52$' 1RWLFHLVKHUHE\JLYHQXQGHUVHFWLRQVDQGRIWKHTransport Infrastructure Act1994, WKDWWKHURDGRUURXWHRUSDUWRIWKHURDGRUURXWH GHVFULEHG LQWKHVFKHGXOHLVKHUHE\ GHFODUHGRUUHYRNHGDVD6WDWHFRQWUROOHGURDGDVWKHFDVHPD\EH$VUHTXLUHGE\WKHDERYHPHQWLRQHGVHFWLRQVRIWKHTransport Infrastructure Act 1994, &DLUQV 5HJLRQDO &RXQFLO KDV EHHQ QRWLILHG DQG WKH GHFODUDWLRQ GHVFULEHG LQ WKH VFKHGXOH EHORZ LV FRQVLVWHQW ZLWK WKH GHSDUWPHQW¶VWUDQVSRUWLQIUDVWUXFWXUHVWUDWHJLHV 0DUN&UDLJ%DLOH\ 0LQLVWHUIRU7UDQVSRUWDQG0DLQ5RDGV 7+(6&+('8/( 7KDWRQDQGIURP1RYHPEHUWKHGHFODUDWLRQRIWKH6WDWHFRQWUROOHGURDGGHVFULEHGLQ$SSHQGL[,KHUHWRLVGHFODUHGD6WDWHFRQWUROOHGURDG UHVSHFWLYHO\XQGHUDQGIRUWKHSXUSRVHVRIWKHTransport Infrastructure Act 1994.
$33(1',;, 1R 60,7+),(/'%<3$66 &$,5165(*,21$/&281&,/ )URPWKHURXQGDERXWDWLWVLQWHUVHFWLRQZLWKWKH&DSWDLQ&RRN+LJKZD\DQG&DLUQV:HVWHUQ$UWHULDO5RDGLQ 127,),&$7,212)'(&/$5$7,21$1'5(92&$7,21 2)67$7(&21752//('52$' 1RWLFHLVKHUHE\JLYHQXQGHUVHFWLRQVDQGRIWKHTransport Infrastructure Act1994, WKDWWKHURDGRUURXWHRUSDUWRIWKHURDGRUURXWH GHVFULEHG LQWKHVFKHGXOHLVKHUHE\ GHFODUHGRUUHYRNHGDVD6WDWHFRQWUROOHGURDGDVWKHFDVHPD\EH$VUHTXLUHGE\WKHDERYHPHQWLRQHGVHFWLRQVRIWKHTransport Infrastructure Act1994,%XQGDEHUJ5HJLRQDO&RXQFLOKDVEHHQQRWLILHGDQGWKHGHFODUDWLRQGHVFULEHGLQWKHVFKHGXOHEHORZLVFRQVLVWHQWZLWKWKH GHSDUWPHQW¶VWUDQVSRUWLQIUDVWUXFWXUHVWUDWHJLHV 0DUN&UDLJ%DLOH\ 0LQLVWHUIRU7UDQVSRUWDQG0DLQ5RDGV 7+(6&+('8/( 7KDWRQDQGIURP1RYHPEHUWKHGHFODUDWLRQRIWKH6WDWHFRQWUROOHGURDGVSHFLILHGLQ$SSHQGL[,KHUHWRLVUHYRNHGDQGLQOLHXWKHUHRIWKH URDGGHVFULEHGLQ$SSHQGL[,,KHUHWRLVGHFODUHGD6WDWHFRQWUROOHGURDGUHVSHFWLYHO\XQGHUDQGIRUWKHSXUSRVHVRIWKHTransport Infrastructure Act 1994. $33(1',;, 1DPHRI 'DWHRI 6WDWHFRQWUROOHG 'HFODUDWLRQ 5RDG 5HOHYDQWWR5RDG 1R )HEUXDU\ (OOLRWW+HDGV5RDG %XQGDEHUJ 5HJLRQDO&RXQFLO $33(1',;,, 1R (//,277+($'652$' %81'$%(5*5(*,21$/&281&,/ )URPLWVLQWHUVHFWLRQZLWKWKH%XQGDEHUJ3RUW5RDGQHDUWKHPRVWQRUWKHUQFRUQHURIWKHZHVWHUQVHYHUDQFHRI/RWRQ63LQ.HSQRFNWRWKH QRUWKHDVWFRUQHURI/RWRQ53DQGWKHQRUWKZHVWFRUQHURI/RWRQ53LQ(OOLRWW+HDGVE\WKHDUHDVKRZQRQWKHDSSURYHGSODQVKHOGE\WKH 'LUHFWRU*HQHUDO 'HSDUWPHQW RI 7UDQVSRUW DQG 0DLQ 5RDGV DQG LGHQWLILHG E\ WKH UHJLVWUDWLRQ QXPEHUV 5') 5'' 5' % DQG 5' $ /HQJWKNLORPHWUHV DSSUR[LPDWHO\ (1'127(6 3XEOLVKHGLQWKH*D]HWWHRQ1RYHPEHU 1RWUHTXLUHGWREHODLGEHIRUHWKH/HJLVODWLYH$VVHPEO\ 7KHDGPLQLVWHULQJDJHQF\LVWKH'HSDUWPHQWRI7UDQVSRUWDQG0DLQ5RDGV 15 November 2019] QUEENSLAND GOVERNMENT GAZETTE No. 81 391 Acquisition of Land Act 1967 Transport Infrastructure Act 1994 Transport Planning and Coordination Act 1994 7$.,1*2)/$1'127,&( 1R 6KRUWWLWOH 7KLVQRWLFHPD\EHFLWHGDVWKHTaking of Land Notice (No. 3301) 2019. /DQGWREHWDNHQ>V RIWKHAcquisition of Land Act 1967@ 7KHODQGGHVFULEHGLQWKH6FKHGXOHLVWDNHQIRUWKHSXUSRVHRIWUDQVSRUWLQSDUWLFXODUURDGSXUSRVHVDQGYHVWVLQWKH&KLHI([HFXWLYH 'HSDUWPHQWRI7UDQVSRUWDQG0DLQ5RDGVDVFRQVWUXFWLQJDXWKRULW\IRUWKH6WDWHRI4XHHQVODQGIRUDQHVWDWHLQIHHVLPSOH 6&+('8/( /DQG7DNHQ $QDUHDRIDERXWVTXDUHPHWUHVEHLQJSDUWRI/RWRQ53FRQWDLQHGLQ7LWOH5HIHUHQFH $QDUHDRIDERXWVTXDUHPHWUHVEHLQJSDUWRI/RWRQ53FRQWDLQHGLQ7LWOH5HIHUHQFH $QDUHDRIVTXDUHPHWUHVEHLQJWKHZKROHRI/RWRQ53FRQWDLQHGLQ7LWOH5HIHUHQFH $QDUHDRIDERXWVTXDUHPHWUHVEHLQJSDUWRI/RWRQ53FRQWDLQHGLQ7LWOH5HIHUHQFH $VVKRZQDSSUR[LPDWHO\RQ3ODQ5 % KHOGLQWKHRIILFHRIWKH&KLHI([HFXWLYH'HSDUWPHQWRI7UDQVSRUWDQG0DLQ5RDGV%ULVEDQH 5RFNKDPSWRQ5HJLRQ 5RFNKDPSWRQ±(PX3DUN5RDG )UHQFKPDQV&UHHN%ULGJH8SJUDGH3URMHFW±/DNHV&UHHN5RDG DQG (1'127(6 0DGHE\WKH*RYHUQRULQ&RXQFLORQ1RYHPEHU 3XEOLVKHGLQWKH*D]HWWHRQ1RYHPEHU 1RWUHTXLUHGWREHODLGEHIRUHWKH/HJLVODWLYH$VVHPEO\ 7KHDGPLQLVWHULQJDJHQF\LVWKH'HSDUWPHQWRI7UDQVSRUWDQG0DLQ5RDGV Acquisition of Land Act 1967 Transport Infrastructure Act 1994 Transport Planning and Coordination Act 1994 7$.,1*2)68%/($6(,17(5(676,1/$1'127,&( 1R 6KRUW7LWOH 7KLVQRWLFHPD\EHFLWHGDVWKHTaking of Sublease Interests in Land Notice (No. 3302) 2019. 6XEOHDVH,QWHUHVWVLQ/DQGWREHWDNHQ>V of the Acquisition of Land Act 1967@ 6XEOHDVHLQWHUHVWVLQODQGGHVFULEHGLQWKH6FKHGXOHDUHWDNHQE\WKH&KLHI([HFXWLYH'HSDUWPHQWRI7UDQVSRUWDQG0DLQ5RDGVDV FRQVWUXFWLQJDXWKRULW\IRUWKH6WDWHRI4XHHQVODQGIRUWKHSXUSRVHRIWUDQVSRUWLQSDUWLFXODUURDGSXUSRVHVDQGYHVWVLQWKH6WDWHRI4XHHQVODQG DVXQDOORFDWHG6WDWHODQG 6&+('8/( 6XEOHDVH,QWHUHVWVLQ/DQG7DNHQ $QDUHDRIDERXWVTXDUHPHWUHVEHLQJSDUWRI/RWRQ63FRQWDLQHGLQ7LWOH5HIHUHQFH $QDUHDRIDERXWVTXDUHPHWUHVEHLQJSDUWRI/RWRQ63FRQWDLQHGLQ7LWOH5HIHUHQFH $VVKRZQDSSUR[LPDWHO\RQ3ODQ5KHOGLQWKHRIILFHRIWKH&KLHI([HFXWLYH'HSDUWPHQWRI7UDQVSRUWDQG0DLQ5RDGV%ULVEDQH 5RFNKDPSWRQ5HJLRQ 5RFNKDPSWRQ±(PX3DUN5RDG )UHQFKPDQV&UHHN%ULGJH8SJUDGH3URMHFW±/DNHV&UHHN5RDG (1'127(6 0DGHE\WKH*RYHUQRULQ&RXQFLORQ1RYHPEHU 3XEOLVKHGLQWKH*D]HWWHRQ1RYHPEHU 1RWUHTXLUHGWREHODLGEHIRUHWKH/HJLVODWLYH$VVHPEO\ 7KHDGPLQLVWHULQJDJHQF\LVWKH'HSDUWPHQWRI7UDQVSRUWDQG0DLQ5RDGV 392 QUEENSLAND GOVERNMENT GAZETTE No. 81 [15 November 2019 Acquisition of Land Act 1967 Transport Infrastructure Act 1994 Transport Planning and Coordination Act 1994 7$.,1*2)/$1'127,&( 1R 6KRUWWLWOH 7KLVQRWLFHPD\EHFLWHGDVWKHTaking of Land Notice (No. 3303) 2019. /DQGWREHWDNHQ>V RIWKHAcquisition of Land Act 1967@ 7KHODQGGHVFULEHGLQWKH6FKHGXOHLVWDNHQIRUDSXUSRVHLQFLGHQWDOWRWKHSXUSRVHRIWUDQVSRUW URDG QDPHO\WKHZKROHRIWKHVHYHUHGDUHDLQ DFFRUGDQFHZLWKV RIWKHTransport Planning and Coordination Act 1994DQGYHVWVLQWKH&KLHI([HFXWLYH'HSDUWPHQWRI7UDQVSRUWDQG 0DLQ5RDGVDVFRQVWUXFWLQJDXWKRULW\IRUWKH6WDWHRI4XHHQVODQGIRUDQHVWDWHLQIHHVLPSOH 6&+('8/( /DQG7DNHQ $QDUHDRIDERXWVTXDUHPHWUHVEHLQJWKHUHPDLQGHURI/RWRQ53FRQWDLQHGLQ7LWOH5HIHUHQFH $VVKRZQDSSUR[LPDWHO\RQ3ODQ5 % KHOGLQWKHRIILFHRIWKH&KLHI([HFXWLYH'HSDUWPHQWRI7UDQVSRUWDQG0DLQ5RDGV%ULVEDQH 5RFNKDPSWRQ5HJLRQ 5RFNKDPSWRQ±(PX3DUN5RDG )UHQFKPDQV&UHHN%ULGJH8SJUDGH3URMHFW±/DNHV&UHHN5RDG (1'127(6 0DGHE\WKH*RYHUQRULQ&RXQFLORQ1RYHPEHU 3XEOLVKHGLQWKH*D]HWWHRQ1RYHPEHU 1RWUHTXLUHGWREHODLGEHIRUHWKH/HJLVODWLYH$VVHPEO\ 7KHDGPLQLVWHULQJDJHQF\LVWKH'HSDUWPHQWRI7UDQVSRUWDQG0DLQ5RDGV Acquisition of Land Act 1967 Transport Infrastructure Act 1994 Transport Planning and Coordination Act 1994 7$.,1*2)/$1'127,&( 1R 6KRUWWLWOH 7KLVQRWLFHPD\EHFLWHGDVWKHTaking of Land Notice (No. 3304) 2019. /DQGWREHWDNHQ>V RIWKHAcquisition of Land Act 1967@ 7KHODQGGHVFULEHGLQWKH6FKHGXOHLVWDNHQIRUWKHSXUSRVHRIWUDQVSRUWLQSDUWLFXODUURDGSXUSRVHVDQGYHVWVLQWKH&KLHI([HFXWLYH 'HSDUWPHQWRI7UDQVSRUWDQG0DLQ5RDGVDVFRQVWUXFWLQJDXWKRULW\IRUWKH6WDWHRI4XHHQVODQGIRUDQHVWDWHLQIHHVLPSOH 6&+('8/( /DQG7DNHQ $QDUHDRIDERXWVTXDUHPHWUHVEHLQJSDUWRI/RWRQ53FRQWDLQHGLQ7LWOH5HIHUHQFH $QDUHDRIDERXWVTXDUHPHWUHVEHLQJSDUWRI/RWRQ53FRQWDLQHGLQ7LWOH5HIHUHQFH $VVKRZQDSSUR[LPDWHO\RQ3ODQV5DQG5KHOGLQWKHRIILFHRIWKH&KLHI([HFXWLYH'HSDUWPHQWRI7UDQVSRUWDQG0DLQ5RDGV %ULVEDQH 0RUHWRQ%D\5HJLRQ %XUSHQJDU\±&DERROWXUH5RDG 7RUUHQV5RDG,QWHUVHFWLRQ±0RUD\ILHOG5RDG%HHUEXUUXP5RDG5RXWH6DIHW\3URMHFW DQG (1'127(6 0DGHE\WKH*RYHUQRULQ&RXQFLORQ1RYHPEHU 3XEOLVKHGLQWKH*D]HWWHRQ1RYHPEHU 1RWUHTXLUHGWREHODLGEHIRUHWKH/HJLVODWLYH$VVHPEO\ 7KHDGPLQLVWHULQJDJHQF\LVWKH'HSDUWPHQWRI7UDQVSRUWDQG0DLQ5RDGV © The State of Queensland 2019 Copyright protects this publication. Except for purposes permitted by the Copyright Act, reproduction by whatever means is prohibited without prior written permission. Inquiries should be addressed to: Gazette Advertising, GPO Box 2457, Brisbane QLD 4001. ______BRISBANE 15 November 2019 [393] Queensland Government Gazette General PUBLISHED BY AUTHORITY ISSN 0155-9370 Vol. 382] Friday 15 November 2019 [No. 82 Department of Justice and Attorney-General Brisbane, 15 November 2019 His Excellency the Governor, acting by and with the advice of the Executive Council, acting under the provisions of the Legal Aid Queensland Act 1997 has approved the appointment of Mr Anthony Reilly, by gazette notice, as the Chief Executive Officer of Legal Aid Queensland on and from 16 November 2019 to and including 15 November 2022. YVETTE D’ATH MP Attorney-General and Minister for Justice Leader of the House Department of Justice and Attorney-General Brisbane, 15 November 2019 The Honourable Catherine Holmes, Chief Justice of Queensland, Acting Governor, acting by and with the advice of the Executive Council and in pursuance to the provisions of the Penalties and Sentences Act 1992, has approved the following persons be appointed, on the recommendation of the Attorney-General, to the Queensland Sentencing Advisory Council on and from the day following Governor in Council approval up to and including 25 July 2022: Name Position Mr John Robertson Member and Chairperson Professor Elena Marchetti Member and Deputy Chairperson Mr Bevan Costello Member Ms Jo Bryant Member Detective Chief Superintendent Member Cheryl Scanlon APM Ms Debbie Kilroy Member Ms Kathleen Payne Member Mr Daniel Kingston Rogers Member Mr Warren Geoffrey Strange Member Mrs Helen Watkins Member YVETTE D’ATH MP Attorney-General and Minister for Justice Leader of the House 394 QUEENSLAND GOVERNMENT GAZETTE No. 82 [15 November 2019 NOTIFICATION OF THE FILLING OF ADVERTISED VACANCIES The following appointments to various positions have been made in accordance with the provisions of the Public Service Act 2008 . NOTIFICATION OF THE FILLING OF APPOINTMENTS PART I A public service officer, tenured general employee or a tenured public sector employee of a public sector unit listed in schedule 1 of Public Service Regulation 2008 who wishes to appeal against a promotion listed in Part 1 must give a written Appeal Notice within 21 days following gazettal of the promotion to – Industrial Registrar Industrial