PSC1: A PROTEIN WITH MULTIPLE ROLES IN RNA METABOLISM
Thesis submitted to the University of Adelaide for the degree of Doctor of Philosophy
Philippa Davey, B.Sc.(Hons)
March 2014
The Department of Molecular Biosciences, Discipline of Biochemistry, Faculty of Sciences, The University of Adelaide, Adelaide, South Australia, 5005. AUSTRALIA
TABLE OF CONTENTS
THESIS SUMMARY ...... i STATEMENT ...... Error! Bookmark not defined. ACKNOWLEDGEMENTS ...... iii CHAPTER 1: INTRODUCTION ...... 1 1.1 PSC1 IS A DEVELOPMENTALLY REGULATED GENE ...... 2 1.2 THE PSC1 PROTEIN SEQUENCE SUGGESTS A ROLE FOR PSC1 IN RNA METABOLISM 7 1.2.1 PSC1 CONTAINS AN RNA RECOGNITION MOTIF ...... 7 1.2.2 PSC1 CONTAINS AN RS DOMAIN ...... 9 1.2.3 ADDITIONAL PSC1 DOMAINS SUPPORT A ROLE IN RNA METABOLISM ...... 10 1.2.3.1 The N domain ...... 10 1.2.3.2 Zinc finger motif ...... 11 1.2.3.3 C-terminal repeat motifs ...... 12 1.2.4 PSC1 IS THE FOUNDING MEMBER OF THE ARRS FAMILY OF PROTEINS ...... 12 1.2.4.1 The Drosophila homologue of Psc1 ...... 14 1.2.5 PSC1 AND THE ARRS FAMILY OF PROTEINS: SR RELATED PROTEINS ...... 17 1.3 SR AND SRRPS: ESSENTIAL PROTEINS IN THE LIFE OF AN MRNA MOLECULE ...... 19 1.3.1 TRANSCRIPTION AND THE SR AND SRRP FAMILY ...... 19 1.3.2 SPLICING AND THE SR AND SRRP FAMILY ...... 21 1.3.2.1 Splice site selection and spliceosome formation ...... 22 1.3.2.2 Splice site identification and selection ...... 22 1.3.2.3 Spliceosome formation ...... 23 1.3.3 3’ END FORMATION AND THE SR AND SRRP FAMILY ...... 25 1.3.4 THE EXON JUNCTION COMPLEX AND THE SR AND SRRP FAMILY ...... 26 1.3.5 EJC INDEPENDENT FUNCTIONS OF THE SR AND SRRP FAMILY...... 28 1.3.5.1 mRNA Nuclear export ...... 28 1.3.5.2 mRNA translation ...... 29 1.3.5.3 mRNA stability ...... 29 1.3.6 THE ROLE OF PHOSPHORYLATION IN THE REGULATION OF THE SR AND SRRP FAMILY ...... 30 1.3.7 THE SR AND SRRP FAMILY: IMPORTANT FACTORS IN GENE EXPRESSION ...... 31 1.4 PSC1 SUBCELLULAR LOCALISATION...... 31 1.4.1 PSC1 LOCALISES TO NUCLEAR SPECKLES ...... 31 1.4.1.1 Psc1 localises to non-SC35 nuclear speckles...... 34 1.4.2 PSC1 LOCALISES TO CYTOPLASMIC SPECKLES ...... 35 1.4.3 THE ROLE OF PSC1 DOMAINS IN SUBCELLULAR LOCALISATION ...... 40 1.4.3.1 The Psc1 RS domain and RRM influence nuclear speckle localisation .... 40 1.4.3.2 The Psc1 RS domain. RRM and C-domain influence Psc1 nucleo- cytoplasmic trafficking ...... 41 1.5 HYPOTHESES AND AIMS ...... 44 CHAPTER 2: MATERIALS AND METHODS ...... 46 2.1 ABBREVIATIONS ...... 46 2.2 MATERIALS ...... 51
2.2.1 CHEMICALS AND REAGENTS ...... 51 2.2.2 RADIOCHEMICALS ...... 51 2.2.3 KITS ...... 51 2.2.4 ENZYMES ...... 52 2.2.5 BUFFERS AND SOLUTIONS ...... 52 2.2.6 YEAST TWO HYBRID BUFFERS AND SOLUTIONS ...... 54 2.2.7 PLASMIDS ...... 55 2.2.8 OLIGONUCLEOTIDES ...... 55 2.2.9 ANTIBODIES...... 57 2.2.10 BACTERIAL STRAINS ...... 58 2.2.11 BACTERIAL GROWTH MEDIA ...... 58 2.2.12 DNA MARKERS ...... 58 2.2.13 PROTEIN MARKERS ...... 58 2.2.14 MISCELLANEOUS MATERIALS ...... 58 2.2.15 WEBSITES ...... 59 2.3 MOLECULAR METHODS ...... 60 2.3.1 VECTOR CONSTRUCTION ...... 60 2.3.2 DNA METHODS ...... 62 2.3.2.1 Restriction endonuclease digestion of DNA ...... 62 2.3.2.2 Agarose gel electrophoresis ...... 63 2.3.2.3 Gel Purification of linear DNA fragments ...... 63 2.3.2.4 Phenol/Chloroform purification of linear DNA fragments ...... 63 2.3.2.5 Removal of 5´ phosphate groups from vector DNA fragments ...... 63 2.3.2.6 Ligation reactions ...... 64 2.3.2.7 cDNA synthesis ...... 64 2.3.2.8 PCR with Taq polymerase ...... 64 2.3.2.9 PCR with Pfu polymerase ...... 64 2.3.2.10 Automated sequencing of plasmid DNA ...... 65 2.3.3 BACTERIA ...... 65 2.3.3.1 Preparation of RbCl2 competent cells ...... 65 2.3.3.2 Bacterial heat shock transformation ...... 65 2.3.3.3 Mini-preparation of plasmid DNA ...... 66 2.3.3.4 Midi-preparation of plasmid DNA ...... 66 2.3.4 RNA METHODS ...... 66 2.3.4.1 RNA isolation ...... 66 2.3.4.2 Northern blot protocol ...... 68 2.3.4.3 Northern blot probe protocol ...... 68 2.3.4.4 RNAse protection assay ...... 69 2.3.4.5 RNAse protection probes ...... 70 2.3.5 PROTEIN METHODS ...... 71 2.3.5.1 Preparation of mammalian cell protein extracts ...... 71 2.3.5.2 Immunoprecipitation ...... 71 2.3.5.3 Determination of protein concentration by Bradford assay ...... 72 2.3.5.4 SDS-PAGE analysis ...... 72 2.3.5.5 Western blot analysis ...... 72 2.3.5.6 Mass spectrometry sample preparation ...... 73
2.3.5.7 Mass spectrometry of Psc1 protein ...... 73 2.3.5.8 Nuclear complex separation by sucrose gradient ...... 74 2.3.5.9 Immunocytochemistry ...... 75 2.3.6 YEAST METHODS ...... 75 2.3.6.1 Yeast transformation ...... 76 2.3.6.2 Yeast two hybrid library screen ...... 76 2.3.6.3 Vector DNA extraction from yeast ...... 77 2.3.6.4 Preparation of yeast protein extracts ...... 77 2.4 TISSUE CULTURE METHODS ...... 79 2.4.1 CELL LINES ...... 79 2.4.2 SOLUTIONS ...... 79 2.4.3 MEDIA ...... 79 2.4.4 CULTURING OF CELLS ...... 80 2.4.4.1 ES Cells ...... 80 2.4.4.2 Freezing and thawing of ES cells ...... 80 2.4.4.3 EBM culture ...... 80 2.4.4.4 COS-1 cells ...... 81 2.4.4.5 Cell counts ...... 81 2.4.4.6 Transient transfection of cells ...... 81 CHAPTER 3: PSC1 GENOMIC SEQUENCE AND mRNA VARIANTS ...... 82 3.1 INTRODUCTION ...... 83 3.2 PSC1 GENOMIC SEQUENCE AND INTRON/EXON STRUCTURE...... 83 3.2.1 THE PSC1 5’UTR AND 3’UTR ...... 84 3.2.2 PSC1 SPLICE VARIANTS ...... 87 3.2.3 INVESTIGATION OF THE PSC1 EXON 9 SPLICE VARIANTS IN ES CELLS AND ES CELL DIFFERENTIATION ...... 92 3.3 NORTHERN BLOT OF ES CELL RNA DETECTS PSC1 VARIANT TRANSCRIPTS ...... 101 3.3.1 DETECTION OF PSC1 TRANSCRIPTS WITH VARIANT 3’UTRS ...... 102 3.3.2 PSC1 3’UTR VARIANTS ARE DIFFERENTIALLY DOWN REGULATED DURING ES CELL DIFFERENTIATION ...... 104 3.4 DISCUSSION ...... 106 3.4.1 PSC1 SPLICE VARIANTS ...... 109 3.4.2.1 Psc1 exon 5 splice variant ...... 109 3.4.2.2 Psc1 exon 9 splice variant ...... 110 3.4.3.4 Psc1 exon 13 splice variant ...... 110 3.4.3 PSC1 TRANSCRIPTS CONTAINING VARIANT 3’UTR SEQUENCES ARE EXPRESSED IN ES CELLS ...... 111 3.4.3.1 The generation of alternative 3’UTRs through alternative poly(A) site selection ...... 112 3.4.3.2 Elements found in 3’UTRs ...... 114 3.4.3.3 Psc1 transcripts with alternative 3’UTRs may be important in ES cell differentiation ...... 114 3.4.4 IS PSC1 IMPORTANT IN ES CELLS AND ES CELL DIFFERENTIATION? ...... 115 CHAPTER 4: THE PSC1 PROTEIN: MODIFICATION AND EXPRESSION 116 4.1 INTRODUCTION ...... 119
4.2 WESTERN BLOT ANALYSIS OF PSC1 ...... 119 4.2.1 DETECTION OF GFP-PSC1 BY WESTERN BLOT ...... 121 4.2.2 DETECTION OF ENDOGENOUS PSC1 FROM ES CELLS ...... 121 4.3 PSC1 IS POST-TRANSLATIONALLY MODIFIED: IDENTIFICATION OF THE PSC1 MODIFICATION ...... 123 4.3.1. PSC1 DOES NOT UNDERGO POST-TRANSLATIONAL CLEAVAGE ...... 125 4.3.3 MALDI-TOF AS A METHOD TO DETERMINE PSC1 POST-TRANSLATIONAL MODIFICATION ...... 129 4.4 CHARACTERISATION OF PSC1 O-GLCNACYLATION ...... 135 4.4.1 VALIDATION OF PSC1 O-GLCNACYLATION ...... 135 4.4.2 LOCATION OF PSC1 O-GLCNAC MODIFICATION ...... 136 4.4.3 ADDITIONAL LOCATIONS OF PSC1 O-GLCNAC MODIFICATION...... 139 4.4.4 O-GLCNACYLATION OF PSC1 477-498 DOES NOT AFFECT PSC1 SUB-CELLULAR LOCALISATION ...... 142 4.5 EXPRESSION OF PSC1 PROTEIN IN DIFFERENTIATING ES CELLS ...... 142 4.6 DISCUSSION ...... 147 4.6.1 PSC1 PROTEIN ISOFORMS SHOW VARIANT MIGRATION IN SDS PAGE ...... 147 4.6.2 O-GLCNAC MODIFICATION ...... 151 4.6.2.1 Potential functional significance of O-GlcNAc modification of Psc1 ..... 152 4.6.2.2 Future experiments on the O-GlcNAc modification of Psc1 ...... 153 4.6.3 CHARACTERISATION OF PSC1 PROTEIN EXPRESSION DURING ES CELL DIFFERENTIATION ...... 153 4.6.4. CONCLUSION ...... 154 CHAPTER 5: IDENTIFICATION OF PSC1 INTERACTING PROTEINS: INVESTIGATION OF CANDIDATE PROTEINS ...... 155 5.1 INTRODUCTION ...... 156 5.2 PSC1 INTERACTS WITH RS DOMAIN CONTAINING PROTEINS ...... 156 5.3 PSC1 CYTOSPECKLES: COMPARISON TO CYTOPLASMIC RNA METABOLISM PROTEINS ...... 162 5.3.1 PSC1 CYTOSPECKLES DO NOT CO-LOCALISE WITH THE S6 RIBOSOMAL PROTEIN ...... 162 5.3.2 PSC1 CYTOSPECKLES DO NOT CO-LOCALISE WITH GWBS ...... 164 5.4 PSC1 DOES NOT LOCALISE TO CAJAL BODIES ...... 167 5.5 PSC1 INTERACTS AND CO-LOCALISES WITH PABPN1 ...... 172 5.6 DISCUSSION ...... 182 5.6.1 PSC1 INTERACTS IN A COMPLEX WITH SC35 AND SF2/ASF ...... 182 5.6.2 PSC1 SELF INTERACTS ...... 183 5.6.3 PSC1 SPECKLES ARE NOT SITES OF CAJAL BODIES, RNA TRANSLATION OR GWBS ...... 183 5.6.4 MOUSE PSC1 INTERACTS WITH PABPN1 ...... 184 5.6.5 POTENTIAL FUNCTIONS OF THE INTERACTION BETWEEN PSC1 AND PABPN1 .... 184 5.6.5.1 A role for Psc1 and Pabpn1 in mRNA nuclear export ...... 184 5.6.5.2 Pabpn1 and its role in polyadenylation and 3’end processing ...... 186 5.6.5.3 Pabpn1 and exosome activity/deadenylation ...... 187 5.6.5.4 Pabpn1 and its role in translation ...... 188 5.6.6 SUMMARY ...... 189
CHAPTER 6: IDENTIFICATION OF PSC1 INTERACTING PROTEINS USING A YEAST TWO HYBRID SCREEN ...... 190 6.1 INTRODUCTION ...... 191 6.2 YEAST TWO HYBRID SCREEN DETAILS ...... 191 6.2.1 UNCHARACTERISED PSC1 INTERACTING PROTEINS ...... 193 6.2.2 CHARACTERISED PSC1 INTERACTING PROTEINS ...... 196 6.3.1 INTERACTION BETWEEN PSC1 AND HRS IN MAMMALIAN CELLS ...... 199 6.3.2 INTERACTION BETWEEN PSC1 AND EIF4H IN MAMMALIAN CELLS ...... 199 6.4 INTERACTION BETWEEN PSC1 AND SART1 IN MAMMALIAN CELLS ...... 202 6.4.1 INTERACTION OF SART1 WITH PSC1 DOMAIN MUTANTS...... 208 6.5 DEVELOPMENTAL EXPRESSION OF SART1 ...... 210 6.6 DISTRIBUTION OF PSC1 AND SART1 AFTER SUBCELLULAR FRACTIONATION ...... 211 6.7 SUBCELLULAR LOCALIZATION OF SART1 AND PSC1 ...... 215 6.7.1 SUBCELLULAR LOCALIZATION OF SART1 ...... 215 6.7.2 PSC1 AND SART1 SUBCELLULAR CO-LOCALISATION ...... 219 6.8 DISCUSSION ...... 232 6.8.1 YEAST TWO HYBRID SCREEN OF TESTIS CDNA FOR PSC1 INTERACTING PROTEINS ...... 232 6.8.2 INTERACTION BETWEEN PSC1 AND HRS ...... 233 6.8.3 INTERACTION BETWEEN PSC1 AND EIF4H ...... 233 6.8.4 SART1: A PSC1 BINDING PROTEIN ...... 234 6.8.4.1 Sart1 and Psc1 directly interact ...... 236 6.8.4.2 Subcellular localisation of Sart1 ...... 236 6.8.4.3 Sart1 is able to localise to nucleoli ...... 237 6.8.4.4 Sart1 over expression disrupts nucleoli ...... 238 6.8.4.5 Sart1 over expression causes changes in the localisation of Psc1 in nucleoli ...... 238 6.8.4.6 What is the function of an interaction between Psc1 and Sart1? ...... 240 CHAPTER 7: FINAL DISCUSSION ...... 242 7.1 IS PSC1 AN RNA EXPORT PROTEIN? ...... 242 7.2 WHAT IS PSC1 TARGET MRNA? ...... 245 7.3 PSC1 INTERACTS WITH SART1 ...... 246 7.4 PSC1 AND SART1 CO-LOCALISE TO THE NUCLEOLI ...... 247 7.5 REGULATION OF A MULTIFUNCTIONAL PSC1 ...... 248 7.6 WHAT IS THE BIOLOGICAL SIGNIFICANCE OF PSC1? ...... 248 REFERENCES: ...... 251
THESIS SUMMARY
Peri-implantation stem cell 1 (Psc1) is a developmentally regulated protein that is down regulated as cells of the blastocyst inner cell mass differentiate into primitive ectoderm in vivo, and as embryonic stem (ES) cells differentiate in vitro. The function of Psc1 is unknown, however the Psc1 protein sequence contains multiple domains that suggest a role in RNA metabolism. These include an RNA recognition motif (RRM) that has been shown to bind RNA in vitro, and a motif known as an RS domain that contains multiple alternating serine and arginine dipeptide repeats, and is found in many proteins involved in RNA processing. Psc1 localises with RNA metabolism proteins and to sites in the nucleus known as nuclear or splicing speckles, as well as to unidentified speckles in the cytoplasm. The work in this thesis has shown that multiple alternative forms of Psc1 exist at both the RNA and protein level, and that regulation of these alternative forms of Psc1 occurs during ES cell differentiation. Further evidence for a role in RNA metabolism and the identification of Psc1 function has been advanced through the identification of Psc1 protein binding partners Sart1 and Pabpn1. These results have lead to a model where Psc1 functions at multiple stages during the maturation of specific RNA transcripts, potentially during splicing and spliceosome formation though an interaction with Sart1, and during mRNA nuclear export through an interaction with Pabpn1.
i
STATEMENT
I certify that this work contains no material which has been accepted for the award of any other degree or diploma in my name, in any university or other tertiary institution and, to the best of my knowledge and belief, contains no material previously published or written by another person, except where due reference has been made in the text. In addition, I certify that no part of this work will, in the future, be used in a submission in my name, for any other degree or diploma in any university or other tertiary institution without the prior approval of the University of Adelaide and where applicable, any partner institution responsible for the joint-award of this degree.
I give consent to this copy of my thesis, when deposited in the University Library, being made available for loan and photocopying, subject to the provisions of the Copyright Act 1968.
I also give permission for the digital version of my thesis to be made available on the web, via the University’s digital research repository, the Library Search and also through web search engines, unless permission has been granted by the University to restrict access for a period of time.
SIGNED ……………………… DATE …………..
ii
ACKNOWLEDGEMENTS
I would like to thank Professor Peter Rathjen for the opportunity to undertake a PhD in the Rathjen lab, for input into my research, and support for the submission of my thesis after such a length of time.
Thank you to all the members of the Rathjen Lab who helped and taught me during my time at the bench, especially the two Steves, Nathan, Katherine, Michael and Joy.
Special thanks to my co-supervisor Rebecca, for guidance and advice during my time in the lab, but especially for never giving up on me completing my thesis, reading my drafts and supplying encouragement when I needed it most.
Special thanks to Joy Rathjen for helping me get my thesis from draft to complete. I can't understate my appreciation for your time, knowledge and expertise.