Registry Email: [email protected] Web Address: www.qirc.qld.gov.au for Appeal Notice For general enquiries prior to lodgement of an appeal: Contact Industrial Registry on 1300 592 987 or email [email protected] APPOINTMENT PART I – APPEALABLE Reference Vacancy Date of Name of Appointee Previous Position and Classification Number Appointment (Unless otherwise indicated) Department of Agriculture and Fisheries 321123/19 Senior Business Services Officer Date of duty Mitchell, Sarah Business Services Officer, (Finance), Business Support and Business Support and Governance, Governance, Business Services, Business Services, Biosecurity Biosecurity Queensland, Queensland, Brisbane (AO5) Brisbane (AO6) 321735/19 Service Desk Analyst, Operations, Date of duty Dorman, Samuel Service Desk Operator, Operations, Information and Technology Partners, Information and Technology Partners, Corporate, Brisbane (AO4) Corporate, Brisbane (AO3) Department of Child Safety, Youth and Women 322624/19 Analyst, Systems Performance, Date of duty Ho, Michelle Administration Officer, Systems Strategy and Delivery Performance, Performance, Strategy and Delivery Strategy, Brisbane (AO5) Performance, Strategy, Brisbane (AO3) 322507/19 Court Coordinator, Youth Justice Date of duty Thorne, Meegan Caseworker, Youth Justice Services, Services – Moreton, Region – Moreton, Region – Morton, Youth Justice Service Delivery, Morayfield (PO3) Regional Services, Caboolture (PO2) 324114/19 Manager, Investment and Date of duty Devine, Catherine Principal Child Protection Partnerships, Region – Northern Practitioner, Child and Family, Region Queensland, Service Delivery, – Northern Queensland, Service Mount Isa (AO8) Delivery, Mount Isa (PO5) 323500/19 Restorative Justice Administration Date of duty Smith, Fiona Administrative Officer, Youth Justice Officer, Youth Justice Services, Region Services, Region – Moreton, Youth – Moreton, Service Delivery, Justice Regional Services, Mooloolaba (AO3) Mooloola (AO2) 311415/19 Senior Team Leader, Child and Date of duty Goslin, Paula Senior Case Manager, Central Region, Family, Region – Central Queensland, Probation and Parole, Statewide Service Delivery, Rockhampton (PO5) Operations, Rockhampton (PO3) 321507/19 Senior Transition Officer, Youth Date of duty Moschella, Stephanie Youth Worker, Western District, Youth Justice Services, Region – Moreton, Justice Services, Region – Morton, Service Delivery, Forest Lake (AO6) Youth Justice Regional Services, Forest Lake (OO3) 15 November 2019] QUEENSLAND GOVERNMENT GAZETTE No. 82 395 APPOINTMENT PART I – APPEALABLE Reference Vacancy Date of Name of Appointee Previous Position and Classification Number Appointment (Unless otherwise indicated) Department of Communities, Disability Services and Seniors 320022/19 Manager, National Disability Date of duty McFarlane, Lauren Senior Complaints and Investigation Insurance Scheme, Governance and Officer, Complaints and Reporting, Monitoring and Reporting, Investigations, Safeguards, Inclusion Engagement and Disability Connect Queensland, Assurance, Disability Connect Brisbane (AO6) Queensland, Brisbane (AO8) 319468/19 Advisor (Safety, Wellbeing and Injury Date of duty Ashe, Susan Workplace Health and Safety Advisor, Management), Office of the Director, Work Safety and Wellbeing, West South West Accommodation Support Moreton Health, Queensland Health, and Respite Services, Disability Brisbane (AO4) Accommodation Respite and Forensic Services, Ipswich (AO5) Department of Education CQR Head of Department – Health 16-11-2019 Swan, Nicholas James Teacher, Sarina State High School, 320905/19P and Physical Education, Central Queensland Region (TCH) Sarina State High School, Central Queensland Region (HOD) SER Guidance Officer, 23-01-2020 O’Rourke, Kathryn Teacher, Palm Beach – Currumbin 323710/19P South East Region (GO) Diane State High School, South East Region (TCH) SER Guidance Officer, 23-01-2020 Peardon, Jade Teacher, Mabel Park State School, 323710/19P South East Region (GO) Kayleen South East Region (TCH) SER Guidance Officer, 23-01-2020 Avgerinos, Lukas Jon Teacher, Woodridge State High 323710/19P South East Region (GO) School, South East Region (TCH) SER Guidance Officer, 23-01-2020 Simmons, Amanda Teacher, Park Ridge State High 323710/19P South East Region (GO) Jane School, South East Region (TCH) SER Guidance Officer, 23-01-2020 Maksoud, Jacqueline Teacher, Waterford State School, 323710/19P South East Region (GO) Antoinette South East Region (TCH) SER Guidance Officer, 23-01-2020 Russon, Nicole Teacher, Norfolk Village State School, 323710/19P South East Region (GO) Justine South East Region (TCH) SER Guidance Officer, 23-01-2020 Forbes, Catherina Teacher, Springfield Lakes State 323710/19P South East Region (GO) Maria School, Metropolitan Region (TCH) SER Guidance Officer, 23-01-2020 Butler, Maggie Teacher, Shailer Park State High 323710/19P South East Region (GO) School – Special Education Program, South East Region (TCH) CQR Head of Department – Mathematics, 23-01-2020 Gardiner, Ashlee Teacher, Mackay Northern 320565/19P Mackay Northern Beaches Elaine Beaches State High School, State High School, Central Queensland Region (TCH) Central Queensland Region (HOD) MER Head of Department – Industrial 23-01-2020 Goodacre, Alyce Kaye Teacher, Brisbane State High School, 322302/19P Design and Technology, Springfield Metropolitan Region (TCH) Central State High School, Metropolitan Region (HOD) 396 QUEENSLAND GOVERNMENT GAZETTE No. 82 [15 November 2019 APPOINTMENT PART I – APPEALABLE Reference Vacancy Date of Name of Appointee Previous Position and Classification Number Appointment (Unless otherwise indicated) NQR Head of Department – Teaching 25-11-2019 Phillips, Cheryl Anne Teacher, Thuringowa State High School, 321494/19P and Learning, Thuringowa North Queensland Region (TCH) State High School, North Queensland Region (HOD) NQR Head of Department – Student 04-11-2019 Janke, Sara Jane Teacher, Doomadgee State School, 320789/19P Services – Doomadgee State School, North Queensland Region (TCH) North Queensland Region (HOD) CQR Head of Department – The Art and 16-11-2019 Pearce, Allison Louise Teacher, Sarina State High School, 320912/19P Languages – Sarina State High School, Central Queensland Region (TCH) Central Queensland Region (HOD) MER Head of Department – Science, 11-11-2019 Imhoff, Michelle Teacher, Bremer State High School, 319728/19P Bremer State High School, Louise Metropolitan Region (TCH) Metropolitan Region (HOD) SER Head of Department – The Arts, 18-11-2019 Usher, Stacey Teacher, Kingston State College, 322348/19P Kingston State College, Kathleen South East Region (TCH) South East Region (HOD) MER Head of Department – Student 23-01-2020 Faulkner, Nicholas Teacher, Bundamba State Secondary 323528/19P Support, Cavendish Road State High Robert College, Metropolitan Region (TCH) School, Metropolitan Region (HOD) MER Head of Department – Science, New 12-11-2019 Tull, Lauren Nicole Teacher, Brisbane School of Distance 323692/19P Secondary School Ripley Valley, Education, Metropolitan Region Metropolitan Region (HOD) (HOD) MER Head of Department – Humanities, 23-01-2020 Butterworth, Matthew Teacher, Calamvale Community 323617/19P Calamvale Community College, College, Metropolitan Region (TCH) Metropolitan Region (HOD) DSR Head of Department – Mathematics, 23-01-2020 Kok, William Hiu Lam Teacher, Charleville State High 322912/19P Nanango State High School, Darling School, Darling Downs Downs South West Region (HOD) South West Region (TCH) CQR Head of Department – Student 18-11-2019 Nicholls, Samantha Teacher, Sarina State High School, 320916/19P Services, Sarina State High School, Lee Central Queensland Region (TCH) Central Queensland Region (HOD) Department of Environment and Science 322671/19 Principal Advisor, Northern Parks and Date of duty Dean, Craig Assistant Principal Ranger, Northern Forests Regional Operations, Parks and Forests Regional Management and Operations, Operations, Management and Queensland Parks and Wildlife Operations, Queensland Parks and Services and Partnerships, Wildlife Services and Partnerships, Cairns (AO7) Cairns (AO6) 323035/19 Manager, Protected Area Investment, Date of duty Burns, Robbie Program Coordinator, Protected Area Protected Area Strategy and Investment, Protected Area Strategy Investment, Queensland Parks and and Investment, Queensland Parks Wildlife Services and Partnerships, and Wildlife Services and Brisbane (AO8) Partnerships, Brisbane (AO7) 315152/19 Principal Scientist, Land Surface Date of duty Hansen, Joanne Senior Scientist, Land Surface Sciences, Science Delivery and Sciences, Science Delivery and Knowledge, Science and Technology, Knowledge, Science and Technology, Dutton Park (PO5) Dutton Park (PO4) 15 November 2019] QUEENSLAND GOVERNMENT GAZETTE No. 82 397 APPOINTMENT PART I – APPEALABLE Reference Vacancy Date of Name of Appointee Previous Position and Classification Number Appointment (Unless otherwise indicated) Department of Housing and Public Works 324959/19 Principal Capability and Accreditation Date of duty Johnson, Lauren Human Resource Advisor, People and Officer, Advisory Capability and Culture, Queensland Health, Knowledge Services, Office of the Brisbane (AO5) Chief Advisor, Portfolio Strategy, Brisbane (AO7) 324770/19 