To my husband John, thank you for everything, this thesis would never have been completed without you. And to my children Liliana and Oscar, thank you for providing the motivation to finish.
iii
NOTE: Pagination of the digital copy does not correspond with the pagination of the print copy
CHAPTER 1
INTRODUCTION
1
CHAPTER 1: INTRODUCTION
For many years the study of gene expression within cells and organisms has focused on regulation at the level of transcription. Much is known about gene promoters and enhancers, transcription factors and transcription factor regulation. Gene expression is routinely measured as the amount of mRNA detected. More recently, however, it has become clear that the regulation of the mRNA itself, from transcription to translation or degradation, plays an equally important role in determining the amount and function of the protein produced. The role of non-coding RNA such as miRNAs, the small single-stranded RNA molecules that target mRNAs to destabilize them or inhibit their translation, are now recognised as having an important role in cell biology. The subject of this thesis, the protein Psc1, is predicted to have multiple roles in RNA metabolism and potentially important roles in the regulation of RNA during development.
1.1 Psc1 is a developmentally regulated gene Peri-implantation Stem Cell 1 (Psc1; also known as RNA binding motif protein 27, Rbm27) was originally isolated in a screen aimed at identifying genes differentially expressed during the early developmental stages of the mouse embryo. Differential display PCR of embryonic stem (ES) cells and early primitive ectoderm like (EPL) cells, showed Psc1 is expressed in ES cells, and down regulated as ES cells differentiate into EPL cells (Schulz, 1996).
Mouse ES cells were isolated from, and are an in vitro model of, the inner cell mass (ICM) cells of the 3.5 days post coitum (d.p.c.) embryo (reviewed in Rathjen et al., 1998; Martin, 1981; Evans and Kaufman, 1981). They are a population of pluripotent cells, and have the ability to give rise to any cell type of the adult (Bradley et al., 1984). In vivo, cells of the ICM undergo differentiation to form a second pluripotent population, an epithelial monolayer of cells termed primitive ectoderm. At gastrulation the primitive ectoderm is the substrate that gives rise to the three germ layers, mesoderm, endoderm, and ectoderm, as well as the germ cells of the developing embryo. To model the ICM to primitive ectoderm transition in vitro, mouse ES cells
2 can be cultured in the presence of the HepG2 cell conditioned medium, MEDII (Rathjen et al., 1999). MEDII promotes the homogenous differentiation of ES cells to EPL cells, an in vitro equivalent to the early primitive ectoderm cells of the 5.25 d.p.c. embryo by both gene expression and developmental potential (Rathjen et al., 1999; Lake et al., 2000). EPL cells can be grown as an adherent culture or as aggregates known as ‘embryoid bodies grown in MEDII’ (EBMs). Gene markers of the ICM, Rex1, Spp1 and Nanog (Botquin et al., 1998; Chambers et al., 2003; Mitsui et al., 2003; Rogers et al., 1991), are down regulated in EBMs at day 2 (EBM2), the pluripotent marker Oct4 (Nichols et al., 1998) is down regulated after EBM5, and the primitive ectoderm marker Fgf5 (Haub and Goldfarb, 1991; Pelton et al., 2002; Rathjen et al., 1999) is expressed between EBM2 and EBM5 (Harvey et al., 2010), indicating EBM2- EBM5 are equivalent to primitive ectoderm.
As shown in Figure 1.1, Psc1 expression is highest in ES cells and is down regulated as ES cell differentiate to EPL cells (Schulz, 1996). The in vivo expression of Psc1 is consistent with that seen in the ES-EPL cell model (Pelton, 2002). Whole mount in situ hybridisation on mouse embryos (Fig. 1.2) showed Psc1 transcript is detected at 3.5 d.p.c. throughout the pluripotent cells of the ICM, but not in extra embryonic cell types. Expression is continued within the pluripotent cells during implantation, and is down regulated between 5 and 5.25 d.p.c., coincident with the earliest morphological evidence of proamniotic cavitation. Psc1 expression is not detected during gastrulation (Pelton, 2002). The expression of Psc1 prior to 3.5 d.p.c. has not yet been determined, however EST data shows Psc1 is present in both oocytes and fertilized ovum (Unigene Mm.329400, UGID:1128436), suggesting Psc1 is present in the embryo from the earliest stage.
RNase protection analysis of later stage mouse embryos and specific tissues of the 16.5 d.p.c. embryo and adult (Fig. 1.3) showed that Psc1 is detectable by 10.5 d.p.c. By 16.5 d.p.c., expression of Psc1 in the total embryo is almost double that seen in ES cells, and is highest in the lungs, limbs and brain, compared to liver, kidney, heart, intestine and skin. In adults, Psc1 expression is highest in the lungs and placenta, lower levels of
3
4
5
6 expression are observed in liver and kidney, and minimal or no expression was detected in heart and skeletal muscle (Schulz, 1996).
Although the function of Psc1 is unknown, spatial and temporal regulation in the early embryo indicate a potentially significant role for Psc1 in early development, possibly in the differentiation process of ICM to primitive ectoderm or in the processes that regulate cavitation. Tissue specific variations in Psc1 expression levels in later stage embryos and in the adult suggest that following gastrulation, Psc1 may have a role in tissue specific development and tissue specific functions in the adult.
1.2 The Psc1 protein sequence suggests a role for Psc1 in RNA metabolism The Psc1 cDNA sequence isolated by Schulz contains an open reading frame of 3015 nucleotides and codes for a protein of 1005 amino acids (Schulz, 1996). BLASTP analysis (www.ncbi.nlm.nih.gov) identified a number of conserved domains within the Psc1 protein sequence (Fig. 1.4) (Schulz, 1996; Kavanagh et al., 2005). The domains identified within Psc1 are predominantly found in proteins involved in RNA metabolism, and indicate a role for Psc1 in this aspect of cell biology. The presence of an RNA binding domain and an RS domain characterise Psc1 as a member of the SR related family of proteins.
1.2.1 Psc1 contains an RNA recognition motif The strongest indicator that Psc1 is involved in RNA metabolism is the presence of an RNA recognition motif (RRM), which shows significant alignment with the RRM consensus motif (NCBI conserved domain database www.ncbi.nlm.nih.gov; Marchler- Bauer et al., 2004; Kavanagh et al., 2005). The Psc1 RRM has been shown to be a functional RNA binding domain using an in vitro RNA binding assay (Kavanagh et al., 2005).
RNA recognition motifs are one of the most abundant protein domains found in eukaryotes, and are present in approximately 2% of human gene products. They are
7
8 often found together with other domains, the most frequent of which are the CCCH and CCHC type zinc fingers. As well as binding to RNA, RRM to RRM interactions are known to occur. This results in the formation of larger RNA binding surfaces, and contributes to the high RNA-binding affinity and specificity seen with many RNA binding proteins (reviewed in Maris et al., 2005).
1.2.2 Psc1 contains an RS domain Amino acids 164-187 of Psc1 contain multiple alternating serine and arginine dipeptide repeats, a motif known as an RS domain. RS domains are found in over 240 metazoan proteins, the majority of which are involved with various aspects of mRNA metabolism. This includes the facilitation and regulation of pre-mRNA splicing and 3’ end processing, and the regulation of mRNA nuclear export, translation, quality control, and stability (reviewed in Huang et al., 2005; Shepard et al., 2009; Zhong et al., 2009; Long and Caceres, 2009). In addition, some RS domain containing proteins are found to have roles in other aspects of cell biology such as chromatin remodelling, cell cycle progression, and cell structure (Boucher et al. 2001; Long and Caceres, 2009).
The RS domain has been shown to be multifunctional, having roles in nuclear import (Caceres et al., 1997), subnuclear localisation (Caceres et al., 1997; Li et al., 1991; Hedley et al., 1995), nucleo-cytoplasmic shuttling (Caceres et al. 1993) and nuclear retention (Cazalla et al., 2002). One of the best studied roles for RS domains is in mRNA splicing and spliceosome formation. When tethered to pre-mRNA, the RS domain of SR proteins, SR related proteins, and synthetic RS domains all have the ability to activate splicing, with potency of activation being directly linked to the number of RS dipeptides present, fitting a model where the tetrapeptide RSRS or SRSR is the functional unit (Graveley et al,, 1998; Philipps et al., 2003). RS domains were originally thought to be predominantly protein-protein interaction domains (Manley and Tacke, 1996; Labourier et al.,1999). However, RS domains have also been shown to interact directly with pre-mRNA at the branchpoint and the 5’ splice site
9 during formation of the spliceosome complex, suggesting protein-RNA interactions may be of equal importance to their function (Shen and Green, 2004).
1.2.3 Additional Psc1 domains support a role in RNA metabolism In addition to the RRM and RS domains, Psc1 contains other domains and motifs that support the involvement of Psc1 in RNA metabolism. These include the N-domain, Zn finger, and several repeat motifs (see Fig. 1.4).
1.2.3.1 The N domain The Psc1 N domain, which constitutes the N-terminal 72 amino acids of Psc1, shares 30% identity with the N-terminus of HPrp3p (Fig. 1.5), a protein associated with the pre-spliceosomal U4/U6 snRNP complex (Wang et al., 1997). HPrp3p is able to bind to the U4 and U6 snRNAs, and is thought to be responsible for the recruitment of other factors, such as HPrp4p to the U4/U6 snRNP complex (Gonzalez-Santos et al., 2002). HPrp3p has been shown to interact with the U2 snRNP-associated protein SPF30 (Rappsilber et al., 2001), and it has been postulated that this interaction assists in the recruitment of the U4/U6.U5 tri-snRNP to the pre-spliceosome complex during the formation of the mature spliceosome.
The N-terminus of HPrp3p contains a PWI motif, a domain that functions as a nucleic acid binding domain with dual specificity for RNA and DNA (Szymczyna et al., 2003). Psc1 contains 50% of the residues that are found to be highly conserved in the core PWI motif, but lacks both the characteristic proline and isoleucine of the PWI itself (Fig. 1.5). HPrp3p contains 64% of these residues, whereas another PWI containing protein SRm160 contains 96%. It is unknown if the Psc1 N-domain has the ability to bind nucleic acids.
10
Psc1 1 MLI EDVDALKSWLAKLLEPICDADPSALANYVVALVKKDKPEKELKAFCADQLDVFLQKETSGFVDKLFESLY 73 Hprp3p 1 MALSKRELDELKPWIEKTVKRVLGFSEPTVVTAALNCVGKGMDKK KA ADHLKPFLDDSTLRFVDKLFEAVE 71 PWI motif LKPWI KKIMQ LG EE FYDFV L L FM LF MLI IR RLIE I D LVEYI I M V MW LVL M V D VI I I V F
Figure 1.5: Psc1 N Domain alignment with Hprp3p and PWI consensus motif. Sequence identity between Psc1 N domain and Hprp3p shown in bold. PWI consensus motif was determined through the alignment of 11 PWI motif proteins. Amino acids that are identical or similar were identified as conserved (shown in red; PWI underlined; Szymczyna et al., 2003).
11
1.2.3.2 Zinc finger motif
C-terminal to the RS domain, Psc1 contains a CCCH (C(X)8C(X)5C(X)3H) type zinc finger motif. This class of zinc finger, although capable of binding DNA, is thought to be primarily involved in binding RNA. The prototypic CCCH zinc finger protein Tristetraprolin (TTP) regulates the degradation of a number of specific mRNAs coding for proto-oncogenes, cytokines and lymphokines. Recent structural studies have shown that this is facilitated by the binding of the TTP CCCH zinc finger to specific AU rich elements in the 3’ untranslated region (UTR) of the mRNA. The recognition of specific mRNA sequences is regulated through the protein backbone hydrogen bonds interacting with the Watson-Crick edges of the adenine and uracil bases, suggesting that the backbone architecture of the CCCH zinc finger may regulate mRNA binding specificity (reviewed in Hall et al., 2005).
1.2.3.3 C-terminal repeat motifs The C-terminal region of Psc1 contains two additional repeat sequences: 8 consecutive glycine/arginine repeats (located between amino acids 897-908), and an acidic amino acid rich region comprised of 70% aspartate and glutamate residues (amino acids 969- 999). The significance of these sequences is unknown, but glycine/arginine rich domains have been shown to function as both protein and RNA binding domains (Kiledjian et al., 1992; Cartegni et al., 1996).
1.2.4 Psc1 is the founding member of the ARRS family of proteins Database analysis has identified proteins that show homology to Psc1 from an evolutionarily diverse range of organisms. These proteins all contain an acidic C- terminus rich in aspartic and glutamic acid residues, after which the family was named - Acidic Rich RS domain (ARRS) family of proteins. Orthologues of a single gene are found in invertebrate species, with a putative gene duplication event resulting in two conserved homologues in vertebrates, one being Psc1 (Kavanagh et al., 2005) (Fig. 1.6).
12
13
ARRS proteins are defined by the sequential arrangement of the six domains found in Psc1, an N-domain, followed by an RS domain, a zinc finger motif, an RNA recognition motif (RRM), a C-domain, and an acidic rich C-terminal motif (Fig. 1.7). The C-domain, located near the C-terminus of the proteins, was identified as a region that contained a high level of homology between ARRS proteins. Within the ARRS RRM, two motifs unique to the ARRS family of proteins are found,
P(X)3N(X)7HF(X)2FG(X)3N and A(X)2A(X)2S(X)5NNRFI(X)3W, suggesting the possibility that ARRS proteins share a common function, potentially the binding of a specific subset of RNA molecules.
1.2.4.1 The Drosophila homologue of Psc1 The ARRS family of proteins is largely uncharacterised with functional information available only for the Drosophila homologue. The Drosophila homologue of Psc1, named second mitotic wave missing (swm, CG10084), has been identified in a number of genetic screens. Swm was first identified genetically as part of a recessive lethal complementation group in a screen for new alleles of ref(2)P, a gene that determines susceptibility to Sigma virus (Gay and Contamine,1993). Swm has also been identified in a screen for suppressors of the CDK inhibitor gene roughex (rux; Dong et al., 1997; Foley and Sprenger, 2001) and swm has been shown to be a negative regulator of Hedgehog (Hh) signaling using both genetic and molecular analyses (Casso et al., 2008). Identification of swm in the rux pathway is thought to be a consequence of its role in Hh signaling, although the molecular basis of the interaction in the Hh pathway is unknown. Swm function is not limited to Hh signaling, as many aspects of a mutant swm phenotype (e.g. ectopic venation, wing hair polarity, cell size, and interaction with Minutes) are not attributable to defects in Hh signaling.
Swm shows broad expression in Drosophila in both embryos and larvae, and in wing discs (Fig. 1.8). Detailed analysis of swm expression by in situ hybridization showed expression is strong in cellularised embryos and is enhanced along the ventral midline. Segmental stripes are evident at germband retraction. Late in embryogenesis, swm
14
15
16 expression appears to be ubiquitous. In third instar larval tissues, strong swm expression is observed in imaginal discs, salivary gland, optic lobe, fat body, and in the wreath cells and gastric caecae of the gut (Casso et al., 2008). Expression of an N- terminally tagged GFP-swm fusion protein in S2 cells shows strong nuclear localisation of swm (Fig. 1.9; Casso et al., 2008).
1.2.5 Psc1 and the ARRS family of proteins: SR related proteins The presence of an RS domain and a putative role in RNA metabolism classify Psc1 and the ARRS family of proteins as novel members of the SR related family of proteins (SRrp). Proteins containing RS domains are classified into two groups, SR proteins and SRrps. Proteins from both groups function, often together, in multiple essential and regulatory aspects of pre-mRNA splicing, and multiple additional stages of mRNA regulation and processing.
SR proteins are typically smaller than Psc1 and are characterised by a modular domain structure consisting of one or two N-terminal RNA binding domains (RBDs), and a C- terminal RS domain (reviewed in Graveley, 2000: Lin and Fu, 2007; Long and Caceres, 2009; Shepard and Hertel 2009; Risso et al.,2012). Psc1 contains the reverse order of these domains (N-terminal RS domain, and C-terminal RBD), plus additional domains and motifs not usually found in SR proteins. The classical SR proteins are SF2/ASF, SC35, SRp20, SRp75, SRp40, SRp55, and 9G8. SR protein nomenclature has recently been standardised and they are now designated splicing factor, arginine/serine-rich (SFRS) as follows: SFRS1 (SF2/ASF), SFRS2 (SC35), SFRS3 (SRp20), SFRS4 (SRp75), SFRS5 (SRp40), SFRS6 (SRp55) and SFRS7 (9G8) (Manley and Krainer, 2010). In this thesis they are referred to by their original names.
SRrps are defined by the presence of an RS domain, and a role in RNA metabolism, with many, but not all, containing an RBD (reviewed in Long and Caceres, 2009; Blencowe et al., 1998). The Psc1 RRM has been shown to bind RNA, and the Zn finger and N domain are potential additional RNA binding domains, supporting a role
17
18 for Psc1 in RNA metabolism. Some examples of SRrps include the U2 auxiliary factors U2AF35 and U2AF65, snRNP components such as U1-70K, splicing regulators such as hTra2 and the splicing co-activators SRm160 and SRm300.
1.3 SR and SRrps: Essential proteins in the life of an mRNA molecule Eukaryotic gene expression is a complex, highly regulated process. In addition to the controlled transcription of genes, the processing of the resultant RNA has a significant impact on the expression and function of the protein end product. The processing and regulation of an mRNA molecule starts co-transcriptionally; a 5’ m7G cap is added, the introns are spliced out of the transcript, and the 3’ end is cleaved and a poly(A) tail added. These events regulate the nuclear export, quality control, translation, stability and function of the end product. SR and SRrps play key roles in these processes that are often interlinked and interdependent. The following section describes how the life of an RNA molecule is impacted by SR and SRrps and provides an overview of the various aspects of RNA metabolism that Psc1 as an SRrp may be involved with (Fig. 1.10).
1.3.1 Transcription and the SR and SRrp family SR proteins and SRrps are among the hundreds of proteins present in the RNA polymerase II (RNAP II) complex (Das et al., 2007), and some interact directly with the C-terminal domain (CTD) of RNAP II (Yuryev et al., 1996). SR and SRrps are best known for their roles in pre-mRNA splicing and these associations with RNAP II have been previously attributed to the fact that RNA splicing may happen co- transcriptionally, with approximately 80% of pre-mRNA splicing occurring co- transcriptionally in mammalian cells (Bauren et al., 1994; Beyer et al., 1988; Girard et al, 2012).
Recently SR proteins have been found to function directly in transcription, with SC35 shown to promote RNAP II elongation in a subset of genes (Lin et al., 2008). Depletion of SC35, SF2/ASF, and the SR-related protein RNSP1 have all been shown to cause
19
20 the formation of R-loops (RNA:DNA hybrid structures) in cells resulting in a hyper mutation phenotype (Li et al., 2005; Xiao et al., 2007; Li et al., 2007). R-loops form transient transcription bubbles within elongating RNAP II complexes in which the nascent RNA remains attached to the template DNA and displaces the non-template strand. R-loops are normally resolved quickly as the RNAP II complex travels along the DNA. Blockage of transcriptional elongation can result in a prolonged R-loop, with the exposed single stranded DNA (ssDNA) vulnerable to attack by nucleases or by other DNA modification enzymes, leading to ssDNA breaks and genome instability (Longerich et al., 2006). These results suggest that as well as SC35, SF2/ASF and RNSP1 could have a direct role in transcriptional elongation (Fig. 1.10A).