Principal Digital Communication Date of duty O’Dwyer, Carlie Lead Content Designer, Queensland, Designer, Communication and Shared Services Strategy and Engagement Unit, Portfolio Strategy, Engagement, Digital Technology and Brisbane (AO7) Services, Brisbane (AO6) Department of Justice and Attorney-General 323715/19 Team Leader, Magistrates Courts Date of duty Hodges, Charlotte Case Manager, Magistrates Courts Service, Queensland Courts Service, Service, Queensland Courts Service, Justice Services, Caboolture (PO4) Justice Services, Brisbane (PO3) 321416/19 Domestic and Family Violence Date of duty McCarroll, Catherine Executive Support Officer, Integration Officer, Magistrates Courts Magistrates Courts Service, Service, Queensland Courts Service, Queensland Courts Service, Justice Services, Beenleigh (AO6) Justice Services, Brisbane (AO3) 321416/19 Domestic and Family Violence Date of duty Hogan, Craig Deputy Senior Registrar, Magistrates Integration Officer, Magistrates Courts Courts Service, Queensland Courts Service, Queensland Courts Service, Service, Justice Services, Justice Services, Caboolture (AO6) Caboolture (AO5) 321416/19 Domestic and Family Violence Date of duty Thompson, Hayley Courts Services Officer, Magistrates Integration Officer, Magistrates Courts Courts Service, Queensland Courts Service, Queensland Courts Service, Service, Justice Services, Justice Services, Ipswich (AO6) Brisbane (AO3) 323472/19 Senior Advisor Child Protection, Date of duty Cotter, Jordan Senior Case Manager, Brisbane Magistrates Courts Service, Region Probation and Parole, Queensland Courts Service, Justice Queensland Corrective Services, Services, Brisbane (AO6) Brisbane (PO3) Department of Natural Resources, Mines and Energy * 322925/19 Senior Valuer, State Valuation Service Date of duty Lynch, Gary Valuer, State Valuation Service Operations, State Valuation Service, Operations, State Valuation Service, Lands, Rockhampton (PO4) Lands, Rockhampton (PO3) * Advertised as Rockhampton, Emerald or Mackay (Negotiable). Department of Premier and Cabinet 321753/19 Legislation Editing and Publishing Date of duty Fleming, Helen Legislation Editing and Publishing Officer Grade 3, Legislation and Officer Grade 2, Legislation and Business Services, Office of the Business Services, Office of the Queensland Parliamentary Counsel, Queensland Parliamentary Counsel, Brisbane (AO5) Brisbane (AO4) Queensland Corrective Services 322225/19 Correctional Manager, Date of duty McIndoe, Gavin Correctional Supervisor, Capricornia Accommodation, Capricornia Correctional Centre, Custodial Correctional Centre, Custodial Operations, Statewide Operations, Operations, Statewide Operations, Rockhampton (GS3) Etna Creek, Rockhampton (AO7) 398 QUEENSLAND GOVERNMENT GAZETTE No. 82 [15 November 2019 APPOINTMENT PART I – APPEALABLE Reference Vacancy Date of Name of Appointee Previous Position and Classification Number Appointment (Unless otherwise indicated) 321323/19 Probation Services Officer, North Date of duty Grice, Adam Garth Correctional Supervisor, Woodford Coast Region, Probation and Parole, William Correctional Centre, Custodial Statewide Operations, Operations, Statewide Operations, Strathpine (AO4) Woodford (GS1) 318643/19 Program Manager Enterprise Portfolio Date of duty Feldman, Kelly Senior Project Officer, Organisation Management Officer, Enterprise Capability Command, Strategy Policy Portfolio Management Office, and Perform, Queensland Police Organisational Capability, State Law Service, Brisbane (AO6) Building, Brisbane (AO8) 324763/19 Sentence Planning Adviser, Southern Date of duty Roscow, Kyle Sentence Planning Officer, Central Sentence Administration Hub, Region, Sentence Management Sentence Management Services, Services, Specialist Operations, Specialist Operations, Brisbane (AO3) Maryborough (AO2) 318853/19 Advisor Parole Board Secretariat, Date of duty Keding, Millissa Support Officer Parole Board Parole Board Secretariat, Secretariat, Parole Board Secretariat, Operational Support Services, Operational Support Services, Brisbane (AO5) Brisbane (AO3) 318853/19 Advisor Parole Board Secretariat, Date of duty Pearce, Jackson Sentence Planning Advisor, South Parole Board Secretariat, East Queensland Reception and Operational Support Services, Protection, Sentence Management Brisbane (AO5) Services, Specialist Operations, Brisbane (AO3) 316298/19 Senior Case Manager, Brisbane Date of duty Melville, Julie Case Manager, Brisbane Region, Region, Probation and Parole, Probation and Parole, Statewide Statewide Operations, Brisbane (PO3) Operations, Chermside (PO2) 323050/19 Probation and Parole Supervisor, Date of duty Bishop, Sarah Jade Senior Case Manager, Southern Southern Region, Probation and Region, Probation and Parole, Parole, Statewide Operations, Statewide Operations, Roma (AO6) Toowoomba (PO3) Queensland Health 323679/19 Principal Advisor Strategy and Date of duty Santillan, Elizabeth Advisor Strategy and Governance, Governance, Strategy Governance Strategy Governance and Legal, and Legal, Corporate Services, Head Corporate Services, Head Office, Office, Kedron (AO7) Kedron (AO5) Department of Transport and Main Roads 324246/19 Senior Advisor (Passenger Transport Date of duty Crompton, Emma Project Officer, Infrastructure Systems Technology), Passenger Transport Services, Portfolio Investment and Technology Projects, Passenger Programming, Policy, Planning and Transport Strategy and Technology, Investment, Brisbane (AO4) Brisbane (AO6) 321017/19 Advisor (Project Controls), Date of duty Nia Nia, Jamie-Lee Finance Support Officer, Metropolitan Metropolitan Region, Program Region, Program Delivery and Delivery and Operations, Operations, Infrastructure Infrastructure Management and Management and Delivery, Delivery, Brisbane (AO5) Brisbane (AO3) 316128/19 Construction Technician, North, Date of duty Farlow, Daniel Construction Technician, North, RoadTek, Infrastructure Management RoadTek, Infrastructure Management and Delivery, Rockhampton (TO3) and Delivery, Rockhampton (TO2) 15 November 2019] QUEENSLAND GOVERNMENT GAZETTE No. 82 399 NOTIFICATION OF THE FILLING OF APPOINTMENTS PART II Appointments have been approved to the undermentioned vacancies. Appeals do not lie against these appointments. APPOINTMENTS PART II – NON-APPEALABLE Reference Vacancy Date of Appointment Name of Appointee Number Department of Communities, Disability Services and Seniors * 317420/19 Assistant Director-General, Date of duty Wise, Maxwell John Disability Connect Queensland, Brisbane (SES3H) 318144/19 Director, Strategic Policy and Legislation, Date of duty Cruickshank, Hannah Strategic Policy and Legislation, Brisbane (SO) * Contract for five (5) years. Department of Education * NQR Lead Principal, North Queensland Region, 16-01-2020 Neumann, Dianne Lesley 323475/19T State Schools Division, Townsville (SL7) ** CO Executive Director, Strategy and Planning Unit, 09-12-2019 Casey, Natalie Chantal 322250/19T Infrastructure Services Branch, Corporate Services Division, Brisbane (SES2H) SER Principal, Ormeau Woods State High School, 18-01-2020 Murtas, Daniel Anthony 324265/19P South East Region (SL7) DSR Principal, Dalveen State School, Darling Downs, 01-01-2020 Priddle, Katelyn Mary Ellen 322951/19P South West Region (SL1) DSR Deputy Principal, Darling Heights State School, 16-11-2019 Clements, Keiryn May 323826/19P Darling Downs, South West Region (DSL2) MER Deputy Principal, Albany Hills State School, 23-01-2020 Farley, Jodie Leigh 32584/19P Metropolitan Region (DSL2) MER Principal, Morningside State School, 16-11-2019 Kennedy, Sheryl Maree 324508/19P Metropolitan Region (SL4) # FNR Executive Principal, Trinity Bay State High School, 06-11-2019 Woodcock, Martin Harrison 318702/19T Far North Queensland Region (EP) NCR Head of Department – Teaching and Learning, Kawana 23-01-2020 Sloan, April Lee 319345/19P Waters State College, North Coast Region (HOD) CQR Deputy Principal, Moranbah State School, 23-01-2020 Hinde, Luke William 324235/19P Central Queensland Region (DSL2) DSR Principal, Kingaroy State School, Darling Downs, 23-01-2020 Taule’alo, Masina John 323308/19P South West Region (SL5) FNR Head of Campus, Northern Peninsula 23-01-2020 Moore, Geoffrey Leslie 323523/19P Area College – Bamaga Senior Campus, Far North Queensland Region (SL4) * Contract period from 11-11-2019 to 10-11-2022. ** Contract period from 09-12-2019 to 08-12-2022. # This is a s122 contract for the period from 06-11-2019 to 05-11-2022. 400 QUEENSLAND GOVERNMENT GAZETTE No. 82 [15 November 2019 APPOINTMENTS PART II – NON-APPEALABLE Reference Vacancy Date of Appointment Name of Appointee Number Department of Environment and Science 317914/19 Director, Permits, Permissions Management, Queensland Date of duty Farquhar, Phillip Parks and Wildlife Services and Partnerships, Brisbane (SO) Department of Innovation, Tourism Industry Development and the Commonwealth Games 320766/19 Director, Startup Programs, Innovation Programs, Date of duty Smith, Sarah Innovation, Brisbane (SO) Department of Natural Resources, Mines and Energy * 316105/19 Executive Director, Georesources Policy, Date of duty Shaw, Christopher Policy, Brisbane (SES3 L) * Contract is for a period of five (5) years. Parliamentary Service PAR Indigenous Liaison Officer, Chamber, 23-10-2019 Stewart, Joseph Bain 32/19 Education and Communication Services, Parliamentary Service, Brisbane (AO5) Queensland Corrective Services 318040/19 Director Legal, Right to Information and Privacy, Date of duty Chen, Yi Legal Right To Information and Privacy, Strategy and Governance, Brisbane (SO) Queensland Treasury * 313026/19 Commissioner of State Revenue, Office of the Date of duty Jackson, Mark John Commissioner – Office of State Revenue, Brisbane (S122) * Contract for five (5) years. 15 November 2019] QUEENSLAND GOVERNMENT GAZETTE No. 82 401 ! " $ ' % " -. /0-1 /2345' ! " # $ % " & & % % " '( $) ''( $) " '*'' +$" , " " +$" '*'' +$" ! " +$" +$" 9xptyqxf typrfityr@fp py thpwpfppxftw'rfp p3swirf Ithpfp@RStyhwtpywp sptp f pi 402 QUEENSLAND GOVERNMENT GAZETTE No. 82 [15 November 2019 Acquisition of Land Act 1967 E KHDGLQJVKDYHEHHQLQFOXGHGIRUHDVHRIUHIHUHQFH DQGJXLGDQFHDQGWKLV(DVHPHQWLVWREHFRQVWUXHG 7$.,1*2)($6(0(17127,&(($6 ZLWKRXWUHIHUHQFHWRWKHP 6KRUWWLWOH F WKH VLQJXODU QXPEHU LQFOXGHV WKH SOXUDO DQG YLFH 7KLV QRWLFH PD\ EH FLWHG DV WKH Taking of Easement YHUVD Notice EAS 1943 (2019) G ZRUGV LPSRUWLQJ D PDVFXOLQH JHQGHU LQFOXGHV DOO (DVHPHQWWDNHQ>VVDQG G RIWKH$FW@ RWKHUJHQGHUVDQG H ZRUGV LPSRUWLQJ SHUVRQV LQFOXGH FRPSDQLHV DQG 7KH HDVHPHQW GHVFULEHG LQ 6FKHGXOH LV WDNHQ E\ FRUSRUDWLRQVDQGYLFHYHUVD 1RUWKHUQ 6(4 'LVWULEXWRU5HWDLOHU $XWKRULW\ WUDGLQJ DV I LI D FRYHQDQW FRQWDLQHG LQ WKLV (DVHPHQW LV RU 8QLW\ZDWHU IRUZRUNVIRUWKHUHWLFXODWLRQRIZDWHUVXSSO\DQG EHFRPHV LQYDOLG RU XQHQIRUFHDEOH WKH UHPDLQLQJ YHVWVLQ1RUWKHUQ6(4'LVWULEXWRU5HWDLOHU$XWKRULW\ WUDGLQJ FRYHQDQWVFRQWDLQHGLQWKLV(DVHPHQWUHPDLQLQIXOO DV8QLW\ZDWHU RQDQGIURP1RYHPEHU IRUFHDQGHIIHFWDQG 5LJKWVDQGREOLJDWLRQV J LIDSDUW\WRWKLV(DVHPHQWFRPSULVHVWZRRUPRUH 7KDWWKHULJKWVDQGREOLJDWLRQVFRQIHUUHGDQGLPSRVHG OHJDO HQWLWLHV WKH FRYHQDQWV FRQWDLQHG LQ WKLV E\WKH(DVHPHQWLQFOXGHWKHPDWWHUVVHWRXWLQ6FKHGXOH (DVHPHQWELQGHDFKRIWKHPMRLQWO\DQGVHYHUDOO\ 6&+('8/( 5,*+762)81,7<:$7(5 '(),1,7,216$1',17(535(7$7,21 $FFHVV 'HILQLWLRQV :KHUH WKH SXUSRVH RI WKLV (DVHPHQW LQFOXGHV $FFHVV WKH ,Q WKLV (DVHPHQW XQOHVV WKH FRQWH[W RU VXEMHFW PDWWHU IROORZLQJZLOODSSO\ UHTXLUHRWKHUZLVH 7KH 2ZQHU JUDQWV WR 8QLW\ZDWHU WKH IXOO DQG IUHH ULJKW DQG D (DVHPHQW /DQG PHDQV WKDW SDUW RI WKH ODQG RYHU OLEHUW\DWDOOWLPHVDIWHUWKHGDWHRIWKLV(DVHPHQWWRHQWHUXSRQ ZKLFKWKLVHDVHPHQWLVWDNHQ DQGUHPDLQSDVVDQGUHSDVVRQDQGRYHUWKH(DVHPHQW/DQGDW E 0DWWHU PHDQV EXLOGLQJV VWUXFWXUHV RU RWKHU ZLOO DQG DV RIWHQ DV WKH RFFDVLRQ UHTXLUHV ZLWK HPSOR\HHV PDWHULDOV RU WKLQJV HUHFWHG SODFHG IRXQG RU DJHQWV DQG FRQWUDFWRUV DQG RWKHU SHUVRQV DXWKRULVHG E\ LQVWDOOHG XSRQ WKH (DVHPHQW /DQG DQG LQFOXGHV 8QLW\ZDWHUDQGZLWKRUZLWKRXWYHKLFOHVSODQWDQGHTXLSPHQW WUHHVDQGSODQWVZLWKLQWKH(DVHPHQW/DQG RIDQ\GHVFULSWLRQZKDWVRHYHU F 2ZQHU PHDQV DQ\ SHUVRQ ZKR KDV DQ HVWDWH 6HZHUDJHRU:DWHU6XSSO\RU%RWK LQWHUHVW ULJKW SRZHU RU SULYLOHJH LQ RYHU RU LQ :KHUHWKHSXUSRVHRIWKLV(DVHPHQWLQFOXGHV6HZHUDJHRU UHODWLRQWRWKHODQGVXEMHFWWRWKH(DVHPHQW/DQG :DWHU6XSSO\RUERWKWKHIROORZLQJZLOODSSO\ DQG WKDW SHUVRQ¶V DGPLQLVWUDWRUV DVVLJQHHV DQG 7KH2ZQHUJUDQWV8QLW\ZDWHUWKHIXOODQGIUHHULJKWDQGOLEHUW\ VXFFHVVRUVDQG DWDOOWLPHVDIWHUWKHGDWHRIWKLV(DVHPHQWWRHQWHUXSRQWKH G 5HOHYDQW:RUNVPHDQV (DVHPHQW/DQGIRUWKHSXUSRVHVRIFRQVWUXFWLQJDQGWKHUHDIWHU L ZKHUH WKH SXUSRVH RI WKLV (DVHPHQW LV IRUHYHUXVLQJDQGPDLQWDLQLQJWKH5HOHYDQW:RUNVDVLWVKDOO ³6HZHUDJH´ IURPWLPHWRWLPHWKLQNILWDQGLQVRGRLQJ8QLW\ZDWHUE\LWV VHZHU V DQGRUSLSHOLQH V IRUWKHSXUSRVHRI HPSOR\HHVDJHQWVDQGRWKHUSHUVRQVDXWKRULVHGE\8QLW\ZDWHU FRQYH\LQJ VHZHUDJHDQGDOO NLQGV RI ZDVWH KDVWKHULJKWWR WKURXJKDFURVVRUXQGHUWKH(DVHPHQW/DQG D FRQVWUXFWLQVWDOOH[WHQGGHHSHQZLGHQFOHDQVHDGG WRJHWKHU ZLWK PDQKROHV VWRSFRFNV DQG DOO WRUHPRYHLQVSHFWPDLQWDLQDQGUHSDLUWKH5HOHYDQW RWKHU XVXDO RU QHFHVVDU\ ILWWLQJV DQG :RUNVDQGZKHQDQGZKHUHWKRXJKWILWE\8QLW\ZDWHU DWWDFKPHQWV LQFOXGLQJSXPSVDQGRUSXPS WRUHPRYHDQGUHSODFHWKH5HOHYDQW:RUNVZLWKQHZ VWDWLRQVZKHUHUHTXLUHG DVZHOODVZRUNVIRU 5HOHYDQW:RUNV ZKHWKHURIDVLPLODUQDWXUHWRWKRVH WKHSURWHFWLRQDQGRUVXSSRUWRIVXFKWKLQJV UHSODFHGRUQRW DQG E WRFKDQJHWKHVL]HDQGQXPEHURIDQ\SLSHVZKLFKIRUP LL ZKHUHWKHSXUSRVHRIWKLV(DVHPHQWLV³:DWHU SDUWRIWKH5HOHYDQW:RUNV 6XSSO\´ F GLJLQWRVLQNVKDIWVLQDQGHUHFWVFDIIROGLQJXSRQWKH ZDWHUUHWLFXODWLRQPDLQVDQGRUSLSHOLQHVIRU (DVHPHQW/DQGDQGWRRSHQDQGEUHDNXSWKHVRLORIWKH WKHSXUSRVHRIFRQYH\LQJZDWHUVXSSOLHGE\ (DVHPHQW /DQG RU DQ\ SDUW RI WKH (DVHPHQW /DQG 8QLW\ZDWHU WKURXJK DFURVV RU XQGHU WKH LQFOXGLQJLWVVXEVXUIDFH (DVHPHQW /DQG WRJHWKHU ZLWK PDQKROHV G UHPRYHDQGGLVSRVHRIVSRLOFUHDWHGDVDFRQVHTXHQFH VWRSFRFNVPHWHUVSUHVVXUHFRQWUROGHYLFHV RIH[HUFLVLQJLWVULJKWVKHUHXQGHU SXPSV DQGRU SXPS VWDWLRQV ZDWHU H FOHDUDQGNHHSFOHDUWKH(DVHPHQW/DQGE\DQ\PHDQV UHVHUYRLUV DQG DOO RWKHU XVXDO RU QHFHVVDU\ RU PHWKRG DQG WR FXW DQG UHPRYH WLPEHU WUHHV DQG ILWWLQJVDQGDWWDFKPHQWVDVZHOODVZRUNVIRU XQGHUJURZWKIURPWKH(DVHPHQW/DQGDQGWREXUQRII WKH SURWHFWLRQ DQGRU VXSSRUW RI DOO VXFK VXFKWLPEHUWUHHVDQGXQGHUJURZWK WKLQJVDQG I FRQVWUXFW DQG PDLQWDLQ RQ WKH (DVHPHQW /DQG VXFK H 8QLW\ZDWHUPHDQV DFFHVV WUDFNV JDWHV DQG DSSXUWHQDQW ZRUNV DV LW L 7KH 1RUWKHUQ 6(4 'LVWULEXWRU5HWDLOHU FRQVLGHUVQHFHVVDU\ $XWKRULW\ WUDGLQJ DV 8QLW\ZDWHU HVWDEOLVKHG J HQWHUXSRQDQGUHPDLQSDVVDQGUHSDVVRQDQGRYHUWKH XQGHUVHFWLRQRIWKHSouth-East Queensland (DVHPHQW/DQGIRUDOORUDQ\RIWKHSXUSRVHVDIRUHVDLG Water (Distribution and Retail Restructuring) ZLWKRUZLWKRXWYHKLFOHVSODQWDQGHTXLSPHQWRIDQ\ Act 2009DQGLWVDVVLJQHHVDQGVXFFHVVRUVDQG GHVFULSWLRQZKDWVRHYHU LL ,IWKHFRQWH[WSHUPLWV$XWKRULVHG3HUVRQV K HQWHUDQGH[LWWRDQGIURPWKH(DVHPHQW/DQGRYHUVXFK ,QWHUSUHWDWLRQ SDUWRUSDUWVRIWKH2ZQHU¶VODQGDGMRLQLQJRUDGMDFHQW ,QWKLV(DVHPHQW WR WKH (DVHPHQW /DQG DV LV UHDVRQDEO\ UHTXLUHG E\ D DUHIHUHQFHWRDVWDWXWHLQFOXGHV2UGHUVLQ&RXQFLO 8QLW\ZDWHU DQG 8QLW\ZDWHU VKDOO FRQVLGHU PRVW 3URFODPDWLRQV 5HJXODWLRQV 5XOHV /RFDO /DZV FRQYHQLHQW RU QHFHVVDU\ IRU WKH SXUSRVH RI SDVVLQJ DQG 2UGLQDQFHV PDGH XQGHU WKH VWDWXWH DQG DQ\ EHWZHHQWKH(DVHPHQW/DQGDQGWKHPRVWFRQYHQLHQW VWDWXWH DPHQGLQJ FRQVROLGDWLRQ RU UHSODFLQJ WKH SRLQWRIHQWU\WRRUH[LWIURPWKH2ZQHU¶VODQG ZKHWKHU VWDWXWH DGMRLQLQJDFRQVWUXFWHGURDGRUQRW 15 November 2019] QUEENSLAND GOVERNMENT GAZETTE No. 82 403 L GRVXFKRWKHUZRUNVDQGWKLQJVWKURXJKDFURVVLQ L 8QLW\ZDWHULVQRWRWKHUZLVHUHVSRQVLEOHIRU RUXQGHUWKH(DVHPHQW/DQGDVDUHLQFLGHQWDOWRWKH DQ\GDPDJHWRRUGHVWUXFWLRQRIDQ\0DWWHU SURSHUH[HUFLVHRIWKHULJKWVJUDQWHGWR8QLW\ZDWHU LQWKHFRXUVHRIWKHH[HUFLVHE\8QLW\ZDWHU XQGHUWKLV(DVHPHQWDQG RILWVULJKWVXQGHUWKLV(DVHPHQWDQG M XVH VXFK SDUW RU SDUWV RI WKH 2ZQHU¶V ODQG LL VXEMHFWWR&ODXVH8QLW\ZDWHULVQRWXQGHU LPPHGLDWHO\DGMDFHQWWRRUDGMRLQLQJHLWKHUVLGHRI DQ\ REOLJDWLRQ WR UHLQVWDWH RU UHSDLU DQ\ WKH(DVHPHQW/DQGDVPD\EHUHDVRQDEO\UHTXLUHG 0DWWHUGDPDJHGRUGHVWUR\HGLQFRQVHTXHQFH E\8QLW\ZDWHUIRUWKHSURSHUH[HUFLVHRIWKHULJKWV RI WKH H[HUFLVH E\ 8QLW\ZDWHU RI LWV ULJKWV JUDQWHGWR8QLW\ZDWHUXQGHUWKLV(DVHPHQW XQGHUWKLV(DVHPHQWDQGLWVRQO\REOLJDWLRQ 3523(57<,15(/(9$17:25.6 ZKHUHVXFK0DWWHUKDVEHHQVRGDPDJHGRU 7KH 5HOHYDQW :RUNV DUH DQG UHPDLQ WKH SURSHUW\ RI GHVWUR\HGLVWROHDYHWKH(DVHPHQW/DQGLQDV 8QLW\ZDWHU QRWZLWKVWDQGLQJ DQ\ DFWXDO RU DSSDUHQW FOHDQ DQG WLG\ VWDWH DV SUDFWLFDEOH KDYLQJ DIIL[LQJ WR WKH (DVHPHQW /DQG 8QLW\ZDWHU VKDOO EH UHJDUGWRWKHQDWXUHRIWKH0DWWHUZKLFKKDV VROHO\UHVSRQVLEOHIRUWKHRSHUDWLRQDQGPDLQWHQDQFHRI EHHQ GDPDJHG RU GHVWUR\HG DQG WKH ZRUN DOO5HOHYDQW:RUNV ZKLFKLWKDVGRQHDQG )(1&,1* LLL 8QLW\ZDWHULVQRWLQDQ\HYHQWUHVSRQVLEOHIRU 5HPRYDO DQ\ LQFRQYHQLHQFH RU GLVWXUEDQFH WR WKH )RUWKHSXUSRVHRIJDLQLQJDFFHVVWRWKH(DVHPHQW/DQG 2ZQHU RU RFFXSLHUV RI WKH (DVHPHQW /DQG 8QLW\ZDWHUPD\GHPROLVKRUEUHDNRSHQDQ\IHQFLQJRQ DULVLQJRXWRIWKHH[HUFLVHE\8QLW\ZDWHURI RUDGMDFHQWWRWKH(DVHPHQW/DQG+RZHYHULIOLYHVWRFN LWVULJKWVXQGHUWKLV(DVHPHQW DUH FRQWDLQHG ZLWKLQ WKH IHQFHG DUHD 8QLW\ZDWHU PXVW 5(029$/2)81$87+25,6('6758&785(6 JLYHUHDVRQDEOHQRWLFHWRWKH2ZQHUWRHQDEOHWKH2ZQHU ,ID0DWWHULVHUHFWHGSODFHGIRXQGRULQVWDOOHGXSRQWKH WRVHFXUHWKHOLYHVWRFN (DVHPHQW/DQGLQFRQWUDYHQWLRQRI&ODXVH8QLW\ZDWHU 5HLQVWDWHPHQW PD\LQDGGLWLRQWRDQ\RWKHUUHPHGLHVDQGDIWHUKDYLQJ 8QLW\ZDWHUPXVWHLWKHU ILUVWJLYHQWKH2ZQHUUHDVRQDEOHQRWLFHRILWVLQWHQWLRQWR D UHLQVWDWHDOOIHQFHV RWKHUWKDQDIHQFHHUHFWHGLQ LQYRNH WKLV FODXVH HQWHU XSRQ WKH (DVHPHQW /DQG DQG FRQWUDYHQWLRQRI&ODXVH GDPDJHGE\8QLW\ZDWHU UHPRYHRUGHPROLVKWKH0DWWHUDQGLILWGRHVVR LQWKHH[HUFLVHDQGSHUIRUPDQFHRIDQ\RIWKHULJKWV D LW PD\ GLVSRVH RI WKH 0DWWHU RU DQ\ UHVXOWDQW DQG OLEHUWLHV JUDQWHG WR 8QLW\ZDWHU XQGHU WKLV GHPROLWLRQPDWHULDOVLQVXFKPDQQHUDVLWVHHVILW (DVHPHQWRU ZLWKRXW EHLQJ OLDEOH WR DFFRXQW WR WKH 2ZQHU E LIWKHIHQFHVDUHQRWUHLQVWDWHGLQVWDOODJDWHXVLQJ WKHUHIRUH H[FHSW DV SURYLGHG LQ VXEFODXVH E RI PDWHULDOV DQG HPSOR\LQJ ZRUNPDQVKLS ZKLFK LV WKLVFODXVH DQG QRW OHVV WKDQ WKH TXDOLW\ RI WKH PDWHULDOV DQG E LW PD\ UHFRYHU LQ DQ\ &RXUW RI FRPSHWHQW ZRUNPDQVKLS LQ WKH H[LVWLQJ IHQFH 7KH JDWH MXULVGLFWLRQFRVWVDFWXDOO\LQFXUUHGE\LWLQWDNLQJ LQVWDOOHG SXUVXDQW WR WKLV VXEFODXVH EHFRPHV WKH WKDW DFWLRQ LQFOXGLQJ LQWHUQDO ZDJH DQG VDODU\ SURSHUW\RIWKHRZQHURIWKHIHQFHLQZKLFKWKHJDWH FRVWV OHVVDQ\PRQH\VDFWXDOO\UHFHLYHGE\LWDVD LV LQVWDOOHG DQG DIWHU LQVWDOODWLRQ VKDOO EH UHVXOWRIGLVSRVLQJRIWKH0DWWHURUDQ\UHVXOWDQW PDLQWDLQHGE\WKHRZQHU GHPROLWLRQPDWHULDOV 126758&785(6217+(($6(0(17/$1' 3527(&7,212)5(/(9$17:25.6 7KH 2ZQHU PXVW QRW DW DQ\ WLPH ZLWKRXW WKH H[SUHVV 7KH 2ZQHU ZLOO QRW GR DQ\ DFW RU PDNH DQ\ RPLVVLRQ ZULWWHQ SHUPLVVLRQ RI 8QLW\ZDWHU ZKLFK PXVW QRW EH ZKLFKZLOOMHRSDUGLVHRUSUHMXGLFLDOO\DIIHFWWKHVDIHW\RU XQUHDVRQDEO\ZLWKKHOG UHOLDEOHZRUNLQJRIDQ\5HOHYDQW:RUNV D HUHFWDQ\EXLOGLQJVRUVWUXFWXUHV