1.3.2 Splicing and the SR and SRrp family The best studied function of SR proteins and SRrps is in the facilitation and regulation of pre-mRNA splicing (Fig. 1.10B) (Bourgeois et al., 2004; Long and Caceres, 2009; Zhong et al., 2009). Splicing is an essential step in the maturation of most protein coding genes in higher eukaryotes and functions to remove the non-coding introns from gene sequences. Splicing allows for the selective inclusion and exclusion of exons, resulting in the potential for one gene to code for many alternatively spliced variants, which can result in the production of multiple functionally distinct proteins from a single gene (reviewed in Long and Caceres 2009; Shepard and Hertel, 2009). Genomic sequencing projects have highlighted the importance of alternative splicing in achieving high proteomic diversity (reviewed in Nilsen and Graveley, 2010). The Drosophila Dscam gene is alternatively spliced, and has the potential to generate 38016 different protein isoforms, more than twice the number of genes in the entire Drosophila genome (Black et al., 2000; Graveley, 2001). 92%–94% of human transcripts are predicted to undergo alternative splicing resulting in a large diversity of gene expression and serious implications for health and disease, with approximately 15% of mutations causing genetic disease shown to affect pre-mRNA splicing (reviewed in Nissim-Rafinia and Kerem, 2005; Wang et al., 2007).
21
1.3.2.1 Splice site selection and spliceosome formation Splicing is initiated co-transcriptionally with the formation of the spliceosome on the nascent pre-mRNA, a process that involves multiple protein-protein, protein-RNA and RNA-RNA interactions. The spliceosome is a macromolecular complex made up of the five small nuclear ribonuleoproteins (snRNPs) U1, U2, U4, U5 and U6, plus many non-snRNP splicing factors. SR proteins and SRrps function directly in both the identification and regulation of splice sites and in the formation of the spliceosome itself (Fig. 1.10B).
1.3.2.2 Splice site identification and selection The positioning of the spliceosome on the RNA is directed by consensus sequences at the 5’ splice site, the 3’ splice site, and 2 elements upstream of the 3’ splice site, a polypyrimidine tract, and the branchpoint. Splice site consensus sequences alone are generally not sufficient to direct assembly of the spliceosome. Auxiliary elements known as exonic splicing enhancers (ESEs) are involved in positioning and initiating assembly of the spliceosome.
ESEs are short (6-8 nt), degenerate binding sites that are generally bound by SR and SRrps (Liu et al., 1998; Liu et al., 2000; Blencowe, 2000; Gravely, 2000). The binding of SR and SRrps to ESEs functions to define both introns and exons in vitro (Berget et al., 1995; Ibrahim et al., 2005; Gravely, 2000) and in vivo (Ellis et al., 2008). Comparison of exons with weak and strong splice sites implicates ESE involvement in splice site recognition of all exons, including both constitutive and regulated alternative splice sites (reviewed in Blencowe, 2000). The developmental and tissue specific expression of SR proteins results in cell specific patterns of splicing which are largely due to differential affinity for ESE sequences at alternative splice sites. SRrps can influence alternative splicing by acting as antagonists and regulators of SR protein splice site selection (Jummaa et al., 1997; Sakashita et al., 2004; Barnard et al., 2002; Cowper et al., 2001; Zhang et al., 1996; Blencowe, 2006).
22
1.3.2.3 Spliceosome formation The interaction of SR proteins bound at ESE sequences and components of the spliceosome regulate the assembly of the spliceosome at the correct sequence on the RNA transcript. The assembly of the spliceosome occurs in a stepwise manner (Fig. 1.11; reviewed in Wahl et al., 2009). First, the U1snRNP binds to the 5’splice site, splicing factor 1/ mammalian branch point binding protein (SF1/mBBP) binds to the branch point, and the SRrps U2 auxiliary factor 65 (U2AF65) and 35 (U2AF35) bind to the polypyrimidine tract and the 3’ splice site, respectively. This forms what is known as the E, or early, complex. ESE bound SR proteins are thought to interact with the SRrp U2AF35, which in turn recruit the SRrp U2AF65, initiating assembly of the spliceosome on the upstream intron. (Zuo et al., 1996; Graveley, 1998). They are also thought to enhance 3’ splice site selection through interaction with splicing coactivators such as the SR related matrix proteins (SRm) 160/300 (Eldridge et al., 1999). SR proteins may mediate U1 snRNP recruitment, with the SR protein SF2/ASF shown to bind the 5’ splice site consensus sequence, and interact with U1 70K to recruit the U1 snRNP complex (Eperon et al., 2000; Jamison et al., 1995). The RS domain of SF2/ASF has been shown to interact directly with RNA at the branch point and it has been postulated that this may in itself mediate pre-spliceosomal assembly/formation (Shen and Green, 2004).
The A complex is formed next when the U2 snRNP complex displaces SF1/mBBP and binds to the branchpoint. Next the U4/U6.U5 tri-snRNP complex is recruited to the pre-spliceosome to form the B complex (reviewed in Gravely, 2000). SR proteins are involved in the recruitment of the U4/U6.U5 tri-snRNP complex to the pre- spliceosome (Roscigno et al., 1995), with the tri-snRNP components SRrp65 and SRrp110 shown to be essential, and to function through RS domain-mediated interactions (Makarova et al., 2001; Roscigno et al., 1995).
Association of the tri-snRNP triggers a rearrangement of the spliceosome to its catalytically active form known as the C complex, wherein U6 snRNP replaces U1 snRNP at the 5’ splice site, U6 snRNP and U2 snRNP interact, U5 snRNP bridges the
23
24 splice sites and U1 snRNP and U4 snRNP become destabilised and disassociate from the complex (Reviewed in Gravely, 2000).
1.3.3 3’ End formation and the SR and SRrp family Closely coupled with splicing is the process of 3’ end formation, the cleavage and polyadenylation of RNA transcripts (Fig. 1.10C). 3’ end formation functions to stop transcription, it is a pre-requisite for nuclear export, and the addition of a poly(A) tail regulates both mRNA translation and stability. Polyadenylation plays important roles in many processes including development (Barckmann et al., 2013) and circadian rhythm (Kojima et al., 2012). The RNA substrate is initially cleaved by an endonuclease and then polyadenylated by poly(A) polymerase (PAP) (reviewed in Millevoi and Vagner, 2010).
The last exon of a gene contains a poly(A) consensus sequence (AATAAA) instead of a 5’splice site such that processing and removal of the last intron involves interaction between splicing components at the 3’ splice site of the last exon and components of the poly(A) complex at the poly(A) signal (Cooke et al., 1999; Nesic et al., 1994; Niwa et al., 1991; Vagner et al., 2000). The complex coupling splicing and 3’ end processing is thought to contain over 70 proteins including multiple spliceosomal and poly(A) complex proteins many of which are SR and SRrps. This includes 9G8, SRp40, SC35, SF2/ASF, SRp55, SRp20 SRm160, SRp75, and U170K (Reviewed in Millevoil and Vagner, 2010).
The SRrp SRm160, a co-activator of splicing, can stimulate 3’ end cleavage by interacting with cleavage and polyadenylation specificity factor (CPSF) (McCracken et al., 2002) and targeting CPSF to stimulate polyadenylation machinery assembly (McCracken et al., 2003). The 59, 68 and 72kDa subunits of Cleavage Factor Im (CFIm) are also SRrps. CFIm functions in the recognition of poly(A) sites through its own RRM domains and through interaction with splicing related proteins. CFIm interacts with the U1snRNP complex protein SRrp U170K (Awasthi and Alwine,
25
2003), and with the SR protein 9G8, directly affecting the assembly of the 3’ end machinery (Valente et al., 2009). CFIm also interacts with the SRrp U2AF65 at the poly(A) signal (Millevoi et al., 2006). This interaction involves the RS domains of both factors and mediates the ability of the last intron pyrimidine tract to positively influence mRNA 3’ end formation (Millevoi et al., 2006; Kyburz et al., 2006).
The SRrps U170K, U2AF65 and the SR protein SRp75 have been shown to interact with PAP, causing inhibition of polyadenylation. This is thought to help co-ordinate timing of 3’ end processing by inhibiting PAP until after cleavage has taken place (Ko et al., 2002; Boelens et al., 1993; Gunderson et al., 1998).
1.3.4 The Exon junction complex and the SR and SRrp family After the removal of an intron from a pre-mRNA transcript, some of the proteins involved in splicing remain attached to the mRNA in an RNP complex, the exon junction complex (EJC; Le Hir et al., 2000; Tange et al., 2004; Fig. 1.10D). The EJC functions to co-ordinate the interactions of the mRNA with protein complexes involved in pre-mRNA splicing (Ashton-Beaucage et al., 2010; Roignant and Treisman, 2010), mRNA nuclear export (reviewed in Martin and Ephrussi, 2009), translation activation (Nott et al., 2004; Tange et al., 2005; Diem et al., 2007; Le Hir and Seraphin, 2008; Ma et al., 2008), and mRNA degradation via nonsense-mediated mRNA decay (NMD; reviewed in Isken and Maquat, 2008; Rebbapragada and Lykke-Andersen, 2009). The EJC forms 20-24 nucleotides upstream from the exon junction and over a dozen proteins have been found to be involved so far, with core factors binding to the RNA during pre-mRNA splicing (Ballut et al., 2005; Tange et al., 2005), and peripheral factors joining only transiently during assembly or subsequent metabolism (Tange et al., 2005; Le Hir and Seraphin, 2008). The SRrps Pinin, Acinus, and RNPS1 are found in the EJC outer shell, and SRm160 is found as a transiently interacting EJC factor (Le Hir et al., 2000; Le Hir et al., 2001; Lejeune et al., 2002). The SR protein SF2/ASF has been found associated with the EJC and may constitute a peripheral EJC interacting protein whose association depends on flanking sequences (Tange et al., 2005). The
26 majority of EJCs are removed during the pioneering round of translation (Le Hir and Andersen, 2008; Buchwald et al., 2010; Bono and Gehring, 2011).
Although the EJC is not essential for mRNA export, its presence can enhance export. It interacts with the RNA export factors UAP56, Aly/REF and NXF1/TAP (Masuda et al., 2005; Cheng et al., 2006). It has been found that reduction of the EJC component Pinin can lead to accumulation of poly(A) RNA in the nucleus, suggesting a possible role for Pinin in mRNA nuclear export (Li et al., 2003).
The EJC appears to directly enhance translation initiation. Spliced mRNAs have a greater translational efficiency than their cDNA counterparts and RNA tethering of EJC components boosts expression of intronless mRNAs, whereas removal of introns has no effect on protein expression if EJC formation is blocked (reviewed in Le Hir et al., 2003). RNPS1, SRm160 and Acinus have been shown to enhance polysome association, and RNPS1 can increase the translational yield from a transcript, i.e. the number of protein molecules produced per RNA molecule (Nott et al., 2004). Recently it was shown that the EJC can activate translation downstream of the mTOR (mammalian target of rapamycin) signaling pathway (Ma et al., 2008), and that translation is repressed by partners of the EJC that function in nonsense mediated decay (NMD; Isken and Maquat, 2008).
The EJC plays a role in the regulation of NMD, a cytoplasmic mRNA quality control mechanism targeting aberrant transcripts formed as a result of nonsense mutations and RNA-processing errors (Chang et al., 2007; Isken and Maquat, 2007; Kervestin and Jacobson, 2012). NMD functions to rapidly degrade mRNA transcripts that contain a premature termination codon (PTC). NMD is triggered by the presence of a termination codon upstream from an EJC, and occurs during the so-called pioneer round of translation (Ishigaki et al., 2001). NMD is facilitated by the EJC proteins Upf1, Upf2 and Upf3, although the EJC SRrp RNPS1 is capable of triggering NMD when tethered directly to an RNA molecule downstream of an in frame stop codon (Gehring et al., 2005). Increased expression of a subset of SR proteins, including SF2/ASF, SC35,
27
SRp40 and SRp55, strongly enhances NMD (Zhang and Krainer, 2004) and this is thought to involve stimulating and/or stabilizing EJC deposition. A recent study has shown that SF2/ASF has the potential to shift the site of NMD from the cytoplasm to the nucleus (Sato et al., 2008).
NMD is now also being recognized as a mechanism for gene regulation in a process known as alternative splicing dependent NMD (AS-NMD) (McGlincy and Smith, 2008) or RUST (from “regulation by unproductive splicing and translation”; Lewis et al., 2002; Lareau et al., 2007). An example of AS-NMD is seen with the SR protein SC35. When highly expressed, SC35 binds its own pre-mRNA, changing the splicing pattern and resulting in an SC35 transcript containing a premature termination codon. NMD is subsequently induced, and SC35 levels are reduced (Sereau et al., 2001). It has been predicted that between ~2% to 35% of alternatively spliced transcripts result in AS-NMD, with many splicing events showing interspecies conservation supporting the role of AS-NMD as a genuine mechanism for gene regulation (de Lima Morais and Harrison, 2010; Mudge et al., 2011; Zhang et al., 2009).
1.3.5 EJC independent functions of the SR and SRrp family SR and SRrps proteins have been shown to function in the nuclear export, translation, and stability of mRNA independent of the EJC (Fig. 1.10 E, F, G).
1.3.5.1 mRNA Nuclear export SF2/ASF, 9G8 and SRp20 are SR proteins that are known to shuttle between the nucleus and cytoplasm and they have all been shown to interact directly with the mRNA export receptor protein TAP to facilitate the export of spliced mRNA (Reed et al., 2005). In addition, SRp20 and 9G8 and the Drosophila U2AF have been shown to interact with and promote the export of intronless mRNA, showing the binding of these proteins to the RNA and their role as export adaptors is independent of splicing and the EJC (Huang et al., 2001; Blanchette et al., 2004). Intronless genes in fact have been shown to have a higher frequency of SR protein binding sites than intron containing
28 genes (Pozzoli et al., 2004). Binding sites for non-shuttling SR proteins such as SC35 and SRp40 have been found in intronless transcripts suggesting that non-shuttling SR proteins may be involved in packaging mRNA for export with shuttling SR proteins facilitating the export (reviewed in Huang and Steitz, 2005; Moore and Proudfoot, 2009).
1.3.5.2 mRNA translation Experiments have shown a role for shuttling SR proteins in regulation of mRNA translation. SF2/ASF and SRp20 co-sediment with ribosomal particles, and SF2/ASF co-sediments with polysomes. When tethered to an mRNA molecule, or bound to an ESE sequence, SF2/ASF has been shown to activate translation, and this activity is facilitated by the RS domain and second RRM of the protein (Sanford et al., 2005; Sanford et al., 2004). This direct effect of SF2/ASF in the regulation of the translation of SF2/ASF-bound mRNA targets is mediated by the recruitment of components of the mTOR signaling pathway, resulting in phosphorylation and release of 4E-BP, a competitive inhibitor of cap-dependent translation (Michlewski et al., 2008). The experiments that demonstrate the involvement of SF2/ASF in translation were carried out on intronless reporters, suggesting a splicing and EJC independent function for SF2/ASF (Sanford et al., 2005; Sanford et al., 2004).
Other SR proteins have been reported to function in translation. SRp20 has been shown to function in internal ribosome entry site (IRES)-mediated translation of a viral RNA (Bedard et al., 2007), and 9G8 plays a role in translation of unspliced mRNA containing a constitutive transport element (CTE; Swartz et al., 2007).
1.3.5.3 mRNA stability There is only limited evidence for shuttling SR proteins playing a role in mRNA stability, suggesting this may be a minor function. Inhibition of SF2/ASF in chicken DT40 B cells causes a six-fold increase in PKCl-r mRNA levels; no other transcripts appear to be affected. SF2/ASF has been shown to decrease PKCl-r mRNA stability by
29 binding to a purine rich region in the 3’ UTR, suggesting that specific RNA-protein complexes involved in exporting mRNA to the cytoplasm can also influence the stability of the mRNA (Lemaire et al., 2002).
1.3.6 The role of phosphorylation in the regulation of the SR and SRrp family SR and SRrps function at multiple steps of mRNA maturation and regulation and are tightly regulated themselves. Phosphorylation of RS domain serine residues plays a major role in regulating localisation, activity and function of both SR and SRrps. Due to the multiple serine residues in RS domains there is potential for many different levels of phosphorylation to exist allowing the protein to have multiple functions (reviewed in Gourisankar et al., 2011). Three different types of protein kinase have been identified which can phosphorylate RS domains, the SR protein kinase family SRPK1 and SRPK2 (Gui et al., 1994; Wang et al., 1998), the Clk/Sty family (Colwill et al., 1996), and DNA topoisomerase I (topo I; Rossi et al., 1996).
The phosphorylation state of SR proteins changes as they are modified to participate in different functions. Phosphorylation is required for the recruitment of SR proteins from nuclear speckles to active sites of transcription (Misteli et al., 1998). Both hypo- and hyper-phosphorylation of SR proteins inhibit splicing (Mermoud et al., 1994; Sanford et al., 1999), and hyperphosphorylation results in disassembly of nuclear speckles and localisation of shuttling SR proteins to the cytoplasm (Gui et al., 1994; Caceres et al., 1998). During splicing and RNA maturation, shuttling SR proteins that form the EJC are dephosphorylated and increase their binding affinity for the RNA export protein TAP. Once in the cytoplasm they are again phosphorylated, resulting in disassociation from the mRNA/protein complex and import back into the nucleus (Huang et al., 2004; Lai and Tarn, 2004). Endogenous cytoplasmic SF2/ASF involved in RNA translation is found to be hypophosphorylated and mutations mimicking hypophosphorylation of SF2/ASF (RG repeats instead of RS) have been shown to increase binding of SF2/ASF to cytoplasmic mRNA and to increase translation (Sanford et al., 2005).
30
Nuclear import of SR proteins is mediated through the importin β related proteins transportin-SR1 (TRN-SR1) and transportin-SR2 (TRN-SR2). Phosphorylation of SR proteins by SRPK1 is required for their interaction with TRN-SR2 and subsequent nuclear import (Lai et al., 2001; Lai et al., 2000). The rare TRN-SR1 isoform also shows a dependence on RS domain phosphorylation for interaction with some proteins (Yun et al., 2003).
1.3.7 The SR and SRrp family: Important factors in gene expression The maturation and regulation of an mRNA transcript is an interdependent pathway of steps involving transcription, splicing, 5’ and 3’ end processing, nuclear export, translation and stability/degradation. Many of the processes involved are linked and regulated by the SR and SRrp family, with many individual SR and SRrps functioning in multiple steps (Fig. 1.10). As well as regulation of individual transcripts, coupling and coordination of post-transcriptional events by SR and SRrps allows for control in determining how, when, and where to translate functionally related subpopulations of mRNAs. The SR and SRrp family therefore plays an important role in the global regulation of gene expression (Keene et al., 2010).
1.4 Psc1 subcellular localisation The subcellular localisation of Psc1 suggests that it may have multiple roles within the cell, or that its function is regulated by subcellular location. Psc1 localises to speckles within the nucleus and the cytoplasm, and its protein sequence as well as localisation suggests roles in multiple steps of RNA metabolism as seen for other SR and SRrps.
1.4.1 Psc1 localises to nuclear speckles Within the nucleus Psc1 co-localises with the SR protein SC35 to sites known as nuclear speckles (reviewed in Spector and Lamond, 2011). Psc1 also shows diffuse staining throughout the nucleoplasm, excluding the nucleoli, and localisation to speckles that do not contain SC35 (Fig. 1.12; Kavanagh et al., 2005). Between 30 and
31
32
50 nuclear or “splicing” speckles are found in the nuclei of mammalian cells. They are irregularly shaped subnuclear structures that contain multiple proteins involved in pre- mRNA and mRNA processing (Lammond and Spector, 2003; Hall et al., 2006; Spector and Lamond, 2011), including SR and SRrps, snRNP complexes, and poly(A) binding protein II (PABP2/Pabpn1). Purification of nuclear speckles and proteomic analysis has identified more than 170 different proteins (Mintz et al., 1999; Saitoh et al., 2004). Nuclear speckles also contain RNA molecules, including poly(A)+ RNA, and several non-coding RNAs such as; uridine-rich small nuclear RNAs (UsnRNAs), 7SK RNA, metastasis-associated lung adenocarcinoma transcript 1 (MALAT1) and long ncRNA (lncRNA) (reviewed in Spector and Lamond, 2011). Speckles are dynamic, with their contents in continuous flux with the nucleoplasm and other nuclear locations.
At the electron microscopic level, nuclear speckles correlate with interchromatin granule clusters (IGCs) and are generally thought to be storage sites in which splicing components are assembled and/or from which they are recruited to sites of active transcription (Thiry et al., 1995). IGCs are interconnected by perichromatin fibrils (PFs) to form a network throughout the interchomatin space that facilitates the processing of pre-mRNA (reviewed in Puvion and Puvion-Dutilleul, 1996; Thiry et al., 1995). Perichromatin fibrils (PFs) are found at the periphery of condensed chromatin and in the interchromatin space, and are essentially RNP complexes containing nascent pre-mRNA and all the components involved in splicing and pre-mRNA processing. Most proteins present in nuclear speckles are also found diffuse in the nucleoplasm, correlating with PFs. Not all proteins found associated with PFs localise to nuclear speckles; these include RNA polymerase II, hnRNPs, and poly(A) polymerase. The absence of these proteins, and of nascent transcripts, within nuclear speckles argues for the idea of nuclear speckles being storage sites, from which factors are actively recruited to nearby transcription sites (reviewed in Spector and Lamond, 2011; Cmarko et al., 1999).
There is some evidence, however, that suggests an active role for speckles in gene expression (reviewed by Hall et al., 2006). Interchromatin fibrils/nascent RNPs are
33 frequently detected around interchromatin granules (Fakan et al., 1994), and active genes and gene-rich R-bands tend to associate with nuclear speckles more frequently than silent genes and gene-poor G-bands (Shopland et al., 2003). Recent demonstrations have shown that some genes become associated with nuclear speckles upon activation (Hall et al., 2006; Hu et al., 2009; Zhao et al., 2009). For example, the active allele of the mono-allelically expressed glial fibrillary acidic protein (GFAP) gene was shown to associate with speckles in 70% of cells, while the inactive allele did not (Takizawa et al., 2008). Estrogen receptor 1 (alpha) (Esr1) bound genes have been shown to be repositioned adjacent to nuclear speckles upon ligand activation by an actin/myosin dependent mechanism with the association tightly linked to maximal induction of gene expression (Hu et al., 2008). Furthermore, co-ordinately active genes tend to associate with the same nuclear speckle (Brown et al., 2008; Hu et al., 2008; Takizawa et al., 2008; Zhao et al., 2009). It has been suggested that nuclear speckles may form de novo after cell division by the recruitment of splicing factors to active genes, and the subsequent association of active genes at nuclear speckles is facilitated by chromatin dynamics (Brown et al., 2008). The signal dependent nuclear rearrangement of genes could allow genes that are rapidly activated in response to a cellular signal to achieve efficient co-transcriptional RNA processing by being in proximity to nuclear speckles (Zhao et al., 2009; Spector and Lamond, 2011). A recent study has shown that the SR protein SRSF1 and MALAT1 lncRNA can facilitate the association of several of the pre-mRNA processing factors on a chromatin locus and potentially nucleate speckle formation (Tripathi et al., 2012).
1.4.1.1 Psc1 localises to non-SC35 nuclear speckles Psc1 localises to additional nuclear speckles that do not contain SC35 (Fig. 1.12B). These Psc1-containing speckles are generally smaller than SC35 speckles, more rounded, and often found adjacent to the nuclear periphery (Kavanagh et al., 2005). Other speckled structures in the nucleus involved in RNA metabolism have been described; including paraspeckles, which function in controlling gene expression by the nuclear retention of RNA (Bond and Fox, 2009; Chen and Carmichael, 2009); Omega
34 speckles, which are thought to be storage sites for hnRNPs (Prasanth et al., 2000); and Cajal bodies, which are sites of snRNP and snoRNP storage and processing (reviewed in Machyna et al., 2013). The relationship of Psc1 speckles to these structures is unknown.
1.4.2 Psc1 localises to cytoplasmic speckles A unique characteristic of Psc1 is its dual localisation to both speckles within the nucleus and speckles within the cytoplasm. In COS-1 cells transfected with a Psc1-HA construct, approximately 50% of cells show Psc1 localising to punctate foci throughout the cytoplasm (Fig. 1.13; Kavanagh et al., 2005). These cytoplasmic speckles, or cytospeckles, vary in size from <0.1 μm to approximately 1 μm in diameter, and can number from a few, up to approximately 1000. Endogenous Psc1 cytospeckles have been observed in EPL and COS-1 cells stained with an anti-Psc1 antibody (Fig. 1.14). Psc1 cytospeckles are motile, and show directed movement within the cytoplasm, trafficking from the cytoplasm into the nucleus. In addition, cytospeckles appear to interact with one another, resulting in multiple fusion and budding events. Cytospeckles do not co-localise with endoplasmic reticulum, mitochondria, lysosomes, or the actin cytoskeleton (Kavanagh et al., 2005).
A number of SR and SRrps are known to shuttle between the nucleus and the cytoplasm, however, none of them have been found in cytoplasmic speckles. Even when overexpressed, the shuttling protein SF2/ASF did not localise to cytoplasmic speckles and was unable to be visualised in the cytoplasm (Fig. 1.15; Kavanagh et al., 2005). During development of the nematode Ascaris lumbicoid SR proteins are seen to accumulate in speckles in the cytoplasm at the 2 cell stage, prior to zygotic gene activation (ZGA; Sanford and Bruzik, 2001). These speckles have been likened to ones seen during mitosis. At the onset of mitosis, proteins normally found in nuclear speckles are distributed diffusely throughout the cytoplasm (Spector et al., 1991). During metaphase they reassemble into discrete structures called mitotic interchromatin granules (MIGs), which are thought to be the equivalent of nuclear
35
36
37
38 speckles (Thiry et al., 1993; Thiry et al., 1995). Psc1 cytospeckles are distinct from both of these cytoplasmic speckles in that they occur post ZGA, in interphase cells, and do not contain proteins such as SC35 and SF2/ASF (Kavanagh et al., 2005).
The role of Psc1 cytospeckles is currently unknown. It is possible to speculate that they function either to regulate the Psc1 protein and/or proteins with which it interacts, or that they represent cytoplasmic RNA metabolism processes that Psc1 may mediate. Punctate foci involved in cytoplasmic RNA metabolism have been described in the processes of RNA localisation for site-specific translation, translational regulation and in RNA degradation. In polarized cells such as fibroblasts, oligodendrocytes and neurons, and during early development in Drosophila and Xenopus, mRNA is often specifically located to allow rapid and localised production of a protein. The RNA is transported to these sites in RNA containing granules, large mRNP complexes which, in addition to mRNA, contain multiple proteins such as components of the translational machinery and proteins involved in transport along the cytoskeleton such as dynactin (reviewed in Anderson and Kedersha, 2006). Proteins involved in mRNA degradation, such as the decapping enzyme hDcp1 and the exonuclease hXrn1, localise to foci in the cytoplasm known as processing bodies (P bodies). P bodies function in RNA silencing pathways, 5’-3’ mRNA degradation, RNAi, and mRNA transport and stabilization (reviewed in Eulalio et al., 2007). In germ cells cytoplasmic foci closely related to P bodies exist, such as nuage, sponge bodies and polar granules. These function in the regulation of mRNA through degradation/stability and transcriptional regulation (reviewed in Barckmann et al., 2013; Voronina et al., 2011).
The subcellular localisation of Psc1 to SC35 containing nuclear speckles suggests that it is involved in RNA metabolism, and the unique localisation of Psc1 to non-SC35 nuclear speckles, and to cytospeckles, indicates potentially novel and/or multiple functions of Psc1 in the regulation of RNA.
39
1.4.3 The role of Psc1 domains in subcellular localisation The Psc1 protein contains a unique sequential arrangement of motifs and displays unique subcellular localisation. To assess the contribution of individual Psc1 motifs to localisation and trafficking, constructs were generated containing Psc1 deletion mutants and isolated domains fused to GFP (Kavanagh et al., 2005). The RS domain and the RRM were found to have the most influence on Psc1 localisation.
1.4.3.1 The Psc1 RS domain and RRM influence nuclear speckle localisation
Within the nucleus, Psc1lacking the RS domain (GFP-Psc1∆RS) showed varying degrees of diffuse nucleoplasmic localisation. Some nuclear speckles were observed, however, and these showed only partial co-localisation with SC35 (Fig. 1.16A). The Psc1 RS domain expressed on its own (GFP-RS) showed diffuse nucleoplasmic localisation, although some co-localisation with SC35 to nuclear speckles was observed (Fig. 1.16B). These results suggest that the Psc1 RS domain plays a role in the localisation of Psc1 to nuclear speckles.
In SR proteins with only one RRM, such as SC35 and SRp20, the RS domain has been shown to be both necessary and sufficient for nuclear speckle targeting (Caceres et al., 1997). Likewise the RS domains of the SRrps SWAP and Tra, which contain no RRMs, are both necessary and sufficient for nuclear speckle targeting (Li et al., 1991; Hedley et al., 1995). For SR proteins with 2 RRMs, however, such as SF2/ASF and SRp40, the RS domain is not necessary for nuclear speckle targeting, and is unable to direct a chimeric protein to nuclear speckles (Caceres et al., 1997).
The Psc1 RRM has been shown to play a role in the subnuclear localisation of Psc1. Psc1 lacking the RRM, or the RRM expressed by itself, were both able to localise to nuclear speckles (Fig. 1.16 C, D). This suggests that both the Psc1 RS domain and RRM contribute to nuclear speckle localisation, in what appears to be a semi-redundant fashion.
40
41
1.4.3.2 The Psc1 RS domain. RRM and C-domain influence Psc1 nucleo- cytoplasmic trafficking The nucleo-cytoplasmic trafficking of Psc1 is influenced by both the RS and RRM domains. When full length GFP-Psc1 is transfected into cells, around 50% of cells show nuclear and cytoplasmic localisation of Psc1, 50% show nuclear localisation, and less than 1% show localisation in the cytoplasm only. In cells transfected with GFP- Psc1RS, however, 75% show nuclear and cytoplasmic localisation of Psc1RS, 10% show nuclear only localisation and 15% show exclusive cytoplasmic localisation (Kavanagh et al., 2005). These results suggest a role for the Psc1 RS domain in nuclear import. Consistent with this, the RS domains of other proteins, such as SF2/ASF and SC35, have been shown to act as nuclear localisation signals. Nuclear import of proteins containing RS domains has been to shown to be facilitated by the TRN-SR1 and TRN-SR2 proteins. TRN-SR 1 and 2 interact directly with RS domains and facilitate nuclear import through interactions with nucleoporins (Lai et al., 2001; Yun et al., 2003).
Deletion of the Psc1 RRM affects the nuclear-cytoplasmic trafficking of Psc1. Over 99% of cells transfected with GFP-Psc1RRM show exclusive nuclear localisation of Psc1RRM (Fig. 1.17A). The Psc1 RRM domain expressed alone (GFP-RRM) showed cytoplasmic localisation in 22% of transfected cells, and co-localised with cytospeckles containing full length Psc1 (Fig. 1.17B). This suggests that the Psc1 RRM regulates Psc1 localisation to the cytoplasm, and that Psc1 localisation to the cytoplasm and to cytospeckles is dependent on, or is regulated by, interaction with RNA binding partners. This supports the hypothesis that cytospeckles may be RNP complexes.
Mutational studies of the Psc1 C-domain have demonstrated a role for this domain in the regulation of Psc1 subcellular localisation. Deletion of the Psc1 C-domain results in increased cytoplasmic localisation of Psc1 with around 85% of cells showing nuclear and cytoplasmic localisation. The C-domain expressed on its own partially co-localises with microtubules (Fig. 1.17C). This suggests that the motility of Psc1 cytospeckles
42
43 that has been observed may rely on trafficking by an interaction of the C-domain with the microtubule network (Kavanagh et al., 2005).
1.5 Hypotheses and Aims Psc1 is an SRrp that is potentially involved in a number of aspects of RNA metabolism. The subcellular localisation of Psc1 to nuclear and cytoplasmic speckles is unique, and suggests a function for Psc1 not yet associated with other SRrp. The work presented in this thesis aims to characterise further the Psc1 gene and protein, the expression of Psc1 protein in early mammalian development, and to identify potential functions of Psc1 through identification of Psc1 interacting proteins.
This thesis examines the hypotheses that: A: Alternative Psc1 transcripts are generated allowing for regulation of Psc1 function. Specifically this thesis aims to: Determine the Psc1 genomic structure and to identify Psc1 splice variants, both from databases and experimentally (Chapter 3) Investigate the complexity of Psc1 transcripts by characterising the three transcripts previously identified by northern blot analysis (Chapter 3) (Schulz, 1996; Pelton et al., 2002) B: Psc1 protein will be down regulated as ES cells differentiate. Specifically this thesis aims to: Use a previously generated Psc1 specific antibody to characterise the expression of Psc1 protein during development using the ES-EBM cell model (Chapter 4) C: Psc1 protein will interact with other proteins involved in RNA metabolism. Specifically this thesis aims to: Characterise Psc1 function by identification of Psc1 interacting proteins using a candidate approach, testing of proteins thought to be likely to interact because of function or subcellular localisation (Chapter 5), and through performing a yeast two hybrid screen (Chapter 6).
44
CHAPTER 2
MATERIALS AND METHODS
45
CHAPTER 2: MATERIALS AND METHODS
2.1 Abbreviations Ac acetate Ade L-Adenine hemisulfate salt. AP alkaline phosphatase APS ammonium persulphate ARRS Acidic Rich RS domain family of proteins AS-NMD alternative splicing dependent NMD ATP adenosine triphosphate BCIG 5-bromo-4-chloro-3-indolyl-β-D-galactoside BCIP 5-bromo-4-chloro-3-indolyl-phosphate βME β-mercaptoethanol bp base pair BSA bovine serum albumin CFIm Cleavage Factor Im Ci curie cpm counts per minute CPSF cleavage and polyadenylation specificity factor CTD C-terminal domain CTE constitutive transport element da Daltons d.p.c. days post coitum dATP deoxyadenosine triphosphate dCTP deoxycytosine triphosphate dGTP deoxyguanosine triphosphate DMEM Dulbecco’s modified Eagle medium DMSO dimethylsulfoxide DNA deoxyribonucleic acid DNAse deoxyribonuclease 46 dNTP deoxynucleotide triphosphate DTT dithiothreitol EBM embryoid bodies grown in MEDII E. coli Escherichia coli ECF enhanced chemi-fluorescence ECL enhanced chemi-luminescence EDTA ethylenediaminetetra-acetic acid EGFP enhanced green fluorescent protein EJC exon junction complex EPL cell early primitive ectoderm like cell ES cell embryonic stem cell ESE exonic splicing enhancers EST expressed sequence tag EtBr ethidium bromide FCS foetal calf serum FITC fluorescein isothiocynate g gram GFP green fluorescent protein GWBs Glycine- and tryptophan-rich cytoplasmic processing bodies HA Hemagglutinin (HCD)-MS (Higher energy collisional dissociation)-Mass spectrometry HEPES N-2-hydroxyethyl piperazine-N-ethane sulphonic acid h hour His L-Histadine HCl hnRNP Heterogeneous ribonucleoprotein particle HRP horse radish peroxidase IGC Interchromatin granule clusters ICM Inner Cell Mass IMVS Institute of Medical and Veterinary Science IP immunoprecipitation IPTG isopropyl-β-D-thiogalactopyranoside
47
IRES Internal ribosome entry site kb kilobase pair kDa kilodalton l Litre LB luria broth Leu L-Leucine LiAc Lithium acetate LIF leukaemia inhibitory factor lncRNA long non-coding RNA M molar MALDI-TOF MS Matrix-assisted laser desorption/ionization-Time of Flight Mass spectrometry MIGs mitotic interchromatin granules min minutes miRNA microRNA mM millimolar MOPS 3-[N-morpholino]propane sulphonic acid MQ H2O reverse osmosis filtered water passed through a Milli-Q™ ion- exchange matrix mRNA messenger RNA mTOR mammalian target of rapamycin MVB multivesicular bodies NMD nonsense mediated decay NOPdp Nucleolar proteome database NP-40 nonidet-P 40 nt nucleotide ODn optical density at a wavelength of n nm O-GlcNac O-linked N-Acetylglucosamine OGA O-GlcNAcase OGT uridine diphospho-N-acetylglucosamine:polypeptide beta-N- acetylglucosaminyltransferase