RWKHUWKDQIHQFHV 5$7(6$1'&+$5*(6 XSRQWKH(DVHPHQW/DQGRUDQ\SDUWRILW 7KH2ZQHULVUHVSRQVLEOHIRUDOOORFDODXWKRULW\UDWHVDQG E SHUPLWWKH(DVHPHQW/DQGRUDQ\SDUWRILWWREH DVVHVVPHQWV DQG ODZIXO FKDUJHV LQ UHODWLRQ WR WKH XVHGLQVXFKDZD\DVWRREVWUXFWRULQWHUIHUHZLWK (DVHPHQW/DQG WKH5HOHYDQW:RUNVDQGRUWKHSURSHUDQGHIIHFWLYH )857+(5$6685$1&(6 XVHRIWKH5HOHYDQW:RUNVE\8QLW\ZDWHU 7KHEHQHILWDQGEXUGHQRIWKLV(DVHPHQWVKDOOSDVVZLWK F LQVWDOO FRQFUHWH ELWXPHQ RU RWKHU SDYHPHQW RU DQGELQGWKH(DVHPHQW/DQGVRDVWRHQXUHWRDQGELQGDOO GULYHZD\V H[FHSW UHVLGHQWLDO GULYHZD\V RQ WKH SHUVRQVGHULYLQJWLWOHWKHUHWRIURPDQGXQGHUWKH2ZQHU (DVHPHQW /DQG RU JDUGHQV RU ODQGVFDSLQJ DQG 8QLW\ZDWHU UHVSHFWLYHO\ DQG WKH 2ZQHU ZKHQHYHU LQYROYLQJ FRQFUHWH EULFN RU RWKHU SHUPDQHQW UHTXLUHGE\8QLW\ZDWHURUWKHSHUVRQRUSHUVRQVIRUWKH PDWHULDOVRU WLPHEHLQJHQWLWOHGWRWKHEHQHILWRIWKLV(DVHPHQWPXVW G UHPRYH RU VWRFNSLOH RU SHUPLW WKH UHPRYDO RU GR DOO VXFK WKLQJV DQG JLYH DOO VXFK DVVXUDQFHV DV DUH VWRFNSLOLQJ RI DQ\ VRLO VDQG JUDYHO RU RWKHU UHDVRQDEO\UHTXLUHGIRUWKHSURSHUDQGHIIHFWLYHFDUU\LQJ VXEVWDQFH RU PDWHULDO RQ WKH (DVHPHQW /DQG RU LQWRHIIHFWRIWKHULJKWVFRQIHUUHGXQGHUWKLV(DVHPHQWEXW FRQVWUXFWDQ\URDGVGDPZDOOVRURWKHUHDUWKZRUNV QRWVRDVWRUHQGHUWKH2ZQHUOLDEOHWREHFDOOHGXSRQWR RQ WKH (DVHPHQW /DQG ZKLFK ZRXOG LQ DQ\ ZD\ FRQWULEXWH WRZDUGV WKH PDLQWHQDQFH DQG XSNHHS RI WKH REVWUXFW RU LQWHUIHUH ZLWK WKH 5HOHYDQW :RUNV 5HOHYDQW:RUNV DQGRUWKHSURSHUDQGHIIHFWLYHXVHRIWKH5HOHYDQW 63(&,$/&29(1$176)2567$7(5(6(59( :RUNVE\8QLW\ZDWHU /$1' '$0$*(726758&785(6 D 7KHIROORZLQJFODXVHVDUHLQDGGLWLRQWRRUUHSODFH D 8QLW\ZDWHU DFWLQJ UHDVRQDEO\ DW DOO WLPHV DQG ZKHUHQRWHGWKRVHVHWRXWDERYHDQGZLOOIRUPSDUW FRPSO\LQJ ZLWK DOO UHOHYDQW ODZV ZLOO GHWHUPLQH RIWKHFRYHQDQWVRIWKLV(DVHPHQWZKHQDQ\ODQGLV KRZ DQG LQ ZKDW PDQQHU WKH ULJKWV JUDQWHG WR GHVLJQDWHGDVD³5HVHUYH´LQDFFRUGDQFHZLWKWKH 8QLW\ZDWHUXQGHUWKLV(DVHPHQWDUHH[HUFLVHG Land Act 1994 DVDPHQGHGIURPWLPHWRWLPH E 8QLW\ZDWHU PXVW QRW ZLOIXOO\ GDPDJH RU GHVWUR\ E ,QWKLVFODXVH DQ\0DWWHUWRDQ\H[WHQWJUHDWHUWKDQLVUHDVRQDEO\ ³0LQLVWHU´ PHDQV WKH 0LQLVWHU DGPLQLVWHULQJ WKH QHFHVVDU\LQRUGHUWRH[HUFLVHLWVULJKWVXQGHUWKLV Land Act 1994 DVDPHQGHGIURPWLPHWRWLPH DQG (DVHPHQWEXW 404 QUEENSLAND GOVERNMENT GAZETTE No. 82 [15 November 2019 ³7UXVWHH´PHDQVWKHUHOHYDQW7UXVWHHRIWKH6WDWH FODLPV GHPDQGV FRVWV ORVVHV 5HVHUYHG/DQG GDPDJHV DQG H[SHQVHV ³&ODLPV´ F Reinstatement of fencing DULVLQJRXWRIRULQDQ\ZD\FRQQHFWHG &ODXVHRIWKLV(DVHPHQWLVGHOHWHGDQGUHSODFHG WRRUUHVXOWLQJIURPWKHJUDQWLQJRIWKLV ZLWKWKHIROORZLQJ (DVHPHQW WR 8QLW\ZDWHU RU ZKLFK LV Unitywater must either: FRQQHFWHG WR RU UHVXOWLQJ IURP (a) Reinstate all fences damaged by it in the 8QLW\ZDWHU¶VXVHDQGRFFXSDWLRQRIWKH exercise of any of its rights granted herein; (DVHPHQW /DQG DOO RI ZKLFK DUH and UHIHUUHGWRDV³WKHLQGHPQLILHGDFWVRU (b) In lieu of reinstating any such fence, install a RPLVVLRQV´ VDYHWRWKHH[WHQWWKDWWKH gate the quality and materials of FODLPDULVHVDVDUHVXOWRIDQ\QHJOLJHQW workmanship of which must be not less than DFW RU RPLVVLRQ RI WKH LQGHPQLILHG the quality and materials of workmanship of SDUWLHVKRZHYHUDQ\QHJOLJHQWDFWRU the existing fence. RPLVVLRQ RU RQH RI WKH LQGHPQLILHG G Removal of Unauthorised structures etc SDUWLHVGRHVQRWQHJDWHWKHLQGHPQLW\ &ODXVHRIWKLV(DVHPHQWLVRPLWWHGDQGUHSODFHG WRDQ\RWKHULQGHPQLILHGSDUWLHV ZLWKWKHIROORZLQJ E 8QLW\ZDWHU KHUHE\ UHOHDVHV DQG If anything is erected, placed, found or installed GLVFKDUJHV WKH LQGHPQLILHG SDUWLHV upon the Easement Land in contravention of IURP DQ\ &ODLP UHODWLQJ WR WKH Clause 5, Unitywater may, in addition to any other LQGHPQLILHG DFWV RU RPLVVLRQV ZKLFK remedies, and having given the Owner reasonable PD\EHPDGHDJDLQVWWKHLQGHPQLILHG notice of its intention to invoke this clause, enter SDUWLHV VDYH WR WKH H[WHQW WKDW WKH Easement Land and remove or demolish the &ODLP DULVHV DV D UHVXOW RI DQ\ Matter. If it does so it may dispose of the Matter or QHJOLJHQW DFW RU RPLVVLRQ RI WKH any resultant demolition materials in such manner LQGHPQLILHG SDUWLHV KRZHYHU DQ\ as it sees fit without being liable. QHJOLJHQWDFWRURPLVVLRQRIRQHRIWKH H Removal of Trees LQGHPQLILHGSDUWLHVGRHVQRWQHJDWHWKH 8QLW\ZDWHUPXVWQRWFXWRUUHPRYHWLPEHURUWUHVV UHOHDVHDQGGLVFKDUJHLQIDYRXURIDQ\ IURP WKH (DVHPHQW /DQG ZLWKRXW ILUVW JLYLQJ RIWKHRWKHULQGHPQLILHGSDUWLHV UHDVRQDEOHQRWLFHWRWKH2ZQHUDQGREWDLQLQJDOO LL Public Risk QHFHVVDU\SHUPLWV6XFKQRWLFHZLOOQRWEHUHTXLUHG D 8QLW\ZDWHU PXVW HIIHFW D SXEOLF XQGHUWKLVFODXVHLQWKHHYHQWWKDWWKHUHLVDQDFWXDO OLDELOLW\ LQVXUDQFH SROLF\ ZLWK DQ RUSRWHQWLDOGDQJHUWRSHUVRQVRUSURSHUW\RUWKHUH LQVXUHUDXWKRULVHGXQGHUWKHInsurance LVDQ\LQWHUIHUHQFHRUMHRSDUG\WRWKHVXSSO\RIWKH Act 1973 &RPPRQZHDOWK RULQDQ\ 5HOHYDQW:RUNV RWKHU FDVH WR WKH VDWLVIDFWLRQ RI WKH I Removal of Assets upon termination of easement 0LQLVWHU QDPLQJ 8QLW\ZDWHU DV WKH 8QGHU WKH Land Act 1994, DQ HDVHPHQW RYHU D LQVXUHGFRYHULQJOHJDOOLDELOLW\IRUDQ\ UHVHUYH HQGV ZKHQ WKH GHGLFDWLRQ RI UHVHUYH LV ORVVRIRUGDPDJHWRDQ\SURSHUW\DQG UHYRNHGXQOHVVDZULWWHQDSSURYDOLVSURYLGHGE\ IRUWKHLQMXU\ LQFOXGLQJGHDWK WRDQ\ WKH0LQLVWHUWKDWWKHHDVHPHQWPD\FRQWLQXHRYHU SHUVRQDULVLQJRXWRIDQ\WKLQJGRQHRU XQDOORFDWHG 6WDWH /DQG ZKHQ WKH GHGLFDWLRQ RI RPLWWHGRQRUDERXWWKHHDVHPHQWODQG UHVHUYHLVUHYRNHG RU DQ\ LPSURYHPHQWV WKHUHRQ DQG 8SRQWHUPLQDWLRQRIWKH(DVHPHQW8QLW\ZDWHU DJDLQVW DOO FODLPV GHPDQGV L PXVWHQVXUHWKDWWKH(DVHPHQW/DQGLVOHIWLQ SURFHHGLQJV FRVWV FKDUJHV DQG DVDIHDQGVWDEOHFRQGLWLRQWRWKHVDWLVIDFWLRQ H[SHQVHVZKDWVRHYHULQUHVSHFWWKHUHRI RIWKH0LQLVWHUDQG VXEMHFWWRWKHWHUPVDQGFRQGLWLRQVRI LL ZLOO XQOHVV GLUHFWHG E\ WKH 0LQLVWHU WKHLQVXUDQFHSROLF\ RWKHUZLVH DW LWV RZQ FRVW DQG H[SHQVH E 6XFKSROLF\PXVW UHPRYHDOORIWKH5HOHYDQW:RUNVIURPWKH D EH IRU DQ DPRXQW QRW OHVV WKDQ (DVHPHQW/DQGDQG 7ZHQW\ LLL ZLOOUHPRYHDWLWVRZQFRVWDQGH[SHQVHDOO 0LOOLRQGROODUV LQUHVSHFWRIDOO RI WKH 5HOHYDQW :RUNV IURP WKH (DVHPHQW FODLPV DULVLQJ RXW RI D VLQJOH /DQG WKDW PD\ FDXVH FRQWDPLQDWLRQ RU HYHQWRUVXFKKLJKHUDPRXQWVDV HQYLURQPHQWDOKDUPWRWKH(DVHPHQW/DQGDV WKH 0LQLVWHU PD\ UHDVRQDEO\ GHILQHGE\WKHEnvironmental Protection Act UHTXLUHDQG 1994RUVLPLODUOHJLVODWLRQ E EH HIIHFWHG RQ D ³FODLPV J Indemnity and Risk RFFXUULQJ´ EDVLV VR WKDW DQ\ 7KHIROORZLQJFODXVHVZLOODSSO\IRUWKHGXUDWLRQRI FODLPPDGHE\8QLW\ZDWHUXQGHU WKH(DVHPHQWDQGZLOOFRQWLQXHWRDSSO\GXULQJWKH WKHSROLF\DIWHUH[SLUDWLRQRIWKH SHULRGV RI UHKDELOLWDWLRQ DQG DQ\ UHPRYDO RI WKH SHULRG RI SROLF\ FRYHU EXW 5HOHYDQW:RUNVXQGHUFODXVH I UHODWLQJ WR DQ HYHQW RFFXUULQJ GXULQJWKHFXUUHQF\RIWKHSROLF\ ZLOO EH FRYHUHG E\ WKH SROLF\ L Indemnity VXEMHFWWRWKHFODLPPHHWLQJWKH SROLF\¶V RWKHU WHUPV DQG D 8QLW\ZDWHULQGHPQLILHVDQGDJUHHVWR FRQGLWLRQVDQG NHHS LQGHPQLILHG WKH 0LQLVWHU WKH F EHPDLQWDLQHGDWDOOWLPHVGXULQJ 6WDWH RI 4XHHQVODQG 7UXVWHH DQG WKH FXUUHQF\ RI WKH (DVHPHQW 2ZQHU WKH ³LQGHPQLILHG SDUWLHV´ DQGXSRQUHFHLSWRIDQ\1RWLFH DJDLQVWDOODFWLRQVVXLWVSURFHHGLQJV RI &DQFHOODWLRQ 8QLW\ZDWHU 15 November 2019] QUEENSLAND GOVERNMENT GAZETTE No. 82 405 PXVWLPPHGLDWHO\HIIHFWDQRWKHU SXEOLFOLDELOLW\LQVXUDQFHSROLF\ LQ DFFRUGDQFH ZLWK WKH SURYLVLRQV RI WKLV &ODXVH J LL F 8QLW\ZDWHU PXVW DOVR SURYLGH D FHUWLILFDWHRIFXUUHQF\ZLWKLQGD\V RI D UHTXHVW E\ WKH 2ZQHU ZKR PD\ RQO\PDNHVXFKUHTXHVWRQFHD\HDU G 8QLW\ZDWHU PXVW DV VRRQ DV SUDFWLFDEOH LQIRUP WKH 0LQLVWHU DQG 2ZQHULQZULWLQJRIWKHRFFXUUHQFHRI DQ\HYHQWWKDW8QLW\ZDWHUFRQVLGHUVLV OLNHO\WRJLYHULVHWRDFODLPXQGHUWKH SROLF\RILQVXUDQFHHIIHFWHGDQGPXVW HQVXUHWKDWWKH0LQWHUDQG2ZQHUDUH NHSW IXOO\ LQIRUPHG RI VXEVHTXHQW DFWLRQV DQG GHYHORSPHQWV FRQFHUQLQJ WKHFODLP K Power of Attorney :KLOVW WKH (DVHPHQW /DQG UHPDLQV XQDOORFDWHG 6WDWH/DQGRULVGHGLFDWHGDVD5HVHUYHSXUVXDQWWR WKHLand Act 1994DVDPHQGHGIURPWLPHWRWLPHRU LV UHJLVWHUHG VROHO\ LQ WKH QDPH RI WKH 6WDWH RI 4XHHQVODQG8QLW\ZDWHULUUHYRFDEO\DSSRLQWVLQVR IDUDVLWLVOHJDOO\DEOHWRWKH6WDWHRI4XHHQVODQG WKHWUXHDQGODZIXODWWRUQH\RI8QLW\ZDWHUHQDEOLQJ WKH DWWRUQH\ WR GR DOO VXFK WKLQJV DV WKH DWWRUQH\ PD\ FRQVLGHU QHFHVVDU\ RU GHVLUDEOH WR HIIHFW D VXUUHQGHU RI WKLV HDVHPHQW XSRQ WKH GHIDXOW E\ 8QLW\ZDWHURIDQ\FRQGLWLRQFRYHQDQWRUFODXVHRI WKLVHDVHPHQWSURYLGHGKRZHYHUWKDWWKH6WDWHRI 4XHHQVODQGPD\RQO\H[HUFLVHLWVULJKWWRVXUUHQGHU WKHHDVHPHQWXQGHUWKLVFODXVHLI L 8QLW\ZDWHU KDV EUHDFKHG D FRQGLWLRQ FRYHQDQWRUFODXVHRIWKLVHDVHPHQWDQG LL WKH 6WDWH RI 4XHHQVODQG KDV JLYHQ ZULWWHQ QRWLFHWRWKHEUHDFKRI8QLW\ZDWHUDQG LLL WKH 6WDWH RI 4XHHQVODQG KDV DOORZHG 8QLW\ZDWHUGD\VIURPWKHGDWHRIUHFHLSW RIWKHQRWLFHWRUHPHG\WKHEUHDFKDQG LY 8QLW\ZDWHUKDVQRWUHPHGLHGWKHEUHDFKE\ WKHH[SLUDWLRQRIWKDWGD\V 6&+('8/( (DVHPHQW7DNHQ (DVHPHQW $ LQ /RW RQ 63 RQ 63 WR EH UHJLVWHUHG LQ WKH /DQG 5HJLVWU\ DUHD P SDUW RI 7LWOH 5HIHUHQFH 406 QUEENSLAND GOVERNMENT GAZETTE No. 82 [15 November 2019 Education (General Provisions) Act 2006 STATE SCHOOL ENROLMENT MANAGEMENT PLAN (State school EMP) This Gazettal Notice supersedes all previous gazettal notices for the State schools listed below. In accordance with Chapter 8, Part 3, Section 170, of the Education (General Provisions) Act 2006, a State school EMP for the State schools listed below has been prepared by a delegate of the Chief Executive of the Department of Education. Region: North Coast School: North Lakes State College Copies of the State school EMPs are available for public inspection, without charge, during normal business hours at the department’s head office and accessible on the department’s website at https://education.qld.gov.au/parents-and-carers/ enrolment/management-plans/ Christmas DQG New Year Dates DQG Closing Times for 201-20 Final 201 Gazette ² Published )ULGD\'HFHPEHU 201 Deadlines9DFDQF\$SSRLQWPHQWV 7REHVXEPLWWHGE\QRRQRQ7XHVGD\'HFHPEHU 'HDGOLQHV2WKHU*D]HWWHQRWLFHV 7REHVXEPLWWHGE\QRRQRQ:HGQHVGD\'HFHPEHU )LQDO$SSURYDOVE\FORVHRIEXVLQHVV:HGQHVGD\'HFHPEHU First 20 Gazette Published FridayJanuary 20 Deadlines9DFDQF\$SSRLQWPHQWV 7REHVXEPLWWHGE\QRRQRQ7XHVGD\'HFHPEHU 'HDGOLQHV2WKHU*D]HWWHQRWLFHV 7REHVXEPLWWHGE\QRRQRQ7XHVGD\'HFHPEHU )LQDO$SSURYDOVE\FORVHRIEXVLQHVV7XHVGD\'HFHPEHU ,I\RXKDYHTXHULHVUHJDUGLQJWKLVPDWWHUSOHDVHGRQRWKHVLWDWH WRFRQWDFWWKH*D]HWWH7HDP[email protected] 15 November 2019] QUEENSLAND GOVERNMENT GAZETTE No. 82 407 Education Queensland Brisbane, 7 November 2019 Holidays Act 1983 NOTIFICATION I, the Honourable Grace Grace MP, Minister for Education and Minister for Industrial Relations in pursuance of the provisions of the Holidays Act 1983, hereby appoint the day specified in Column 1 of the Schedule, hereto as a public holiday within the District set opposite that day in Column 2 of the schedule, being a holiday in respect of the annual agricultural, horticultural or industrial show set opposite that day in Column 3 of the schedule. Column 1 Column 2 Column 3 Date of Holiday District Name of Show 2020 31 January 2020 Southern Downs Region – the area of the former Stanthorpe Shire and the Stanthorpe Annual Show area of the village of Dalveen 7 February 2020 Southern Downs Region – the area of the former Warwick Shire – Division 1 Allora Annual Show 21 February 2020 Southern Downs Region – the area of the former Warwick Shire – Division 3 Killarney Annual Show (excluding the urban area of Warwick City and the locality of Murray's Bridge) 13 March 2020 Goondiwindi Region – that area covered by the former Shire of Inglewood Inglewood Annual Show excluding that part of the former shire within the boundaries of the parishes of Wyemo, Beebo, Texas, Silverspur, Arcot, Gunyan, Bonshaw, Maiden Head, Aitkin’s Flat and the town of Texas 20 March 2020 Southern Downs Region – the area of the former Warwick Shire – Divisions 2, Warwick Annual Show 5 and 6, Division 3 (being the urban area of Warwick City and the locality of Murray’s Bridge), Division 4 (excluding the village of Dalveen) 26 March 2020 Toowoomba Region – Toowoomba Regional Council area excluding the Toowoomba Yarraman, Upper Yarraman and Cooyar areas Royal Agricultural Show 3 April 2020 Western Downs Region – Wandoan and District Wandoan Show Festival 17 April 2020 Western Downs Region – Dalby and District Dalby and District Annual Show 1 May 2020 Goondiwindi Region – for that area covered by the former Goondiwindi Town Goondiwindi Annual Show Council and the former Waggamba Shire 5 May 2020 Shire of Banana – that part of the shire formerly known as Division 1 of Taroom Annual Show Taroom Shire (includes township of Taroom) 8 May 2020 Maranoa Region – from the eastern boundary of the Council area including Roma Agricultural Show the towns of Jackson, Yuleba, Wallumbilla, Roma, Hodgson and Muckadilla. North of Roma to the northern boundary of the Council area including the town of Injune and the area known as Bymount and south of Roma to the southern boundary of the Council area including the township of Surat and the area East and South of Surat Township 8 May 2020 North Burnett Region – Mundubbera Area Mundubbera Annual Show 12 May 2020 Maranoa Region – west of Amby to the western boundary of the Council area Mitchell Agricultural Show including the towns of Mitchell and Mungallala. South of Amby to the southern boundary of the Council area including the area known as Dunkeld and north of Amby to the northern boundary of the Council area 15 May 2020 City of Ipswich Ipswich Annual Show 15 May 2020 Gympie Region excluding Goomeri Township, Parish of Goomeribong Gympie Annual Show 15 May 2020 Shire of Banana – that part of the shire covering the parishes of Annandale, Callide Valley Agricultural and Craiglands, Dumgree, Earlsfield, Greycliffe, Spier, Thalberg, Callide, Prairie, Pastoral Show Coreen, Kooingal, Scoria, Kroombit, Clifford, Kariboe, Grevillea, Prospect, Tiamby, Moura and Kianga (includes townships/areas of Biloela, Jambin, Goovigen, Thangool, Banana, Moura, Prospect Creek, Mount Murchison) 15 May 2020 Shire of Murweh Charleville and District Annual Show 19 May 2020 Western Downs Region – Miles and District Miles and District Show 20 May 2020 Barcaldine Region – Alpha township Alpha Annual Show 22 May 2020 Central Highlands Region – Capella and Tieri Capella and District Agricultural Show 22 May 2020 Fraser Coast Region Fraser Coast Agriculture Show 22 May 2020 Shire of Paroo Cunnamulla Show 22 May 2020 Western Downs Region – Chinchilla and District Chinchilla Annual Show 27 May 2020 Isaac Region – Moranbah, Clermont, Middlemount, Dysart, Kilcummin and Clermont Show Day rural areas 28 May 2020 Bundaberg Region – within the post codes of 4660 and 4670 Bundaberg Annual Show 29 May 2020 Central Highlands Region – Townships of Springsure and RollestonSpringsure and District Agricultural Show 29 May 2020 Shire of Flinders – Hughenden, Stamford, Prairie and Torrens Creek Hughenden Show 29 May 2020 Sunshine Coast Region – the area of the former Caloundra City Council Maleny Annual Show 408 QUEENSLAND GOVERNMENT GAZETTE No. 82 [15 November 2019 Column 1 Column 2 Column 3 Date of Holiday District Name of Show 2020 3 June 2020 Central Highlands Region – Townships of Emerald, Comet, Gemfields, Emerald and District Blackwater, Bluff, Dingo, Duaringa Agricultural Show 5 June 2020 Shire of Carpentaria Normanton Show Day 8 June 2020 Weipa Town Area Weipa Fishing Classic 11 June 2020 Isaac Region – St Lawrence, South of Clairview and rural areas Rockhampton Agricultural Show 11 June 2020 Rockhampton Region Rockhampton Agricultural Show 12 June 2020 Shire of Banana – that part of the shire covering the parishes of Thuriba, Olinda, Rockhampton Agricultural Show Rannes, Benleith, Granville, Woolein, Fairview, Cottenham, Wright, Perch, Neimen and the parish of Banana excluding L110/FN261, L109/FN261, L48/FN283, L53/FN423, L1&2/RP892597, L1/RP612740, L1-6/RP613366, L2/RP612740, L127/FN470, and Pt L13/FN469 (includes township of Baralaba) 12 June 2020 Shire of Banana – that part of the shire covering the parishes of Westwood, Rockhampton Agricultural Show Fleetwood, Moongan, Dundee, Bunerba, Ulogie, Manton, Don and Bundalba (includes townships of Wowan and Dululu) 12 June 2020 Shire of Cloncurry Cloncurry and District Annual Show 12 June 2020 Shire of Livingstone Rockhampton Agricultural Show 12 June 2020 Shire of Richmond Richmond Annual Field Day 12 June 2020 Shire of Woorabinda Rockhampton Agricultural Show 12 June 2020 Sunshine Coast Region – the area of the former Maroochy Shire Sunshine Coast (Nambour) Show 18 June 2020 Isaac Region – Nebo, Glenden, Coppabella, Coastal Region, Clairview and Mackay Agricultural Show Clairview North 18 June 2020 Mackay Region Mackay Agricultural Show 19 June 2020 City of Mount Isa Mount Isa Agricultural Show 19 June 2020 Shire of Mornington Mount Isa Agricultural Show 19 June 2020 Whitsunday Region – Proserpine, Airlie Beach, Cannonvale Whitsunday Show (the area formerly known as Shire of Whitsunday) 23 June 2020 Whitsunday Region – Bowen (the area formerly known as Divisions 1 and 2 of Bowen Annual Show the Shire of Bowen and that part of Division 3 north of the Bogie River from its confluence with the Burdekin River to its source and then easterly by the Clark Range to the eastern boundary of the Shire) 24 June 2020 Shire of Burdekin Burdekin Annual Show 10 July 2020 Cassowary Coast Region – Divisions 4, 5 and 6 and those parts of Divisions 2 Innisfail and District Annual and 3 generally north of the Walter Hill Range Show 17 July 2020 Cairns Region Cairns Annual Show 17 July 2020 Mareeba Shire excluding the Parishes of Irvinebank, Myosotis, Western, Cairns Annual Show Mowbray, Salisbury, Riflemead and that part of the Parish of Garioch located north of Hunter and Rifle Creeks 17 July 2020 Shire of Aurukun Cairns Annual Show 17 July 2020 Shire of Cook Cairns Annual Show 17 July 2020 Shire of Hope Vale Cairns Annual Show 17 July 2020 Shire of Kowanyama Cairns Annual Show 17 July 2020 Shire of Mapoon Cairns Annual Show 17 July 2020 Shire of Napranum Cairns Annual Show 17 July 2020 Shire of Wujal Wujal Cairns Annual Show 17 July 2020 Shire of Yarrabah Cairns Annual Show 20 July 2020 Mareeba Shire – That part of Mareeba Shire included within the Parishes of Mossman Annual Show Mowbray, Salisbury, Riflemead and that part of the Parish of Garioch located north of Hunter and Rifle Creeks 20 July 2020 Shire of Douglas Mossman Annual Show 24 July 2020 Cassowary Coast Region – Division 1 and those parts of Divisions 2 and 3 Tully and District Annual Show generally south of the Walter Hill Range 28 July 2020 Charters Towers Region Charters Towers Annual Show 10 August 2020 Bundaberg Region – within the postcode of 4671 Royal Queensland Show 10 August 2020 City of Redland Royal Queensland Show 10 August 2020 Gladstone Region Royal Queensland Show 10 August 2020 Goondiwindi Region – for that area covered by the former Shire of Inglewood Royal Queensland Show within the boundaries of the parishes of Wyemo, Beebo, Texas, Silverspur, Arcot, Gunyan, Bonshaw, Maiden Head, Aitkin's Flat and the town of Texas 10 August 2020 Gympie Region – Goomeri