48
OPMD oculopharyngeal muscular dystrophy PAGE polyacrylamide gel electrophoresis PAP Poly(A) polymerase PBS phosphate buffered saline PBT phosphate buffered saline + 0.1% Tween-20 PCR polymerase chain reaction PEG polyethylene glycol PFA paraformaldehyde PFs Perichromatin fibrils PMSF phenylmethylsulfonyl fluoride poly(A) polyadenosine PTC premature termination codon RBPs RNA binding proteins RBD RNA binding domain rDNA Ribosomal DNA RISC RNA-induced silencing complex RNA ribonucleic acid RNase ribonuclease RNAi RNA interference RNAPII RNA polymerase II RNAsin ribonuclease inhibitor RNP Ribonucleoprotein rNTP ribonucleotide triphosphate RP retinitis pigmentosa r.p.m. revolutions per minute RRM RNA recognition motif RT room temperature RUST regulation by unproductive splicing and translation s seconds SAP Shrimp Alkaline Phosphotase sca-RNA small Cajal body-specific RNA
49
SD Buffer standard digest buffer SD media synthetic dropout media SDS sodium dodecyl phosphate SG Stress granule siRNA small interfering RNA snoRNA small nucleolar RNA snoRNP small nucleolar ribonucleoprotein snRNA small nuclear RNA snRNP small nuclear ribonucleoprotein particle SRrp SR related protein ssDNA single stranded DNA TAE Tris acetate EDTA TBE Tris borate EDTA TBS tris buffered saline TBST tris buffered saline + Tween-20 TEMED N, N, N', N'-teramethyl-ethenediamine TOP Terminal oligopyrimidine tract TRITC Tetramethylrhodamine B isothiocyanate Trp L-Tryptophan TTP Tristetraprolin Tween-20 polyoxyethylenesorbitan monolaurate U unit UAS upsteam activation sequence uORF upstream open reading frame UTR Untranslated region UV ultra violet V volts v volume w weight ZGA Zygotic gene activation
50
2.2 Materials
2.2.1 Chemicals and Reagents BDH Chemicals: APS, NP-40 AND phenol Bio-Rad: Affiprep 10, Bradford Reagent, Coomassie Brilliant Blue CLONTECH: Lyticase, Herring testes DNA, AH109 Yeast Invitrogen Life Technologies: TRIzol reagent Merck: PFA National Diagnostics: Sequagel 6 AND Protogel. PE Biosystems: Big Dye terminator mix Pierce: Super SignalTM Chemilimunesence Substrate, West pico luminol/enhancer - peroxide solutions Promega: dNTPs Roche: BCIG, BCIP, DTT, glycogen, ssDNA, IPTG, and 10x transcription buffer, EDTA-Free completeTM protease inhibitor tablets. FuGENE 6, ECF alkaline phosphatase substrate, Protein A agarose. Sigma: agarose, ampicillin, BSA, EtBr, EDTA, kanamycin, MOPS, PMSF, rATP, rGTP, rCTP, rUTP, SDS, TEMED, Tris base, Hoechst-33258, Tween-20. Tel-test: RNAzol B
2.2.2 Radiochemicals Perkin Elmer: α-32P dATP, α-32P rUTP
2.2.3 Kits DECAprimeTM II Randomly Primed DNA Labeling Kit: Ambion Gel purification kit: GeneWorks Gel Extraction kit: Qiagen Miniprep kit: Geneworks
51
MATCHMAKER GAL4 Two-Hybrid System 3: CLONTECH Omniscript reverse transciption kit: Qiagen Quantum Prep Plasmid Midiprep kit: Bio-Rad RPA III Ribonuclease Protection Assay kit: Ambion UltraClean Mini Plasmid prep kit: Mobio
2.2.4 Enzymes Restriction endonucleases were supplied by Pharmacia, New England Biolabs and GeneWorks. Other enzymes were obtained from the following sources:
Roche: DNAse 1, RNAse T1, T7 RNA polymerase Geneworks Ltd: Escherichia. coli DNA polymerase I (Klenow fragment), RNAsin, T4 DNA ligase and buffer Invitrogen: Platinum Taq PCR Supermix: Sigma: RNAse A, RNAse T1 Stratagene: Pfu Turbo polymerase Promega: T7 and SP6 RNA polymerases, SAP
2.2.5 Buffers and Solutions 2x SDS load buffer: 125 mM Tris HCl pH 6.8, 4% (v/v) SDS, 20% (v/v) glycerol, 0.1% (w/v) bromophenol blue, 5% (v/v) β-mercaptoethanol 4x lower buffer: 1.5 mM Tris pH 8.8, 0.4% SDS 4x Tris-SDS buffer: 1.5 M Tris HCl pH 8.8, 0.4% (w/v) SDS 10x GLB: 50% (v/v) glycerol, 0.1% (w/v) SDS, 500 µg/µl bromophenol blue, 500 µg/µl xylene cyanol 10x MOPS buffer: 0.4 M MOPS, free acid; 0.1 M Na-acetate; 10 mM EDTA, adjusted to pH 7.2 10x SD buffer: 30 mM Tris-HAc pH 7.8, 625 mM KAc, 100 mM MgAc, 40 mM spermidine, 5 mM DTE 20x SSC buffer: 3M NaCl; 0.3 Na-citrate
52
Buffer A: 10 mM HEPES pH 8.0, 80 mM KCl, 1 mM DTT, 1.5 mM MgCl2
Buffer B: 0.3 M HEPES pH 8.0, 1.4 M KCl, 30 mM MgCl2
Buffer C: 20 mM HEPES pH 8.0, 0.6 mM KCl, 1.0 mM DTT, 1.5 mM MgCl2, 0.2 mM EDTA, 25% (v/v) Glycerol, 0.5 mM PMSF Buffer D: 20 mM HEPES pH 8.0, 100 mM KCl, 1.0 mM DTT, 0.2 mM EDTA, 20% (v/v) glycerol, 0.5 mM PMSF
Church buffer: 1 mM EDTA, 0.5 M NaPO4 pH 7.5, 7% SDS Coomassie Brilliant Blue stain: 1 g Coomassie brilliant blue in 1 L 50% Methanol (v/v), 10% Glacial acetic acid (v/v). Coomassie Brilliant Blue destain: 40% Methanol (v/v), 10% Glacial acetic acid (v/v). Ficoll loading buffer: 1 x MOPS, 6.85% formaldehyde, 50% deionised formamide, 4% Ficoll, bromophenol blue. IP lysis buffer: 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 10% (v/v) glycerol, 1% Triton X-100, 10 mM EDTA. To this add complete protease inhibitor cocktail tablet (Roche) and PMSF. Lysis Buffer: 50 mM Tris-HCl pH7.5, 150 mM NaCl, 10% (v/v) glycerol, 1% Triton X-100, 10 mM EDTA, 200 µM Na-orthovanadate, 1 complete protease inhibitor tablet (Roche) NP-40 Lysis Buffer: 50 mM Tris HCl pH 7, 150 mM NaCl, 1% (v/v) NP-40, 1 mM PMSF, 1 mM EDTA
PBS: 136 mM NaCl, 2.6 mM KCl, 1.5 mM KH2PO4, 8 mM Na2HPO4 pH 7.4. PBT: PBS + 0.1% (v/v) Tween-20
PFU buffer: 20 mM Tris-HCl pH 8.8, 2 mM MgSO4, 10 mM (NH4)2SO4, 100 ng/ml BSA, 0.1% Triton X-100, RNA load buffer: 95% (v/v) deionised formamide, 20 mM EDTA, 0.02% (w/v) bromophenol blue, 0.02% (w/v) xylene cyanol SAP buffer: 50 mM Tris-HCl pH9.0, 10 mM MgCl SDS-PAGE buffer: 25 mM Tris-Glycine, 0.1% (w/v) SDS
Sucrose solution buffer: NaCl 150 mM, Tris HCl 50 mM, MgCl2 5 mM TAE: 40 mM Tris-acetate, 20 mM NaAc, 1 mM EDTA, pH8.2 TBE: 90 mM Tris, 90 mM boric acid, 2.5 mM EDTA, pH 8.3
53
TBS: 25 mM Tris HCl pH 8, 150 mM NaCl TBST: TBS + 0.1% (v/v) Tween-20 TE: 10 mM Tris HCl pH 7.5, 1 mM EDTA TEN Buffer: 40 mM Tris HCl pH 7.4, 1 mM EDTA, 150 mM NaCl
Tfb 1: 30 mM KAc, 100 mM RbCl, 10 mM CaCl2, 15% (v/v) glycerol, pH 5.8 (adjusted with 0.2 M acetic acid)
Tfb 2: 10 mM MOPS, 75 mM CaCl2, 10 mM RbCl, 15% (v/v) glycerol, pH 6.5 (adjusted with 1 M KOH)
Transcription Buffer: 40 mM Tris HCl pH 8, 6 mM MgCl2, 2 mM spermidine, 10 mM DTT Western Transfer buffer: 192 mM glycine, 25 mM Tris HCl pH 8.3, 0.1% (w/v) SDS, 20% (v/v) methanol.
2.2.6 Yeast two hybrid Buffers and Solutions YPD medium: 20 g/L Difco peptone, 10 g/L Yeast extract, 2% glucose, (20 g/L Agar for plates), pH 5.8. 1x TE/LiAc soloution: 1X TE buffer (10 mM Tris-HCl, 1 mM EDTA pH 7.5), 100 mM LiAc pH 7.5. PEG/LiAc solution: 1 X TE/LiAc soloution, 40% PEG 4000 Lyticase solution: 5 units/µl in TE buffer SD media: 6.7 g/L Yeast nitrogen base without amino acids, 10% 10x appropriate dropout solution (specific mixture of amino acids), (20 g/L Agar for plates), 2% Glucose. 10X Dropout supplements: Complete amino acid mix: 300 mg/L L-Isoleucine, 1500 mg/L L-Valine, 200 mg/L L-Adenine hemisulfate salt, 200 mg/L L-Arginine HCL, 200 mg/L L-Histidine HCl monohydrate, 1000 mg/L L-Leucine, 300 mg/L L-Lysine HCl, 200 mg/L L- Methionine, 500 mg/L Phenylalanine, 2000 mg/L L-Threonine, 200 mg/L L- Tryptophan, 300 mg/L L-Tryrosine, 200 mg/L L-Uracil. SD/-Trp/-Leu: Complete amino acid mix lacking L-Tryptophan and L-Leucine
54
SD/-Trp/-Leu/-His: Complete amino acid mix lacking L-Tryptophan, L-Leucine and L-Histidine HCl SD/-Trp/-Leu/-His/-Ade: Complete amino acid mix lacking L-Tryptophan, L- Leucine, L-Histadine HCl and L-Adenine hemisulfate salt. Cracking buffer stock solution: 8 M Urea, 5% w/v SDS, 40 mM Tris-HCl (pH6.8), 0.1 mM EDTA, 0.4 mg/ml Bromophenol blue. Cracking buffer complete: Prepare immediately before use. 1 ml Cracking buffer stock solution, 10 µl β-mercaptoethanol, 70 µl Protease inhibitor solution (0.1 mg/ml Pepstatin A, 0.03 mM Leupeptin, 145 mM Benzamidine, 0.37 mg/ml Aprotinin), 50 µl 100x PMSF.
2.2.7 Plasmids pBS-Hrs (a kind gift from Dr Kitamura; Komada and Kitamura, 1995) pEGFP-C2 (Clontech) pEGFP-Pabpn1 (a kind gift from Dr Calado; Calado et al., 2000a) pEGFP-Psc1; Psc1 nt 103-3512 3’ of GFP in pEGFP (Kavanagh et al., 2005) pEGFP-Psc1 domains (N-domain, RS, Zn-finger, RRM, C-domain; Kavanagh et al., 2005) pEGFP-Psc1 domain mutants (ΔN-domain, ΔRS domain, ΔZn-finger, ΔRRM, ΔC- domain; Kavanagh et al., 2005) pEGFP-SC35 (Kavanagh et al., 2005) pEGFP-SF2 (Kavanagh et al., 2005) pGBKT7 (CLONTECH) pGADT7 (CLONTECH) pGEM-T Easy vector system I (Promega) pXMT2 (Rathjen et al., 1990)
2.2.8 Oligonucleotides DNA primers were synthesised by GeneWorks Ltd.
55 eIF4Heco5':GAATTCCCAGCCATGCATCATCACCACCATCACGCGGACTTCG ATACCTACGAC eIF4Heco3': GAATTCTCATTCTTGCTCCTTCTGAAC eIF4H FLAG5': GCGGACTTCGATACCTACGAC eIF4H FLAG3': GAATTCTCATTCTTGCTCCTTCTGAAC HRS5': TATGAATTCCCAGCCATGGGGCGAGGGAGCGGCACCTTCGAG HRS3':TTAGAATTCTCACTTGTCATCGTCGTCCTTGTAGTCGTCAAAGGAGA TGAGGCTGGGC Psc1#1: TCCCCCGGGGATGCTCATAGAAGATGTG Psc1#2: AGGCCCGGGTCATCTTCGCCACGAACGAGA Psc1mutN: CGCCTTCCCTGCACCTATACTAAGAACTAC Psc1094 (5'): TGCCAAGTATGATTCCTTTCC Psc1624 (3'): ATTAACTGAAACAGGAACTGG Sart1atg: GGTACCATGGGGTCGTCAAAGAAGCACCGTG Sart5'flag2:GGGGTACCATGGACTACAAGGACGAGATGACAAGGGGTCGTCA AAGAAGCACCGTGG Sart3'kpn2: GGGGTACCTCATTTGGTGATGGTGTTCGCATTCATGCTC 3'UTRA: CACCAAAGGCCGTGACTTTAC (BP338 START) 3'UTRB: GCCAGTAGTAACTCTGTCCCC
OGlcNac mutagenesis primers: mut484-497B: TTCCAGGACTACTCTCTGGATGACAATATT mut484-497AA: TATTGTCATCCAGAGAGTAGTCCTGGAA PscT497AB: GGACTACTCTGGCGACGTTGCTA PscT497AA: TAGCAACGTCGCCAGAGTAGTCC PscS494AB: TGGTGACGTTGGCATTAACTGAA PscS494AA: TTCAGTTAATGCCAACGTCACCA PscS491AB: TGCTATTAACTGCAACAGGAACT PscS491AA: AGTTCCTGTTGCAGTTAATAGCA PscT484AB: CTGGTGGTTCAGCCTGGATGACA PscT484AA: TGTCATCCAGGCTGAACCACCAG
56
2.2.9 Antibodies Antibodies were used for western blot (W), immunoprecipitation (IP), and immunofluorescence (IF) at the following dilutions:
Primary antibodies: Goat anti-alpha actin: Santa Cruz Biotechnology (W 1:1000) Goat anti-Coilin: Santa Cruz Biotechnology (IF 1:100) Mouse anti-FLAG monoclonal: Sigma (W 1:500; IP 3 µl; IF 1:500) Mouse anti-GW182 monoclonal: a kind gift from Dr Martin Friztler (IF neat) Mouse anti-HA 12CA5 monoclonal: a kind gift from Dr S Dalton (W 1:2000; IP 5 µl; IF 1:1000) Mouse anti O-GlcNAc: Affinity BioReagents (W 1:2000) Rabbit anti-FLAG: Sigma (W 1:1000; IP 3 µl; IF 1:3000) Rabbit anti-GFP: Sigma (W 1:5000; IP 0.5 µl) Rabbit anti-p110 (Sart1 amino acids 667-800): a kind gift from Reinhard Lührmann (W 1:2000; IP 1 µl; IF 1:2000) Rabbit anti-Psc1: Kavanagh 2005 (W 1:500; IP 5 µl; IF 1:300) Rabbit anti-S6 Ribosomal protein: Cell Signaling Technology (IF 1:200)
Secondary antibodies: Goat anti-mouse IgG - HRP conjugate: DAKO (W 1:2000) Goat anti-mouse IgG - TRITC conjugate: Sigma (IF 1:4000) Goat anti-mouse-AP: Rockland (W 1:2000) Goat anti-rabbit-AP: Rockland (W 1:2000) Goat anti rabbit IgG Alexa Fluor 488: Molecular Probes (IF 1:400) Goat anti-rabbit IgG - FITC conjugate: Sigma (IF 1:1000) Goat anti-rabbit IgG - HRP conjugate: DAKO (W 1:2000) Goat anti-rabbit IgG - TRITC conjugate: Sigma (IF 1:4000) Rabbit anti-goat Cy3: Sigma (IF 1:1000) Rabbit anti-mouse IgG - FITC conjugate: DAKO (IF 1:2000)
57
2.2.10 Bacterial Strains DH5α strain E. coli were used for chemical heat shock transformations and were stored at -80°C in 50% glycerol.
2.2.11 Bacterial Growth Media Luria broth: 1% (w/v) Bacto-tryptone, 0.5% (w/v) yeast extract, 1% (w/v) NaCl, adjusted to pH 7.0 with NaOH. Solid Media: Agar plates were prepared by supplementing the above media with 1.5% Bacto-agar.
Growth media were prepared in MQ water and sterilised by autoclaving. Ampicillin (100 µg/ml) or kanamycin (25 µg/ml) was added after the medium cooled to 55°C to maintain selective pressure for recombinant plasmids in transformed bacteria.
2.2.12 DNA Markers EcoRI digested SPP-1 bacteriophage DNA markers were purchased from Geneworks. Band sizes (kb): 8.51, 7.35, 6.11, 4.84, 3.59, 2.81, 1.95, 1.86, 1.51, 1.39, 1.16, 0.98, 0.72, 0.48, 0.36.
DNA fragment sizes and approximate concentrations were determined by loading agarose gels with 500 ng marker DNA.
2.2.13 Protein Markers Benchmark prestained protein ladder was purchased from Invitrogen. Band sizes were variable between batches and are indicated on figures.
2.2.14 Miscellaneous Materials 3 mm chromatography paper: Whatman Ltd.
58
Freezing vials: Nunc Inc Imaging plate: Fujifilm Nylon membrane: Millipore Protran nylon: Schleicher and Schuell Sephadex spin column: Sigma Tissue culture grade plates and flasks: Falcon, Corning X-ray film: Fuji or Konica
2.2.15 Websites http://biodata.mshri.on.ca/flygrid http://expasy.org/tools/findmod/ http://regrna.mbc.nctu.edu.tw http://www.ncbi.nlm.nih.gov www.fccc.edu/research/labs/golemis/interationTrapInWork.html www.lamondlab.com/NOPdb www.ncbi.nlm.nih.gov/UniGeneMm.329400
59
2.3 Molecular Methods
2.3.1 Vector Construction All constructs were sequenced using big dye terminator (BDT) automated sequencing (section 2.3.2.10). All primer sequences are listed in section 2.2.8. Psc1 O- GlcNac deletion mutants were generated using Quikchange site-directed mutagenesis (Stratagene). pEGFP-eIF4H: Full length mouse eIF4H was amplified by PCR using primers eIF4H eco5' and eIF4H eco3', and mouse ES cell cDNA. The product was cloned into pGEMT Easy and subcloned into pEGFP after digestion with EcoRI. pEGFP-Hrs: Mouse Hrs was amplified by PCR using primers HRS5' and HRS3', and pBS-Hrs as the template DNA (a kind gift from Dr Kitamura; Komada and Kitamura, 1995). The product was cloned into pGEMT Easy and subcloned into pEGFP using EcoRI sites. pEGFP-Psc1O-GlcNAc mutants: O-GlcNAc mutants in which the serine/threonine residues between amino acids 477-498 were replaced with alanine (T484A, S491A, S494A, T497A) and a mutant lacking the entire region between amino acids 483 and 498, removing all four serine/threonine residues (∆484-497) were constructed using Quikchange site-directed mutagenesis kit (Stratagene) as per the manufacturer’s instructions. GFP-Psc1 was used as the template vector and primer pairs are as follows: (mut484-497B : mut484-497A), (PscT497AB : PscT497AA), (PscS494AB: PscS494AA), (PscS491AB: PscS491AA), (PscT484AB: PscT484AA). pGADT7-Psc1: The yeast two hybrid activation domain-Psc1 construct was generated by PCR amplification of the Schulz Psc1 coding sequence (3015 nt), excluding both 5’ and 3’ UTR sequences, using primers Psc1#1 and Psc1#2, and EGFP-Psc1 as the template. The 3015 nt product was cloned into pGEMT Easy and subcloned into pGADT7 using the SmaI site.
60
pGADT7-SC35: SC35 was excised from the pEGFP-SC35 construct (Kavanagh et al., 2005) with EcoR1 and BamH1 and ligated into EcoR1/BamH1 digested pGADT7. pGADT7-SF2/ASF: SF2/ASF was excised from the pEGFP-SF2 construct (Kavanagh et al., 2005) with EcoR1 and BamH1 and ligated into EcoR1/BamH1 digested pGADT7. pGBKT7-Psc1: The yeast two hybrid binding domain-Psc1 construct was generated by PCR amplification of the Schulz Psc1 coding sequence (3015 nt), excluding both 5’ and 3’ UTR sequences, using primers Psc1#1 and Psc1#2, and EGFP-Psc1 as the template DNA. The 3015 nt product was cloned into pGEMT Easy and subcloned into pGBKT7 using the SmaI site. pGBKT7-Psc1 Δ N-domain: Yeast two hybrid binding domain-Psc1 construct lacking the N- domain was generated by PCR using primers Psc1mutN and Psc1#2, and the pEGFP-Psc1 construct (Kavanagh et al., 2005) as the DNA template. The product was cloned into pGEMT Easy and subcloned into the XmaI site of pGBKT7. pGBKT7-Psc1 Δ RS domain: Yeast two hybrid binding domain-Psc1 construct lacking the RS- domain was generated by PCR using primers Psc1#1 and Psc1#2, and the pEGFP-Psc1 Δ RS-domain construct (Kavanagh et al., 2005) as the DNA template. The product was cloned into pGEMT Easy and subcloned into the SmaI site of pGBKT7. pGBKT7-Psc1 Δ C-domain: Yeast two hybrid binding domain-Psc1 construct lacking the C- domain was generated by PCR using primers Psc1#1 and Psc1#2, and the pEGFP-Psc1 Δ C-domain construct (Kavanagh et al., 2005) as the DNA template. The product was cloned into pGEMT Easy and subcloned into the SmaI site of pGBKT7.
61 pGEMT-exon9probe: The sequence used to generate an RNAse protection probe for exon 9 was amplified by PCR using primers Psc1094 and Psc1624, and pEGFP-Psc1 as template DNA. The PCR product was ligated into pGEMT Easy. pGEMT-Psc1 3'UTR: A 754 nt fragment of the Psc1 3'UTR (bp 3386-4119 of the predicted genomic sequence) was amplified by PCR using primers 3'UTRA and 3'UTRB, and ES cell cDNA. The product was ligated into pGEMT Easy. pXMT2-FLAG-eIF4H: Full length mouse eIF4H with an N terminal FLAG sequence was amplified by PCR using primers eIF4H FLAG5' and eIF4H FLAG3', and mouse ES cell cDNA. The product was cloned into pGEMT Easy and subcloned into pXMT2 using EcoRI digestion. pXMT2-FLAG-Sart1: Sart1 was amplified by PCR using primers Sart1atg and Sart3'kpn2, and pACT2-Sart1 (testis cDNA library clone #8 that contained full length Sart1) as template DNA. The product was cloned into pGEMT Easy, and this vector was used as the template for PCR to introduce a 5' FLAG tag using primers Sart5'flag2 and Sart3'kpn2. The product was cloned into pGEMT Easy and then subcloned into pXMT2.
2.3.2 DNA Methods
2.3.2.1 Restriction endonuclease digestion of DNA Plasmid DNA was digested with 4 U enzyme per 1 µg DNA and incubated at the appropriate temperature for 1-6 hours. All restriction digestions were carried out in 1 x SD buffer, or the recommended New England Biolabs (NEB) buffer.
62
2.3.2.2 Agarose gel electrophoresis Agarose gel electrophoresis was carried out using horizontal mini-gels by pouring 10 ml gel solution (1% w/v agarose in 1 x TAE) onto a 7.5 cm x 5.0 cm glass microscope slide. Agarose mini-gels were flooded in TAE buffer and samples containing GLB were electrophoresed at 100 mA for up to 1 hour. DNA was stained with EtBr, visualised by exposure to medium wavelength UV light and photographed using a Tracktel thermal imager.
2.3.2.3 Gel Purification of linear DNA fragments Linear DNA fragments were run on appropriate percentage TAE agarose gels and visualised under long wavelength UV light. Bands were dissected using sterile scalpel blades and purified using a Gel purification kit (GeneWorks) according to the manufacturer’s instructions.
2.3.2.4 Phenol/Chloroform purification of linear DNA fragments
To purify digested DNA, sample volume was made up to 400 µl in H2O, and 200 µl phenol and200 µl chloroform were added. Samples were vortexed for 2 minutes, then centrifuged for 3 minutes at 14 K. The upper aqueous layer was removed to a fresh tube and 400 µl chloroform added. Samples were vortexed and centrifuged again and the upper aqueous layer removed to a fresh tube. 10% volume 3 M NaAc pH 4.6, 1 µl glycogen, and 2.5 x volume 100% ethanol were added. Samples were vortexed, then placed at -80°C for 30 minutes. Samples were centrifuged for 20 minutes at 14 K, and
DNA pellets washed in 70% ethanol prior to resuspension in H2O.
2.3.2.5 Removal of 5´ phosphate groups from vector DNA fragments Restriction enzyme digested vector DNA was dephopsphoylated at the 5' overhang with 1 unit of shrimp alkaline phosphatase (SAP) per 1 µg of DNA in 1x SAP buffer. The sample was incubated for 15-30 minutes at 37°C and the enzymes were inactivated by heating to 65°C for 15 minutes.
63
2.3.2.6 Ligation reactions Complementary end ligation reactions were carried out with DNA fragment and vector at a molar ration of 3:1 in the presence of 1 x T4 ligation buffer and 2 units of T4 DNA ligase (Geneworks). Reactions were incubated at RT overnight.
2.3.2.7 cDNA synthesis Reverse transcription was carried out using Omniscript reverse transcription kit (Qiagen) according to the manufacturer's instructions.
2.3.2.8 PCR with Taq polymerase PCR reactions using Platinum Taq PCR supermix (Invitrogen) were carried out following the manufacturer’s instructions. 1 µl of cDNA or 10 ng plasmid DNA, and 100 ng of each primer were used in 35 µl reaction volume. PCR was carried out in a PTC-100 hot bonnet thermal cycler.
2.3.2.9 PCR with Pfu polymerase PCR reactions using Pfu Turbo (Stratagene) were carried out according to the manufacturer’s instructions. 25 µl PCR reactions containing 1 µl cDNA or 10 ng plasmid DNA, 100 ng of each primer, 1 µl of 10 mM dNTPs, 1x PFU buffer and 1 U Pfu Turbo polymerase were denatured at 94°C for 3 minutes, and cycled in a PTC-100 hot bonnet thermal cycler.
Site directed PCR mutagenesis was carried out using Quikchange site-directed mutagenesis protocol (Stratagene) using appropriate oligonucleotides and Pfu turbo polymerase.
64
2.3.2.10 Automated sequencing of plasmid DNA 1 µg of plasmid DNA was combined with 100 ng sequencing primer and Big Dye terminator mix (PE Biosystems) in a total volume of 20 µl. The reaction was cycled through the following steps 30 times. Step 1: 96°C for 30 s Step 2: 50°C for 15 s Step 2: 60°C for 4 min 80 µl 75% isopropanol was added to reactions, mixed and allowed to precipitate for 15 minutes - 4 hours at RT. DNA was pelleted for 20 minutes at 14,000 rpm, washed in 250 µl 75% isopropanol, centrifuged again for 5 minutes and air dried. DNA was sequenced at the Institute for Medical and Veterinary Science Sequencing Centre (IMVS), Adelaide, Australia and viewed on the Editview program (PE Biosystems).
2.3.3 Bacteria
2.3.3.1 Preparation of RbCl2 competent cells A single colony of DH5α E coli strain bacteria was cultured in 5 ml of Luria Broth (LB) and grown overnight at 37°C with shaking. 1 ml of overnight culture was subcultured into 30 ml of LB. The culture was grown at 37°C to OD600= 0.6. 10 ml of culture was subcultured into 200 ml LB and grown to OD600 = 0.6 at 37°C with shaking. Cells were poured into 40 ml Oakridge tubes and chilled on ice for 5 minutes prior to centrifugation at 6000 rpm for 5 minutes at 4°C. The supernatant was aspirated and the cell pellet was resuspended in 20 ml TFB1, left on ice for 5 minutes and centrifuged at 6000 rpm for 5 minutes at 4°C. The supernatant was aspirated and the pellet was resuspended in 2 ml TFB2. After 15 minutes on ice 100 µl aliquots were snap frozen in a dry ice/ethanol bath and stored at –80°C.
2.3.3.2 Bacterial heat shock transformation
RbCl2 competent DH5α cells were thawed on ice for 5 minutes. 50 µl aliquots were mixed with DNA (approximately 10 ng of plasmid DNA) and incubated on ice for 30
65 minutes. The cell/DNA mixture was heat shocked for 2 minutes at 42°C and mixed with 1 ml LB. Cells were allowed to recover by incubation at 37°C for 30 minutes and were pelleted by brief centrifugation in a microfuge at maximum speed. The majority of the LB was removed, leaving around 100 µl. Cells were resuspended and plated on LB plates containing 100 µg/ml of the appropriate antibiotics. When using pGEMT Easy vector, 20 µl BCIG (50 mg/ml dissolved in dimethyl formamide) and 50 µl IPTG (50 mg/ml) were spread onto plates for colour selection of bacteria containing recombinant plasmids, prior to plating bacteria.
2.3.3.3 Mini-preparation of plasmid DNA A single bacterial colony was cultured in 2 ml of LB containing the appropriate antibiotic and grown overnight at 37°C in a rotating drum. The culture was poured into a 1.5 ml eppendorf tube and centrifuged at maximum speed for 1 minute. Plasmid DNA was obtained using the Geneworks Mini Prep Kit, or the MOBIO UltraClean Mini Plasmid Preparation Kit according to the manufacturer's instructions.
2.3.3.4 Midi-preparation of plasmid DNA A single bacterial colony was cultured in 25 ml LB containing the appropriate antibiotics in a 250 ml flask and grown overnight at 37 °C with shaking. The culture was transferred to a 40 ml Oakridge tube and centrifuged in an SS-34 rotor at 6,000 rpm for 10 min at 4 C in a Sorvall RC-5B centrifuge. Plasmid DNA was obtained using the Bio-Rad Plasmid MidiPrep Kit according to the manufacturer's instructions.
2.3.4 RNA methods
2.3.4.1 RNA isolation RNAzol B: Total RNA was isolated from cells using RNAzolTM B (Teltest) according to manufacturer's instructions. Cells grown in suspension were pelleted and resuspended
66 in 0.2 ml RNAzol B per 106 cells. Adherent cells were lysed in the culture dish through addition of 1 ml RNAzol B per 10 cm2 dish surface area. Lysate was pipetted up and down to solubilize the RNA. To extract the RNA, 0.1 ml chloroform per ml of homogenate was added, samples were mixed vigorously for 15 seconds by shaking, and then placed on ice for 5 minutes. Samples were then centrifuged at 14,000 rpm for 15 minutes at 4°C. The upper aqueous phase was transferred to a new tube along with an equal volume of isopropanol and incubated at 4°C for 15 minutes. Samples were then centrifuged for 15 minutes at 14,000 rpm at 4°C. The RNA pellet was washed with 75% ethanol, air dried on ice for 15 minutes, and resuspended in MQ H2O. RNA concentration was determined by A260/280 measurement and RNA quality was confirmed by agarose gel electrophoresis.
TRIzol: Total RNA was isolated from cells using TRIzol reagent (Life Technologies) according to manufacturer's instructions. Cells grown in suspension were pelleted and resuspended in 0.2 ml TRIzol per 106 cells. Adherent cells were lysed in the culture dish through addition of 1 ml TRIzol per 10 cm2 dish surface area. Lysate was pipetted up and down to solubilize the RNA and incubated for 5 minutes at room temperature. To extract the RNA 0.2 ml chloroform per ml of homogenate was added, samples were mixed vigorously for 15 seconds by shaking, and then incubated at room temperature for 3 minutes. Samples were then centrifuged at 14,000 rpm for 15 minutes at 4° C. The upper aqueous phase was transferred to a new tube along with an equal volume of isopropanol and incubated at room temperature for 10 minutes. Samples were the centrifuged for 10 min at 14,000 rpm at 4° C. The RNA pellet was washed with 75% ethanol, air dried on ice for 15 minutes, and resuspended in MQH2O. RNA concentration was determined by A260/280 and RNA quality was confirmed by agarose gel electrophoresis.
67
2.3.4.2 Northern blot protocol RNA samples (5-10 µg) were mixed with Ficoll loading buffer, heated for 5 minutes at 95°C, snap cooled on ice, and separated by agarose gel electrophoresis in an RNAse free environment. 1% agarose gels were prepared with 1 x MOPS buffer with 0.6 M formaldehyde. Gels were run in 1x MOPS buffer with 0.2 M formaldehyde. Samples were loaded into flooded wells and electrophoresed at 70-100 V for 2.5-3 hours. The gel was soaked for 2x 10 minutes in distilled H2O with gentle agitation to remove the formaldehyde. The RNA was transferred to nylon membrane by capillary blot in 20x SSC transfer buffer for 16-24 hours. The filter was washed in 2x SSC, UV-crosslinked with 120 mJ at 254 nm in a UV Stratalinker 1800 (Stratagene), then washed again in 1x SSC, 0.1% SDS at 65°C for 30 minutes. The membrane was prehybridised in Church buffer (Church and Gilbert, 1984) for 1 hr at 65°C. The denatured probe was added and hybridized overnight at 65°C. The membrane was then washed twice in 2x SSC. If required, the membrane was washed further in 0.2% SSC, 0.1% SDS for 15 minutes, and 2 x 0.2% SSC. The membrane was exposed to film or imaging plate (Fujifilm) and signal detected on a Bio-RadFX imager (Bio-Rad). Band quantification was performed using Bio-Rad Quantity One software. To strip membranes for reprobing, 0.1% SSC + 0.1% SDS was brought to the boil and the membrane was washed in the solution for 5 minutes. This was repeated until no radioactivity was detected.
2.3.4.3 Northern blot probe protocol Radioactive DNA probes were synthesised using the DECAprimeTM II Randomly Primed DNA Labeling Kit (Ambion) as per the manufacturer's instructions.
Approximately 25 ng of template DNA was mixed with 10 µl H2O and 2.5 µl decamer solution (random 10 bp primers), denatured at 95°C for 5 minutes, then snap cooled on ice. 5 µl reaction buffer (-dATP), 5 µl α-32P dATP (3000 Ci/mmol), and 1 µl Klenow enzyme were added and gently mixed. This was incubated at 37°C for 10 minutes and purified by passing through a G-25 Sephadex spin column. Before adding to the northern membrane, the probe was heated to 95°C for 5 minutes and snap cooled on ice.
68
Template DNA for northern blot probes: Psc1: Full length Psc1 was digested out of the pGBKT7-Psc1 construct using Sma-1. Psc1 3'UTR: A 754 nt fragment of the Psc1 3'UTR (bp 3386-4119 of the genomic sequence) was amplified by PCR using primers 3'UTRA and 3'UTRB. The product was ligated into pGEMT Easy and digested out with Not1 and EcoR1. Sart1: Full length Sart1 was digested out of the pXMT2-FLAG-Sart1 construct using kpn1. Oct4: A 484 bp fragment was generated from a pBS-Oct4 vector as described in Rathjen et al 1999. Rex1: A 848 bp fragment was generated from a pCRII-Rex1 vector, as described in Rathjen et al 1999. GAPDH: DECAtemplate GAPDH-M (Ambion).
2.3.4.4 RNAse protection assay RNAse protection assays were performed using the RPA III Ribonuclease Protection Assay kit (Ambion) as per the manufacturer's instructions.
Hybridization procedure: Sample RNA (5-20µg, isolated using Trizol; section 2.3.4.1) was mixed with labeled probe (6x 104 cpm). Probe/RNA was co-precipitated with 0.5 M NH4OAc and 2.5 volumes of 100% ethanol. Samples were mixed, incubated at -20°C for at 15-30 minutes and centrifuged at 14,000 rpm for 15 minutes at 4°C. Pellets were air dried for 5 minutes, resuspended in 10 µl hybridization buffer, votexed, incubated at 95°C for 3 min, votexed, and incubated overnight at 42°C. RNAse A/RNAse T1 was diluted 1:100 in RNAse Digestion III buffer, 150 µl added to each sample RNA tube and incubated at 37°C for 30 minutes. 225 µl RNAse Inactivation/Precipitation III solution was added plus 1 µl of Yeast RNA to aid precipitation. The samples were incubated at -20°C for 15 minutes and centrifuged at 14,000 rpm for 15 minutes at 4° C. Pellets were air dried for 5 minutes at room temperature and resuspended in 4 µl Gel Loading Buffer II. Samples were incubated
69 for 3 minutes at 95°C prior to loading on a100 ml, pre electrophoresesd TBE- acrylamide gel. The gel was run at 23 A for 1.5 hours and dried onto Whatman paper in a gel dryer. The gel was then exposed to an imaging plate (Fujifilm) and signal detected on a Bio-RadFX imager (Bio-Rad). Band quantification was performed using Bio-Rad Quantity One software. Radioactive markers were generated from SPP1 DNA markers (Geneworks). 1 µl SPP1 was mixed with 1 µl α-32P dATP, 5 µl NEB buffer 4, 43 µl H2O and 1 µl Klenow enzyme. This was incubated at 37° C for 25 minutes before clean up in a G-25 Sephadex column.
2.3.4.5 RNAse protection probes RNA probes were generated by in vitro transcription of linearised plasmid. pGEMT- exon9probe was linearised with Nco1, purified by phenol/chloroform extraction, and transcribed with SP6 RNA polymerase generating a 550 nt product. Beta-actin template was provided in the RPA III Ribonuclease Protection Assay kit (Ambion) and transcribed with T7 RNA polymerase to generate a 304 nt product.
Transcription reactions were set up as follows: 4 µl 5 x transcription optimized buffer (Promega), 2 µl 100 mM DTT, 1 µl super RNasin RNAse inhibitor, 1 µl each of 10 mM rATP, rGTP, and rCTP, 2.4 µl 100 µM rUTP, 5 µl α-32P rUTP, 2 µl template DNA, 1 µl RNA polymerase (SP6 or T7). Reactions were incubated at 37°C for 1 hour. 10 U of RNAse-free DNase was added and incubated at 37°C for 15 minutes. 10 µl 7 M ammonium acetate, 50 µl 100% ethanol were added and samples were incubated at - 20°C overnight. The probe sample was centrifuged at 14,000 rpm for 20 minutes at room temperature, the pellet washed with 70% ethanol and air dried at room temperature before being resuspended in 10 µl RNA loading buffer with formaldehyyde. The probe was heated at 95°C for 5 minutes prior to loading a 15 ml, pre electrophoresesd TBE- acrylamide gel. The gel was run at 23 A until the bromophenol blue reached the bottom of the gel. Autoradiography was used to detect the radioactive probe and it was excised from the gel and eluted overnight at 37°C in
70
400 µl RPA III kit elution buffer. 1 µl of probe in 2 ml Optiphase scintillation fluid was counted in a liquid scintillation counter.
2.3.5 Protein methods
2.3.5.1 Preparation of mammalian cell protein extracts Cells grown in suspension were harvested by centrifugation and washed in PBS. Adherent cells were washed in PBS then harvested using TEN buffer (1 ml per 10 cm2 surface area). Cells were transferred to a 1.5 ml eppendorf tube, pelleted for 30 seconds at 1200 rpm and lysed in 50 µl of NP40 Lysis buffer plus protease inhibitors (Roche complete protease inhibitor cocktail tablet, PMSF) at 4°C with rotation for 30 minutes. Cell debris was removed following centrifugation for 10 minutes at 14,000 rpm in an eppendorf centrifuge. Supernatants were collected and analysed for protein expression by SDS-PAGE (section 2.3.5.4) and western analysis (section 2.3.5.5).
2.3.5.2 Immunoprecipitation Cells grown in suspension were harvested by centrifugation and washed in PBS. Adherent cells were washed in PBS then harvested using TEN buffer (1 ml per 10 cm2 surface area). Cells were transferred to a 1.5 ml eppendorf tube, pelleted for 30 seconds at 1200 rpm and lysed in 500 µl of IP lysis buffer plus protease inhibitors (Roche complete protease inhibitor cocktail tablet, PMSF) at 4°C with rotation for 30 minutes. Cell debris was removed by centrifugation for 10 minutes at 14,000 rpm in an eppendorf centrifuge. To pre-clear samples, 25 µl of protein A agarose beads were added and incubated for 3 hours at 4°C with rocking. Beads were removed and the appropriate immunoprecipitation antibody (section 2.2.9) was added and incubated for 1 hour at 4°C. 50 µl protein A agarose beads were added and samples were incubated overnight at 4°C with rocking. If required, beads were pre-blocked with 5% albumin prior to incubation with sample. Beads were washed in IP lysis buffer at least 3 x 20 minutes. SDS-load buffer was added and samples analysed by SDS-PAGE (section 2.3.5.4) and western analysis (section 2.3.5.5).