Township, Parish of Goomeribong Royal Queensland Show 15 November 2019] QUEENSLAND GOVERNMENT GAZETTE No. 82 409 Column 1 Column 2 Column 3 Date of Holiday District Name of Show 2020 10 August 2020 Lockyer Valley Region Royal Queensland Show 10 August 2020 Logan City Royal Queensland Show 10 August 2020 Moreton Bay Region Royal Queensland Show 10 August 2020 North Burnett Region – Biggenden, Eidsvold, Gayndah, Mount Perry and Royal Queensland Show Monto Areas 10 August 2020 Scenic Rim Region Royal Queensland Show 10 August 2020 Shire of Balonne Royal Queensland Show 10 August 2020 Shire of Cherbourg Royal Queensland Show 10 August 2020 Somerset Region Royal Queensland Show 10 August 2020 South Burnett Region Royal Queensland Show 10 August 2020 Toowoomba Region – that part of the Toowoomba Regional Council area Royal Queensland Show covered by Yarraman, Upper Yarraman and Cooyar 10 August 2020 Western Downs Region – Tara and District Royal Queensland Show 12 August 2020 City of Brisbane Royal Queensland Show 21 August 2020 Northern Peninsula Area Region Northern Peninsula Area Show 28 August 2020 City of Gold Coast Gold Coast Annual Show 9 September 2020 Barcaldine Region – Aramac, Baraldine and Jericho townships Westech Field Day 9 September 2020 Longreach Region Westech Field Day 11 September 2020 Shire of Noosa Noosa Show 18 September 2020 Shire of Pormpuraaw Pormpuraaw Show Day 18 September 2020 Shire of Torres Torres Strait Cultural Festival Show Day 18 September 2020 Torres Strait Island Region (whole region) Torres Strait Multi-Cultural Festival Show Day 3 November 2020 Whitsunday Region – Collinsville (that area formerly known as that part of Collinsville Annual Show Division 3 of the Shire of Bowen south of the Bogie River from its confluence with the Burdekin River to its source and then easterly by the Clark Range to the eastern boundary of the Shire) GRACE GRACE MP Minister for Education Minister for Industrial Relations Education Queensland Brisbane, 7 November 2019 Holidays Act 1983 NOTIFICATION I, the Honourable Grace Grace MP, Minister for Education and Minister for Industrial Relations in pursuance of the provisions of the Holidays Act 1983, hereby appoint the day specified in Column 1 of the Schedule, hereto as a special holiday within the District set opposite that day in Column 2 of the schedule, being a special holiday in respect of the event set opposite that day in Column 3 of the schedule. Note 1: The following holidays are special holidays pursuant to Section 4 of the Holidays Act 1983 and are bank holidays not public holidays. Note 2: Pursuant to a directive issued under the Public Service Act 2008, they are holidays for public service employees unless otherwise determined by a chief executive. Column 1 Column 2 Column 3 Date of Holiday District Event 2020 28 January 2020 Torres Strait Island Region – St Pauls St Pauls Anglican Church Day 3 February 2020 Torres Strait Island Region – Badu Deed of Grant in Trust Hand Over Day 3 February 2020 Torres Strait Island Region – Mabuiag St. Mary's Church Day 12 February 2020 Torres Strait Island Region – Kubin and St Pauls Mualgal Native Title Determination Day 13 February 2020 Torres Strait Island Region – Saibai Saibai Native Title Determination Day 24 February 2020 Shire of Lockhart River Foundation Day 28 February 2020 Torres Strait Island Region – Boigu United Pentecostal Church Day (Church of Rock) 16 March 2020 Torres Strait Island Region (whole region) Torres Strait Amalgamation Day 9 April 2020 Shire of Croydon Normanton Barra Classic 410 QUEENSLAND GOVERNMENT GAZETTE No. 82 [15 November 2019 Column 1 Column 2 Column 3 Date of Holiday District Event 2020 20 April 2020 Torres Strait Island Region – St Pauls Kozan Outreach Church Day 27 April 2020 Torres Strait Island Region – Badu St. Marks Church Day 4 May 2020 Torres Strait Island Region – Hammond Patron Saint Joseph Day 19 May 2020 Torres Strait Island Region – St Pauls Florence Buchanan Day (Coming of the Light) 21 May 2020 Torres Strait Island Region – Dauan Ascension Day (Church Day of Parish of Ascension) 22 May 2020 Shire of Bulloo Shindig Festival 24 May 2020 Shire of Pormpuraaw National Sorry Day 26 May 2020 Shire of Cherbourg National Sorry Day 29 May 2020 Shire of Palm Island Strike 57 Commemoration Day 29 May 2020 Shire of Torres Torres Strait Flag Day 29 May 2020 Torres Strait Island Region (whole region) Torres Strait Flag Day 1 June 2020 Torres Strait Island Region (whole region) Community Services (Torres Strait) Act Day 3 June 2020 Northern Peninsula Area Region Mabo Day 3 June 2020 Shire of Doomadgee Mabo Day 3 June 2020 Shire of Torres Mabo Day 3 June 2020 Torres Strait Island Region (whole region) Mabo Day 5 June 2020 Shire of Palm Island Bwgcolman Day 8 June 2020 Torres Strait Island Region – Saibai Holy Trinity Church Day 15 June 2020 Torres Strait Island Region – Mer Dauar Waier Observance Festival 17 June 2020 Shire of Yarrabah Yarrabah Foundation Day 19 June 2020 Torres Strait Island Region – Boigu St Saviour Church Day – Torres Strait Church 19 June 2020 Torres Strait Island Region – Iama St John Divine Church Day 19 June 2020 Torres Strait Island Region – Poruma Halfway Island Native Title Determination Day 29 June 2020 Torres Strait Island Region – Kubin St Peter’s Church Day 29 June 2020 Torres Strait Island Region – Mabuaig Wagadagam Tribal Chief Initiation Day 29 June 2020 Torres Strait Island Region – Warraber Church Day 1 July 2020 Shire of Torres Coming of the Light Day 1 July 2020 Torres Strait Island Region (whole region) Coming of the Light 2 July 2020 Torres Strait Island Region – Erub and Ugar Coming of the Light Celebrations (Service and Re-enactment at Dabad) 2 July 2020 Torres Strait Island Region – Mer Coming of the Light Celebrations 4 July 2020 Shire of Mapoon NAIDOC Day 6 July 2020 Torres Strait Island Region – Mabuiag Native Title Determination Day 7 July 2020 Torres Strait Island Region – Masig Island Native Title Determination – Aureed Island Claim Day 7 July 2020 Torres Strait Island Region – Poruma Native Title Determination 8 July 2020 Torres Strait Island Region – Boigu Coming of the Light 8 July 2020 Torres Strait Island Region – Dauan Coming of the Light and Native Title Determination Day 10 July 2020 Northern Peninsula Area Region NPA Culture Festival 10 July 2020 Shire of Cherbourg NAIDOC Day 10 July 2020 Shire of Palm Island NAIDOC Day 10 July 2020 Shire of Yarrabah NAIDOC Day 10 July 2020 Torres Strait Island Region – Warraber Coming of the Light 20 July 2020 Shire of Boulia Boulia Camel Races 20 July 2020 Torres Strait Island Region – Poruma and Warraber Indigenous Protected Area Celebration 24 July 2020 Shire of Pormpuraaw Pormpuraaw Fishing Competition 27 July 2020 Shire of Lockhart River St. James' Day 27 July 2020 Torres Strait Island Region – Mer St. James Anglican Church Day 3 August 2020 Shire of Kowanyama Kowanyama Annual Rodeo 15 November 2019] QUEENSLAND GOVERNMENT GAZETTE No. 82 411 Column 1 Column 2 Column 3 Date of Holiday District Event 2020 3 August 2020 Torres Strait Island Region – Mabuiag St Mary's Church Dedication Day 3 August 2020 Torres Strait Island Region – Saibai Annexure Day 4 August 2020 Shire of Aurukun Aurukun Day 6 August 2020 Torres Strait Island Region – Erub and Ugar The Ark of Transfiguration (Ugar Church Day) 7 August 2020 Shire of Etheridge Etheridge Show 7 August 2020 Shire of Mornington Mount Isa Rodeo Day 7 August 2020 Torres Strait Island Region – Boigu August Festival 17 August 2020 Shire of Kowanyama Kowanyama DOGIT Day 17 August 2020 Torres Strait Island Region – Mer Yam Festival 24 August 2020 Torres Strait Island Region (whole region) First Councillors Conference – Masig 26 August 2020 Torres Strait Island Region – Warraber Native Title Determination 28 August 2020 Shire of Doomadgee Doomadgee Day 3 September 2020 Torres Strait Island Region – Mabuiag Coming of the Light to Mabuiag 4 September 2020 Shire of Palm Island Spring Festival Day 14 September 2020 Torres Strait Island Region – Iama Turan Tabernacle Church Day Iama UPC 15 September 2020 Torres Strait Island Region – Hammond Hammond Island Church Opening Day 16 September 2020 Torres Strait Island Region – Dauan Church of the Holy Cross Day 23 September 2020 Torres Strait Island Region – Boigu Blood Covenant Church Dedication Day 25 September 2020 Shire of Mapoon Mapoon Day 25 September 2020 Torres Strait Island Region – Erub Annual Daisy Mye Sports Carnival 16 October 2020 Shire of Cherbourg Cherbourg Day 26 October 2020 Shire of Wujal Wujal Wujal Wujal Foundation Day 26 October 2020 Shire of Yarrabah DOGIT Day 28 October 2020 Shire of Napranum Napranum DOGIT Day 29 October 2020 Shire Of Lockhart River DOGIT Day 30 October 2020 Northern Peninsula Area Region NPA Sporting Carnival 30 October 2020 Torres Strait Island Region – Badu Coming of the Light to Badu 2 November 2020 Torres Strait Island Region – Erub and Ugar All Saints Church Day 3 November 2020 Barcaldine Region – Muttaburra township Melbourne Cup Day 3 November 2020 Blackall-Tambo Region Melbourne Cup Day 3 November 2020 Shire of Burke Melbourne Cup Day 3 November 2020 Shire of Murweh Central Warrego Race Club Inc. Annual Melbourne Cup Race Meeting (Afternoon Only) 3 November 2020 Shire of Quilpie Melbourne Cup Day 3 November 2020 