71
2.3.5.3 Determination of protein concentration by Bradford assay Samples and standards were measured in triplicate and averages were used in further calculations. 2 µl BSA standards (1-10 mg/ml) or samples were mixed with 200 µl of 1:4 diluted Bradford Reagent (Bio-Rad) in a 96-well tray. Absorbance at 505 nm was measured in a Emax plate reader (Molecular Dynamics). Protein concentrations of samples were determined by calculation from the straight line of best fit of the standard curve.
2.3.5.4 SDS-PAGE analysis SDS-polyacrylamide gels (8%, 10% or 15%), containing 1x Tris-SDS buffer, 0.1% (w/v) APS and 0.1% (v/v) TEMED, were poured using 0.75-1 mm spacers and allowed to polymerise for approximately 20 minutes under a distilled water overlay. After polymerisation, the water was removed and a 4% stacker gel containing 1x Tris-SDS buffer, 0.1% APS (w/v) and 0.1% (v/v) TEMED was applied. 10 well combs were inserted and the gel left to polymerise. Samples were mixed with SDS-Load buffer and proteins denatured at 95°C for 5 minutes before loading on gels. Gels were electrophoresed in SDS-PAGE buffer using a PAGE minigel apparatus (Bio-Rad).
2.3.5.5 Western blot analysis Proteins were transferred from SDS-polyacrylamide gels to nitrocellulose (Protran, Schneider and Schell) in western transfer buffer using a mini trans-blot electrophoretic transfer cell (Bio-Rad). Membranes were blocked by incubation in 5% (w/v) milk powder in PBT overnight at 4°C. An appropriate dilution of primary antibody (section 2.2.9) in PBT was added to the membrane and incubated for 1 hour at RT. Filters were washed using 4 x 15 minute washes in PBT before incubation with the appropriately diluted HRP-conjugated secondary antibody (section 2.2.9). Following further 6 x 10 minute washes in PBT, the western blots were developed by bathing in enhanced chemiluminescence (ECL) reagents for 5 minutes (SuperSignal Substrates, Pierce),
72 drained and exposed on autoradiographic film (Kodak or Fuji). For ECF detection, the membrane was incubated in AP-conjugated secondary antibody (section 2.2.9) for 1 hour and washed in TBST. Blots were incubated in enhanced chemifluorescence (ECF) reagent (Roche) for 5 minutes and scanned with a Bio-Rad Fx scanner. The scanned image was analysed using Quantity One software (Bio-Rad).
2.3.5.6 Mass spectrometry sample preparation Psc1 and GFP-Psc1 were immunoprecipitated for analysis by mass spectrometry. Endogenous Psc1 was isolated from 20 x 10 cm near confluent plates of ES cells. GFP- Psc1 was isolated from 15 x 10 cm plates of GFP-Psc1 transfected COS-1 cells, grown for 3 days post transfection. Cells were washed in PBS then harvested using TEN buffer (1 ml per 10 cm2 surface area). Cells were pelleted for 30 seconds at 1200 rpm and lysed in 2 ml of IP lysis buffer plus protease inhibitors (Roche complete protease inhibitor cocktail tablet, PMSF) at 4°C with rotation for 30 minutes. Cell debris was removed by centrifugation for 10 minutes at 14,000 rpm in an eppendorf centrifuge. To pre-clear samples, 100 µl of protein A agarose beads were added and incubated for 3 hours at 4°C with rocking. Beads were removed and immunoprecipitation, antibody was added (30 µl anti-Psc1 or 9 µl anti-GFP) and incubated for 1 hour at 4°C. 100 µl protein A agarose beads were added and samples were incubated overnight at 4°C with rocking. Beads were washed in IP lysis buffer at least 3 x 20 minutes. 40 µl 2x SDS- load buffer was added and 10% of the sample analysed by SDS-PAGE and western analysis. The remaining 90% of the sample was separated on an 8% SDS-PAGE gel and Coomassie stained over night. The gel was destained and taken to the Hanson Protein Core Facility, Hanson Institute, Institute for Medical and Veterinary Science Sequencing Centre (IMVS), Adelaide, Australia.
2.3.5.7 Mass spectrometry of Psc1 protein Mass spectrometry was performed at the Hanson Protein Core Facility. Psc1 bands were excised from gel, alkylated with iodoacetamide, digested with trypsin and the peptides were introduced to the Q-TOF2 mass spectrometer by reversed phase HPLC.
73
The eluted peaks were analysed and the monoisotonic forms of the component ions (m/z) and their charge states (z) were measured. These were converted into a virtual singly charged state corresponding to the mass of the peptide plus one proton for ease of analysis. NCBI and TrEMBL protein databases were interrogated by either MS-Fit (http://prospector.ucsf.edu) or MASCOT (http://www.matrixscience.com) to identify proteins. Comparison of measured masses with known sequence using PAWS (http://65.219.84.5/paws.html) was used to match fragments. FindMod (http://kr.expasy.org/tools/findmod/) was used to identify potential post translational modifications.
2.3.5.8 Nuclear complex separation by sucrose gradient COS-1 cells (approximately 2x 107 cells) were used for sucrose gradient separation of nuclear complexes. Cells were harvested with trypsin, and washed twice with PBS at 4°C.
Preparation of nuclear extract: 4 ml of cold Buffer A plus protease inhibitors was added to the 400 µl pellet and allowed to stand on ice for 10 minutes before being pelleted at 2000 rpm for 5 minutes. The cell pellet was resuspended in 800 µl Buffer A plus protease inhibitors and homogenised with 10 strokes of a dounce glass homogeniser. Lysis was confirmed by microscopic observation with trypan blue. Lysates were then spun down at 2000 rpm for 10 min and the supernatant removed and nuclei pellets spun further at 25,000 g for 20 minutes in a Sorval S334 rotor. The nuclear pellet was resuspended in 500 µl Buffer C plus protease inhibitors and homogenised by passage through a 26.5 gauge needle. Samples were put at 4°C with rocking for 30 minutes, and then centrifuged for 30 minutes at 25,000g. The supernatant (nuclear fraction) was dialysed overnight against 5 ml Buffer D at 4° C. The dialysate was centrifuged at 25000g for 20 minutes and the nuclear extract supernatant was separated by sucrose gradient.
74
Sucrose gradient: A 15- 45% sucrose gradient was generated using 15% and 45% sucrose solutions and poured using a gradient maker (Bio-Rad). Nuclear extract was layered on top of the gradient and spun in an ultra centrifuge at 40,000 rpm for 18 hours at 4°C. 0.5 ml fractions were collected and stored at -20°C. 90 µl samples of each fraction was analysed by SDS-PAGE (section 2.3.5.4) and western analysis (section 2.3.5.5).
2.3.5.9 Immunocytochemistry 1 x 105 COS-1 cells were seeded onto coverslips (Crown Scientific) in 6 well dishes. Cells were washed twice with PBS, and fixed by immersion in methanol for 2 minutes at -20°C and re-hydrated for 15 minutes in PBT. Cells were blocked in 5% (w/v) BSA/PBT for 30 minutes. Primary antibodies were diluted appropriately (section 2.2.8) in 2% (w/v) BSA in PBT and incubated with the cells for 60 minutes at RT. Unbound primary antibody was removed using 3 x 10 minute washes in PBT. Cells were incubated with the appropriate secondary antibodies (section 2.2.8), diluted in 2% (w/v) BSA in PBT, at RT for 60 minutes in the dark, before being washed 3 x 5 minutes in PBT. Nuclei were visualised by staining with 0.5 µg/ml Hoechst 33258 trihydrochloride (BisBenzamide) for 1 minute before washing twice for 5 minutes with PBT. Coverslips were mounted onto slides and viewed using either a Zeiss Axioplan microscope with 100x oil immersion lens and equipped for 3 channel fluorescence (Zeiss filter sets II, IX, and XV), or a Bio-Rad MRC-1000UV Confocal Laser Scanning system with a Nikon Diaphot 300 inveted microscope. Images were compiled with ADOBE Photoshop 6.0.
2.3.6 Yeast methods Yeast protocols were performed as described in the CLONTECH Yeast Protocols Handbook.
75
2.3.6.1 Yeast transformation 50 ml YPD media was inoculated with AH109 strain yeast and incubated at 30°C for
16-18 hours with shaking (250 rpm) until growth was at a stationary phase (OD600 >
1.5). 30 ml of overnight culture was transferred into 300 ml YPD (OD600= 0.2 - 0.3) and incubated at 30°C for 3 hour with shaking (OD600 = 0.4 - 0.6). The culture was transferred into 50 ml tubes and vortexed at 1000 x g (5000 rpm for 2 minutes in a
Sorval SS-34 rotor) at room temperature. Cells were resuspended in sterile H2O, pooled, and centrifuged at 1000 x g. The cell pellet was resuspended in 1.5 ml sterile 1x TE/LiAc solution generating competent cells. 100 µl of yeast competent cells, 0.1 µg of vector/DNA, and 0.1µg of Herring testes carrier DNA (CLONTECH) were mixed by vortexing. Freshly prepared PEG/LiAc solution was added and cells were incubated at 30°C for 30 minutes with shaking (200 rpm). 70 µl of DMSO was added and the cells were heat shocked for 15 minutes at 42°C. Cells were chilled on ice for 1 minute, centrifuged and resuspended in 1x TE. Cells were plated on appropriate SD plates, and incubated at 30°C for 4 days.
2.3.6.2 Yeast two hybrid library screen Yeast were transformed as per section 2.3.6.1, however transformation protocol was scaled up to Library scale as described in the CLONTECH MATCHMAKER GAL4 Two-Hybrid System 3 and Libraries User Manual. Yeast containing the pGBKT7-Psc1 vector were grown and transformed with pACT2 vectors containing a testis cDNA library (Mouse Testis MATCHMAKER cDNA Library: CLONTECH) and plated on SD/-Trp/-Leu/-His agar plates (to select for yeast containing both pGBKT7 and pAct2 vectors and showing an interaction between Psc1 and a library protein). To increase the stringency of the screen for interacting proteins, colonies that grew were streaked onto SD/-Trp/ -Leu/-His/-Ade agar plates. DNA was extracted from the yeast that grew (section 2.3.6.3) and potential interactors identified through sequencing of the vectors (section 2.3.2.10).
76
2.3.6.3 Vector DNA extraction from yeast 2 ml YPD media was inoculated with transformed AH109 yeast (large 2-4 mm, fresh 2-4 day old colony) and incubated overnight at 30°C with shaking. Cells were pelleted by centrifugation at 14,000 rpm for 5 minutes. The supernatant was decanted and the pellet resuspended in residual liquid (~50µl). 10 µl of lyticase (5 units/µl) was added and the cells were vortexed and then incubated at 37°C for 60 minutes with shaking to weaken the cells walls. 20 µl 10% SDS was added and vortexed for 1 minute. Samples were put through one freeze/thaw cycle at -20°C and vortexed again. Nucleic acid was isolated by increasing the sample volume to 200µl with TE buffer pH 7, and adding 200 µl phenol:chloroform:isoamyl alchohol. The sample was vortexed for 5 minutes, then centrifuged for 10 minutes at 14,000 rpm. The aqueous (upper) phase was transferred to a fresh tube and DNA was precipitated using 8 µl of 10 M ammonium acetate and 500 µl 95-100% ethanol. Samples were placed in a dry-ice/ethanol bath for 1hr, then centrifuged at 14 000 rpm for 10 minutes. The pellet was air dried and resuspended in 10 µl MQH2O. Vector DNA was amplified by transformation into competent DH5α E Coli (section 2.3.3.2).
2.3.6.4 Preparation of yeast protein extracts Yeast containing the pGBKT7-Psc1 vector was streaked onto SD/-Trp agar plates. Colonies less than 4 days old were used to inoculate 10 ml SD/-Trp media and incubated overnight at 30°C with shaking. The culture was used to inoculate 50 ml
YPD media and incubated at 30°C with shaking until OD600 =0.4 - 0.6 (~ 4 - 5 hours). Medium was transferred into tubes half filled with ice, and cells were pelleted at 3000 rpm for 5 minutes at 4°C. The pellet was washed in 50 ml ice-cold H2O and pelleted at 3000 rpm for 5 minutes at 4°C. The cells were snap frozen with dry ice and ethanol and stored at -80°C. To extract protein, 400 µl of cracking buffer (pre warmed to 60°C) and 300 µl of glass beads (425-600 µm) were added to the cell pellets, vortexed for 1 minute, then centrifuged at 14,000 rpm for 5 minutes at 4°C. The supernatant (SN1) was removed and the pellet placed at 100°C for 5 minutes, vortexed for 1 minute, and centrifuged at 14,000 rpm for 5 minutes at 4°C. The supernatant was removed (SN2),
77 added to SN1, and frozen at -80° C. Samples were analysed by western blot (section 2.3.5.5).
78
2.4 Tissue culture methods
2.4.1 Cell Lines Acquisition of Cell lines: D3 ES cells Dr Lindsay Williams, Ludwig Institute, Melbourne, Australia COS-1 cells ATCC
2.4.2 Solutions
PBS: 136 mM NaCl, 2.6 mM KCl, 1.5 mM KH2PO4, 8 mM Na2HPO4 pH 7.4, sterilised by autoclaving (20 psi for 25 minutes at 140°C). PBS/gelatin: 0.2% (w/v) gelatin in PBS.
Trypan blue: 0.4 g Trypan blue, 0.06 g KH2PO4, in 100 ml MQ H2O. Trypsin: 0.1% trypsin (Difco) and EDTA Versene buffer solution (CSL), sterilised by filtration through a 0.2 µm filter (Whatman). 0.1 M βME: β-mercaptoethanol diluted in PBS. β-mercaptoethanol/PBS solutions were not kept longer than two weeks. L-glutamine: 100 mM L-glutamine in PBS. LIF: COS-1 cell conditioned medium containing LIF prepared as described by Smith (1991) except that transfections were performed by electroporation.
2.4.3 Media Incomplete ES cell medium: 90% DMEM medium (Gibco BRL), 10% FCS (Gibco BRL), 1% L-glutamine, 0.1 mM β-mercaptoethanol/PBS, 1000 units/ml penicillin and streptomycin. Complete ES cell medium: Incomplete ES cell medium with 0.1% LIF. 50% MEDII: 50% Incomplete ES cell media and 50% MEDII (HepG2 conditioned medium collected from HepG2 cells cultured in COS medium for 4-5 days and supplemented with 0.1 mM β-mercaptoethanol before use; Rathjen et al., 1999). COS-1 medium: 90% DMEM medium, 10% FCS.
79
2.4.4 Culturing of Cells
2.4.4.1 ES Cells ES cells were maintained on gelatinised 10 cm petri dishes (Corning or Falcon) in complete ES cell medium at 37°C in 10% CO2. Cells were passaged by washing in PBS and incubation with 1 ml trypsin for 1 minute. Trypsinised cells were added to 9 ml complete ES cell medium, centrifuged at 1200 rpm for 4 minutes, medium aspirated, and resuspended in 10 ml complete ES medium. Cells were counted and re- seeded at density of 105-106 cells per plate. Medium was changed every 2 days, and cells were passaged every 3-4 days.
2.4.4.2 Freezing and thawing of ES cells 10 cm plates of ES cells were trypsinised and centrifuged at 1200 rpm for 4 minutes. The supernatant was aspirated and the cells resuspended in 4 ml of freezing mix (90% FCS, 10% DMSO). 500 µl was placed in each freezing vial (Nunc) and stored overnight at –80 °C in a Mr. Frosty Freezing Container (Thermo Scientific). Vials were placed in liquid nitrogen for long term storage. Freezing vials were thawed in a 37 °C water bath and the cells were seeded onto 60 mm plates containing 4 ml ES cell complete medium. The next day the cells were washed in PBS and the medium replaced.
2.4.4.3 EBM culture EBM (embryoid bodies grown in MEDII) cell aggregates were formed from single cell suspension (1x 105 cells/ml) of ES cells aggregated in 50% MEDII and cultured in 10 cm petri dishes (Corning or Falcon). EBMs 1-4 were grown at 37°C in 10% CO2 and with medium changed and aggregates divided 1 in 2 on day 2 (Rathjen et al., 2002).
80
2.4.4.4 COS-1 cells
Cells were maintained in COS-1 medium, grown at 37°C in 5% CO2 and passaged every 3-4 days when cultures were reaching confluence. Cells were passaged by washing in PBS and incubation with trypsin for 5 minute at 37°C. Trypsinised cells were dislodged from the flask, transferred into COS-1 medium, and spun at 1200 rpm for 2 min. Cell pellets were resuspended in 10 ml COS-1 medium and cells re-seeded at 10-20% of their density prior to passaging.
2.4.4.5 Cell counts Following trypsinisation and resuspension, 100 µl cell suspension was mixed with 900 µl Trypan Blue. 50 µl of the mixture was placed on a haemocytometer and unstained live cells were scored under the light microscope at 20x magnification.
2.4.4.6 Transient transfection of cells Cells were transfected using FuGENE 6 transfection reagent (Roche) according to the manufacturer’s instructions. Cells were transfected for 24-48 hours prior to harvesting or fixation.
81
CHAPTER 3
PSC1 GENOMIC SEQUENCE AND mRNA
VARIANTS
82
CHAPTER 3: PSC1 GENOMIC SEQUENCE AND mRNA VARIANTS
3.1 Introduction Psc1 was originally isolated in a differential display PCR screen aimed at identifying genes that are differentially expressed during early development of the mouse embryo (see section 1.1). A partial Psc1 cDNA sequence was obtained from a clone isolated from a D3 ES cell ZAP II cDNA library (Clontech). The 5' end of the sequence was subsequently generated using RACE/PCR (Schulz, 1996). This has been the sequence used for Psc1 research to date. The compiled Psc1 cDNA was 3512 nucleotides (nt) in length and contained two in-frame stop codons in the 5’ UTR prior to an ATG initiation codon at nt 157-159. The deduced ORF was 3015 nt in length and coded for a protein of 1005 amino acids. The 3’ UTR present in the original cDNA library clone was 340 nt in length, however, neither a poly(A) tail nor poly(A) consensus sequence (AATAAA) was present, indicating that the 3' UTR sequence was likely to be incomplete. Northern blot analysis of ES cell mRNA using a Psc1 specific probe detected transcripts of 3 distinct sizes, indicating the existence of at least 3 variant Psc1 transcripts (Schulz, 1996).
In this chapter the NCBI mouse genome database was used to determine the complete Psc1 genomic sequence. Further database analysis was used to determine potential Psc1 splice variants, and compare the Schulz sequence with other reported variants of Psc1. Experiments were performed to assess the expression of the Schulz variant in ES cells, to characterise further the 3 Psc1 variants observed by northern blot, and to analyse the expression of these variants during ES cell differentiation.
3.2 Psc1 genomic sequence and intron/exon structure The public release of the mouse genome in 2002 allowed for rapid analysis of the Psc1 genomic structure. The Schulz Psc1 cDNA sequence and the NCBI BLAST program 83
(http://www.ncbi.nlm.nih.gov) were used to determine the genomic structure of mouse Psc1 (Table 3.1). Full length Psc1 is predicted to contain 21 exons (accession number XM_128924.8), separated by 59759 nt of introns, covering a total region of 66196 nt at position 42435007 – 42501203 in region B3 of mouse chromosome 18.
The Schulz Psc1 clone contained a 5’UTR of 157 nt. The genomic sequence predicted an additional 24 nt, giving Psc1 a 5’UTR of 181 nt in the first exon prior to the start codon. The most 3’ Psc1 exon (exon 21) in the genomic sequence was 3158 nt in length, which included a 3’UTR of 3074 nt. The Schulz clone was incomplete, with a 3’UTR of 340 nt containing a non-consensus polyadenylation sequence. The predicted full length 3’UTR contains a consensus AATAAA polyadenylation sequence at 2939- 2944 nt downstream of the TGA stop codon.