Shire of Richmond Richmond Melbourne Cup Races (Afternoon Only) 3 November 2020 Shire of Winton Melbourne Cup Day 24 November 2020 Shire of Mornington Mornington Island Memorial Day 30 November 2020 Torres Strait Island Region – Poruma St Andrews Church Day 4 December 2020 Torres Strait Island Region – Saibai Church Dedication Day 7 December 2020 Torres Strait Island Region – Poruma and Warraber Aureed Island Native Title Determination Day 8 December 2020 Torres Strait Island Region – Erub Native Title Determination Day 9 December 2020 Torres Strait Island Region – Ugar Native Title Determination Day 10 December 2020 Torres Strait Island Region – Boigu Native Title Determination Day 14 December 2020 Torres Strait Island Region – Badu Native Title Determination Day 14 December 2020 Torres Strait Island Region – Iama Native Title Determination Day GRACE GRACE MP Minister for Education Minister for Industrial Relations 412 QUEENSLAND GOVERNMENT GAZETTE No. 82 [15 November 2019 Police Service Administration Act 1990 Local Government Regulation 2012 CESSATION OF A POLICE ESTABLISHMENT AUCTION NOTICE I, Acting Deputy Commissioner B J Codd of the Queensland This is an Auction Notice under section 142 of the Local Police Service, pursuant to s. 10.10 of the Police Service Government Regulation 2012 (‘the Regulation’). Administration Act 1990, and the powers delegated to me, hereby declare the following – On 26 June 2019, Mackay Regional Council issued a Notice of Intention to Sell pursuant to section 140 of the Regulation to • The cessation of Corrective Services Investigation Unit, Level 4, sell the land described below by way of auction. Gabba Towers, 411 Vulture Street Woolloongabba, 4102 may apply as a police station as from 14 November 2019. You are hereby notified that Mackay Regional Council intends to proceed with the auction for the sale of land described in below This declaration is made at Brisbane in the State of Queensland under sections 141 to 143 of the Regulations unless all overdue on the 11th day of November 2019. rates, interest and other amounts are paid immediately. B J CODD Full description of land to be sold by auction: Acting Deputy Commissioner Address: 44/3 Kirribilli Avenue, EAST MACKAY QLD 4740 Police Service Administration Act 1990 Description Title Reference Area Lot 44 SP 274077 50981790 81 m² DECLARATION OF A POLICE ESTABLISHMENT Auction time and place: I, Acting Deputy Commissioner B J Codd of the Queensland Time: 12 noon on Friday, 6th December 2019 Police Service, pursuant to s. 10.10 of the Police Service Administration Act 1990 Place: Jubilee Community Centre, , and the powers delegated to me, 71 Gordon Street, Mackay QLD 4740 hereby declare the following – DATED this 8th day of November 2019 • Corrective Services Investigation Unit, Level 3, 69 Ann Street Brisbane, 4000 may apply as a police establishment as Council Reference: 58862_4 from 14 November 2019. CLH Lawyers Reference: 3273699 The declaration is made at Brisbane in the State of Queensland Local Government Regulation 2012 on the11 day of November 2019. B J CODD AUCTION NOTICE Acting Deputy Commissioner This is an Auction Notice under section 142 of the Local Government Regulation 2012 Local Government Regulation 2012 (‘the Regulation’). On 26 June 2019, Mackay Regional Council issued a Notice of AUCTION NOTICE Intention to Sell pursuant to section 140 of the Regulation to sell the land described below by way of auction. This is an Auction Notice under section 142 of the Local Government Regulation 2012 (‘the Regulation’). You are hereby notified that Mackay Regional Council intends to proceed with the auction for the sale of land described in below On 26 June 2019, Mackay Regional Council issued a Notice of under sections 141 to 143 of the Regulations unless all overdue Intention to Sell pursuant to section 140 of the Regulation to rates, interest and other amounts are paid immediately. sell the land described below by way of auction. You are hereby notified that Mackay Regional Council intends to Full description of land to be sold by auction: proceed with the auction for the sale of land described in below Address: 4 John Temple Drive, ETON QLD 4741 under sections 141 to 143 of the Regulations unless all overdue Description Title Reference Area rates, interest and other amounts are paid immediately. Lot 2 RP 734626 21145120 2.151 Ha Full description of land to be sold by auction: Auction time and place: Address: 43 Beaconsfield Road, BEACONSFIELD QLD 4740 Time: 12 noon on Friday, 6th December 2019 Description Title Reference Area Place: Jubilee Community Centre, Lot 12 RP 722265 20738127 620 m² 71 Gordon Street, Mackay QLD 4740 Auction time and place: DATED this 8th day of November 2019 Time: 12 noon on Friday, 6th December 2019 Council Reference: 42787_2 Place: Jubilee Community Centre, CLH Lawyers Reference: 3273675 71 Gordon Street, Mackay QLD 4740 DATED this 8th day of November 2019 Council Reference: 3491_8 CLH Lawyers Reference: 3273621 15 November 2019] QUEENSLAND GOVERNMENT GAZETTE No. 82 413 Local Government Regulation 2012 Local Government Regulation 2012 AUCTION NOTICE AUCTION NOTICE Local This is an Auction Notice under section 142 of the Local This is an Auction Notice under section 142 of the Government Regulation 2012 Government Regulation 2012 (‘the Regulation’). (‘the Regulation’). On 26 June 2019, Mackay Regional Council issued a Notice of On 26 June 2019, Mackay Regional Council issued a Notice of Intention to Sell pursuant to section 140 of the Regulation to Intention to Sell pursuant to section 140 of the Regulation to sell the land described below by way of auction. sell the land described below by way of auction. You are hereby notified that Mackay Regional Council intends to You are hereby notified that Mackay Regional Council intends to proceed with the auction for the sale of land described in below proceed with the auction for the sale of land described in below under sections 141 to 143 of the Regulations unless all overdue under sections 141 to 143 of the Regulations unless all overdue rates, interest and other amounts are paid immediately. rates, interest and other amounts are paid immediately. Full description of land to be sold by auction: Full description of land to be sold by auction: Address: 25/61 Kunapipi Road, LAGUNA QUAYS QLD 4800 Address: 1/2 Griffin Avenue, BUCASIA QLD 4750 Description Title Reference Area Description Title Reference Area Lot 25 GTP 107216 50619840 833 m² Lot 1 BUP 71230 21490178 119 m² Auction time and place: Auction time and place: Time: 12 noon on Friday, 6th December 2019 Time: 12 noon on Friday, 6th December 2019 Place: Jubilee Community Centre, Place: Jubilee Community Centre, 71 Gordon Street, Mackay QLD 4740 71 Gordon Street, Mackay QLD 4740 DATED this 8th day of November 2019 DATED this 8th day of November 2019 Council Reference: 12307_5 Council Reference: 39115_1 CLH Lawyers Reference: 3273634 CLH Lawyers Reference: 3273671 Local Government Regulation 2012 AUCTION NOTICE This is an Auction Notice under section 142 of the Local Government Regulation 2012 (‘the Regulation’). On 26 June 2019, Mackay Regional Council issued a Notice of Intention to Sell pursuant to section 140 of the Regulation to sell the land described below by way of auction. You are hereby notified that Mackay Regional Council intends to proceed with the auction for the sale of land described in below under sections 141 to 143 of the Regulations unless all overdue rates, interest and other amounts are paid immediately. Full description of land to be sold by auction: Address: 41 Calen Mount Charlton Road, CALEN QLD 4798 Description Title Reference Area Lot 4 RP 711950 21023105 1012 m² Auction time and place: Time: 12 noon on Friday, 6th December 2019 Place: Jubilee Community Centre, 71 Gordon Street, Mackay QLD 4740 DATED this 8th day of November 2019 Council Reference: 17210_6 CLH Lawyers Reference: 3273644 414 QUEENSLAND GOVERNMENT GAZETTE No. 82 [15 November 2019 CONTENTS (Gazettes No. 72-82—pp. 367-414) Page APPOINTMENTS ...... 393-400 Legal Aid Queensland Act Penalties and Sentences Act Public Service Act NOTICES / BYLAWS / DECLARATIONS / STATUTES...... 402-412 Acquisition of Land Act Education (General Provisions) Act Holidays Act Police Service Administration Act NOTIFICATION OF FORMS ...... NIL THIS WEEK Bills Assented to...... NIL THIS WEEK ADVERTISEMENTS...... 412-413 Local Government Act Extraordinary Gazette (Other)...... 367-368 Extraordinary Gazette (Other)...... 369-370 Extraordinary Gazette (Other)...... 371-374 Extraordinary Gazette (Other)...... 375-376 Extraordinary Gazette (Other)...... 377-378 Extraordinary Gazette (Premier and Cabinet)...... 379-380 Extraordinary Gazette (Other)...... 381-384 Extraordinary Gazette (Other)...... 385-386 Natural Resources, Mines and Energy Gazette...... 387-388 Transport / Main Roads Gazette...... 389-392 Local Government Gazette ...... NIL THIS WEEK General Gazette...... 393-413 © The State of Queensland 2019 Copyright protects this publication. Except for purposes permitted by the Copyright Act, reproduction by whatever means is prohibited without prior written permission. Inquiries should be addressed to: Gazette Advertising, GPO Box 2457, Brisbane QLD 4001. ______BRISBANE 15 November 2019