3.2.1 The Psc1 5’UTR and 3’UTR Elements within 5’UTRs are known to function in the control and regulation of mRNA translation. Analysis of the Psc1 5’UTR by the RegRNA regulatory RNA motif and elements finder (http://regrna.mbc.nctu.edu.tw) predicted the presence of potential regulatory elements. Terminal oligopyrimidine tract (TOP) sequences were found at nt 32-38 (CTCTTG) and 163-169 (CCTTCCCTG), fitting the TOP motif consensus of C(Py)nG where n = 3-14. TOP motifs are thought to act as binding sites for regulatory trans-acting proteins and are generally found in the 5’UTRs of mRNAs involved in protein synthesis and whose translation is regulated in a growth-dependent manner (Davuluri et al., 2000). TOP motifs are found in all vertebrate ribosomal proteins and translation elongation factors analysed to date, and are required to coordinate translational repression during growth arrest, differentiation, development and certain drug treatments (Kato et al., 1994; Meyuhas et al., 2009; Kaspar et al., 1992).
The Psc1 5’UTR also contained an upstream ORF (uORF) at nt 64-78, a feature often found in mRNAs encoding regulatory proteins. An uORF can enhance translation by stimulating the formation of translationally competent ribosomes that may translate the
84
Table 3.1: Structure of Psc1 gene showing exon and intron sizes and junction sequences. Start and stop refers to nucleotide position on chromosome 18. The conserved AG and GT nucleotides at the intron ends are in bold.
85
Exon start stop Intron 3' end Exon 5' end Exon size (nt) Exon 3' end Intron 5' end Intron size (nt) 1 42435007 42435246 TAGGT 240 GCCGAT GTGAGT 12515 2 42447762 42447880 AACTAG ATGTGA 119 AAAAAG GTAATT 3756 3 42451637 42451761 TTCAG AGACTT 125 GAAGAG GTAATA 6325 4 42458087 42458178 TACAG GTATTT 92 ACGAAG GTTTGT 618 5 42458797 42458990 TTATAG AACACG 194 ACGTTG GTGAGT 913 6 42459904 42460164 AAACAG AGCACA 261 ACGATG GTAAAG 1212 7 42461377 42461670 TTACAG AAAGAG 294 TACCAA GTAAGT 3663 8 42465334 42465468 CTGTAG GACCTC 135 CAGAAA GTAAGT 8156 9 42473625 42473789 CTATAG GACAGG 165 TCCCAG GTAAGC 3465 10 42477255 42477404 TTTCAG ATACAT 150 CAAGAG GTGAGG 2051 11 42479456 42479600 CAACAG CTGCTA 145 GGGAAA GTAAGA 817 12 42480418 42480571 TTTCAG ACAAGG 154 ATCCAG GTAATT 994 13 42481566 42481862 TTAAAG GTTGCT 297 CAAAAG GTAATC 1846 14 42483709 42483852 TTGTAG ATGATG 144 TGTCCG GTATGC 1706 15 42485559 42485678 TTTTAG GTATTT 120 AAACAG GTAATA 1139 16 42486818 42486892 ACTCAG GAAGCA 75 CAGAAG GTACTC 115 17 42487008 42487172 TTGTAG ATGCTG 165 ACAGAG GTATCT 5261 18 42492434 42492538 TCCCAG GCCCAG 105 GTTGAG GTGAGA 324 19 42492863 42493051 ATTTAG GCTGCA 189 TTCTCA GTAAGT 3565 20 42496617 42496727 CTTTAG GCTACA 111 GAAGAG GTAAAG 1318 21 42498046 42501203 CTTTAG GAAACA 3158 AGCTGT
86 uORF and then either terminate and reinitiate or terminate and leave the mRNA, often resulting in the down regulation of the main open reading frame. The uORF peptide itself can potentially play a regulatory role (reviewed in Meijer and Thomas, 2002). The presence of an uORF is often accompanied by an internal ribosome entry site (IRES), and the Psc1 5’UTR is predicted to contain an IRES at nt 76-103. IRES sequences allow mRNA to be translated by an alternative mechanism to the conventional 5’-cap dependent mechanism resulting in increased regulation of translational efficiency (Le and Maizel, 1997). The presence of 5'UTR regulatory elements in the Psc1 5’UTR could function to control the translational efficiency of Psc1 transcripts and these predictions need to be tested experimentally.
Like the 5’UTR, the 3’UTR of mRNA often contain cis-acting regulatory elements that can affect mRNA 3’end processing, nuclear export, subcellular localisation, translation and mRNA stability (reviewed in Chen et al., 2006). Elements in the 3’ UTR rely on both primary and secondary structure and are often hard to define and predict. Analysis of the Psc1 3’UTR by the RegRNA regulatory RNA motif and elements finder identified the presence of many potential regulatory motifs. For example, 7 K-Box motifs (cTGTGATa) were identified. K-Box motifs are found in many notch pathway target genes, and are responsible for the down regulation of transcripts through a micro RNA pathway (Lai et al., 1998; Lai, 2005). The 3'UTR of Psc1 will need to be tested experimentally to determine what role it plays in the regulation of Psc1 mRNA.
3.2.2 Psc1 splice variants Based on genomic sequence, full length mouse Psc1 was predicted to contain 21 exons. Comparison of the predicted mRNA sequence with the Schulz sequence, and database mRNA and EST sequences, identified evidence of alternative splicing of three exons and generation of at least three alternatively spliced Psc1 transcripts (Fig. 3.1A). The NCBI Unigene database contains 14 mRNA and 137 EST sequences that correspond to Psc1 (www.ncbi.nlm.nih.gov/UniGene Mm.329400). Within these sequences, alternative splicing of exons 5, 9 and 13 is evident.
87
Figure 3.1: Psc1 splice variants. A) i. Database analysis identified alternative splicing of 3 exons in the Psc1 sequence. ii. Within the database evidence existed for the generation of three alternatively spliced Psc1 transcripts. Intron/exon structure black, 5’UTR blue, 3’UTR green. B) Intron 5 alternative 3’ splice site: sequence analysis upstream of the predicted intron 5 splice site identifies two potential alternative splice sites with the consensus TAG at 33nt (1) upstream and GAG 35nt (2) upstream. C) Psc1 genomic structure and Psc1 domains: Diagram shows the Psc1 intron/exon structure (black) in relation to the identified Psc1 domains (red). 5’UTR blue, 3’UTR green. RS: RS domain, RRM: RNA recognition motif, AR: Acidic rich region.
88
A) i. Exon Nature of alternative Evidence for predicted Evidence for alternatively spliced splicing sequence sequence (Genebank accession #)
5 Alternative 3’ splice site 1 mRNA 1 mRNA (BC054080) 2 ESTs 1 EST (BQ896445)
9 Removal from mRNA 3 mRNAs 1 mRNA (AY461716) 7 ESTs
13 Removal from mRNA 3 mRNAs 1 mRNA (BC054080) 7 ESTs
ii. 5’UTR 1 2 3 4 5 6 7 8 9 10 11 12 13 14 151617 18 19 20 21 3’UTR Genomic predicted full length Rbm27 XM_128924.8
Variant mRNAs mKIAA1311 (AK129330)
mRbm27 (BC054080.1)
Psc1 (AY461716.1)
89
B) Predicted 3’splice Predicted intron sequence site Exon 5 CTAG AG TCTACCTATGGCTTTTATATCTGTGTATTATAG AACACGTGAAGAA BQ896445 BC054080 alternative 3’ splice site (1) alternative 3’ splice site (2)
C) 1 2 3 4 5 6 7 8 9 10 11 12 13 14 151617 18 19 20 21
N Domain RS Zn Finger RRM C Domain AR ATG TGA
90
Two sequences in the database (Genebank accession BC054080 and BQ896445; Fig. 3.1Ai.) start in sequence that is predicted to be intronic, 22 and 21 nt upstream of exon 5 respectively. Analysis of the predicted intronic sequence upstream of exon 5 identified two potential alternative 3’ splice sites, 33nt and 35nt upstream from the predicted site (Fig. 3.1B). This would generate an additional 11 amino acids in one case, or cause a frame shift resulting in a TGA stop codon halfway through exon 5 at nt 562-664 in the other. As the two sequences were incomplete at the 5’ end the actual alternative splice site remains unknown. Evidence for the use of the predicted 3’ splice site was found in three sequences.
Exon 9 was found to be spliced out of one sequence (Schulz Psc1 sequence, Genebank accession AY461716; Fig. 3.1Ai.) and retained in 10 sequences. Exon 9 is 165 nt in length, starting at nt 1493 in the predicted sequence (XM_128924.8), codes for 55 amino acids, and removal does not cause a frameshift. The sequence of exon 9 contains no significant homology or motifs and its potential function is unknown.
Exon 13 was found to be spliced out of one sequence (Genebank accession BC054080, Fig. 3.1Ai.) and retained in 10 sequences. Exon 13 is 297nt in length, starting at nt 2108 in the predicted sequence (XM_128924.8), codes for 99 amino acids, and removal does not cause a frame shift. Exon 13 contains 40 amino acids of the consensus Psc1 RNA recognition motif (RRM).
Psc1 and the ARRS family of proteins are defined by the sequential arrangement of six conserved domains, an N-domain, followed by an RS domain, a zinc finger motif, an RNA recognition motif (RRM), a C-domain, and an acidic rich C-terminal motif (see section 1.2; Fig. 1.4). The relationship between the domains and the Psc1 exon structure is shown in Figure 3.1C. The N-domain is contained in exons 1-3, the RS domain solely in exon 5, the Zn finger in exons 6-7, the RRM in exons 12-13, the C domain starts at the intron/exon junction of exon 18 and carries into exon 19, and the acidic rich C-terminal motif is in exons 20-21.
91
Analysis of the alternatively spliced exons in the context of the Psc1 domains suggests that if the alternative 3’ splice site of exon 5 does not induce a frameshift, its inclusion at the start of the exon containing the RS domain may influence RS domain function, potentially through a structural change in the protein near the domain. The removal of exon 9 does not interfere with any recognised Psc1 domain. The splicing out of exon 13 removes 56% of the RRM, and may be used to generate a Psc1 protein with alternative RNA binding specificities or no RNA binding ability at all.
The current mRNA evidence supports the generation of 3 different Psc1 transcripts (Fig. 3.1Aii.). All sequences in the database appear incomplete at the 5’ end (although the Schulz sequence contains the complete coding region of exon 1) and transcripts containing all 21 exons have not been isolated to date. Of the variant transcripts in the database, the first begins in exon 7 and retains both exons 9 and 13. The second variant transcript begins with sequence that suggests the use of the alternative exon 5 splice site and retains exon 9 but lacks exon 13. The third variant transcript begins with exon 1, uses the predicted exon 5 splice sites, lacks exon 9, retains exon 13, and has an incomplete 3’UTR.
3.2.3 Investigation of the Psc1 exon 9 splice variants in ES cells and ES cell differentiation The lack of exon 9 in the Schulz Psc1 transcript was a splicing variant not observed in any other database sequence. To confirm the genuine nature of this transcript PCR was performed. ES cell cDNA was used as this was the source of the original cloned sequence, and primers were designed such that cDNA containing exon 9 would produce a 715 base pair (bp) product, and DNA lacking the exon would produce a product of 550 bp (Fig. 3.2). The results showed that the majority of Psc1 transcripts in ES cells contained exon 9, but a small amount of a splice variant lacking exon 9 was also detected. This demonstrated that there was more than one Psc1 splice variant in ES cells, and that the variant lacking exon 9 was the minor transcript.
92
93
As the presence of Psc1 splice variants in ES cells may be relevant to the activity of Psc1, the expression of the variant transcripts was investigated using RNAse protection assays to analyse the ratio of the two splice variants in ES cells and during ES cell differentiation.
An RNAse protection probe was designed to cover sequence upstream and downstream of exon 9, such that a band of 550 bp would results from transcripts lacking exon 9, and two products of 350 and 200 bp would result from transcripts containing exon 9 (Fig. 3.3 A). The probe was radioactively labeled and RNAse protection assays performed on ES cell RNA (Fig. 3.3B). Bands at 200, 350 and 550 bp were detected indicating the presence of transcripts with and without exon 9. As a positive control for transcripts lacking exon 9, RNA from COS-1 cells transfected with GFP-Psc1, a construct lacking exon 9, was analysed and an intense band of 550 bp was detected in this sample. Bands of 200 and 350 bp were also detected in this sample, and are likely to be endogenous COS-1 cell Psc1. Sequence of Psc1 from African green monkeys (the source of COS-1 cells) is unavailable. In the closely related Pan Troglodyte and human, Psc1 shows 92% identity to mouse over the probe sequence. None of the 3 bands were detected in the yeast RNA negative control. Quantitation of bands from four independent experiments showed that an average of 3.6% of the total Psc1 transcripts found in ES cells did not contain exon 9 (Fig. 3.3C).
Psc1 mRNA is down regulated during ES cells differentiation (Pelton et al., 2002). To examine the behaviour of the exon 9 splice variants during ES cell differentiation, RNAse protection assays were performed as above. ES cells were differentiated as EBMs for 2, 3 or 4 days (see sections 1.1 and 2.2.4.3). RNA was extracted and analyzed by RNAse protection assay. The 200, 350 and 550 bp bands were detected in each sample indicating transcripts with and without exon 9 were expressed during ES cell differentiation (Fig. 3.4A). Quantitation of the bands indicated that, as the cells differentiated, the ratio of Psc1 transcript lacking exon 9 compared to transcript containing exon 9 remained constant (Fig. 3.4 B). When normalised to β-actin, transcripts containing exon 9 and the transcripts lacking exon 9 were down regulated at
94
Figure 3.3: Semi-quantitative analysis of Psc1 exon 9 splice variants in ES cells. An RNAse protection assay was used to detect and measure the Psc1 exon 9 splice variants. A) A probe that covered 350 nt upstream and 200 nt downstream of exon 9, but did not include exon 9 itself, was designed such that two products of 350 nt and 200 nt would be generated if exon 9 was present in a transcript, and a single 550 nt product would be observed if exon 9 was absent from a transcript. B) The probe was radioactively labelled and RNAse protection assays were carried out on ES cell RNA. Bands of 200 nt and 350 nt were detected, representing transcripts containing exon 9, and a faint band of 550 nt was detected representing transcripts lacking exon 9. RNA from COS-1 cells that had been transfected with a Psc1 construct lacking exon 9 (GFP-Psc1) was used as a positive control for the exon 9 lacking splice variant. Yeast RNA was used as a negative control. C) Quantitation of results: The signal detected from the 200 nt and 350 nt probe fragments (+exon 9 transcripts) were added together and compared to the signal from the intact 550 nt probe (-exon 9 transcripts). 90-95% of Psc1 transcripts were found to contain exon 9.
95
96
97
Figure 3.4: Regulation of Psc1 exon 9 splice variant during ES cell differentiation. A) An RNAse protection assay was used to measure the Psc1 exon 9 splice variants during ES cell differentiation. ES cells were differentiated in suspension in MEDII for 2, 3 and 4 days. RNAse protection assays were performed as described in Figure 3.3. Bands indicating Psc1 transcripts containing and lacking exon 9 were detected. Beta- actin was used as a loading control. B) Quantitation of results: Bands were quantitated as described for Figure 3.3. The ratio between the exon 9 containing and exon 9 lacking transcripts remained the same during cell differentiation C) The Psc1 exon 9 splice variants were both down regulated at a similar time and rate during ES cell differentiation. Significant down regulation was observed from ES to EBM2 (++ p=<0.01), no further change between EBM2 and EBM3 or EBM4 occurred. Error bars = std dev; n= 4 biological repeats.
98
99
100 a similar rate as ES cells differentiated, with approximately 50% less transcript in EBM2, EBM3 and EBM4 cells compared to ES cells (Fig. 3.4C). The significance of the Psc1 transcript lacking exon 9 remains unknown.
3.3 Northern blot of ES cell RNA detects Psc1 variant transcripts Variant Psc1 transcripts in ES cells have been previously detected by northern blot analysis (Schulz, 1996). Psc1 mRNA was detected as three differently sized transcripts, originally estimated using DNA size markers at 5.5 kb, and a doublet at 3.7 and 3.5 kb. Based on the genomic sequence of Psc1, the predicted full length mRNA including all the coding exons, the 5’ and 3’ UTR and an approximately 250 nt poly(A) tail is 6.69 kb.
To obtain a more accurate estimation of Psc1 transcript size in ES cells, and potentially identify the relationship between the three transcripts, the predicted Psc1 sequence and identified splice variants, northern blot analysis was performed on ES cell RNA along with RNA size markers. The Schulz Psc1 sequence was used as the probe template (Fig. 3.5).
In agreement with previous results three bands were detected; a single higher band, and a lower doublet. The larger transcript ran between the 7.5 and 9.5 kb markers and the smaller transcripts ran as a doublet between the 4.4 and 7.5 kb markers. The accuracy of the markers was called into question; the sizes of the 28s and 18s ribosomal subunits detected in the experiment were estimated by the markers to be 1-2 kb larger than the actual subunit size. With this inaccuracy taken into account the larger transcript of Psc1 was estimated to be between 6-7 kb, consistent with the predicted full length sequence. The small transcripts were between 4-5 kb, with approximately 400-500 bp difference between the two bands of the doublet. In agreement with the original experiment an approximately 2 kb size difference was identified between the higher and lower bands.
101
102
3.3.1 Detection of Psc1 transcripts with variant 3’UTRs Northern blot analysis identified variant Psc1 transcripts in ES cells that differed by approximately 2 kb. As the predicted full length Psc1 coding sequence is only 3.2 kb, experiments were performed to determine whether the difference in transcript size was due to variation in the 3074 nt 3’UTR. Northern blot analysis was performed on ES cell RNA using the sequence 754 - 1122 nt downstream of the Psc1 TGA stop codon as the probe template (Fig. 3.6). The higher band and the upper band of the doublet were detected. All three bands were detected when probed using the Schulz Psc1 sequence as the probe template.
These results suggest that the three Psc1 transcripts may differ in the length of their 3’UTR sequence. The Psc1 TGA stop codon and 3’UTR are all contained in one exon, therefore alternative splicing is unlikely to be the cause of these results. Close analysis of the Psc1 3’UTR identified three consensus AATAAA polyadenylation sequences, at 712-717, 1059-1064, and 2939-2944 nt downstream of the TGA stop codon. Use of the first polyadenylation site, at 712 nt downstream of the stop codon, would generate a transcript of approximately 4.3 kb and could account for the lower band of the doublet that is detected with the Psc1 coding sequence probe, but not the 3’UTR probe (see Figure 3.6B for diagram). Use of the second polyadenylation site, at 1059 nt downstream of the stop codon, would generate a transcript of approximately 4.7 kb and could account for the upper band of the doublet that is detected by both the coding sequence probe and the 3’UTR probe. Use of the third polyadenylation site, at 2939 nt downstream of the stop codon, would generate a transcript of approximately 6.6 kb, and could account for the higher band that is also detected by both probes (see Figure 3.6B for diagram). The predicted sizes of the 3’UTR transcript variants does not take into account the possibility of alternative splicing of the coding sequence, with alternative splicing of exon 9 and exon 13 potentially resulting in size variation of 165 nt and 297 nt, respectively.
103
104
3.3.2 Psc1 3’UTR variants are differentially down regulated during ES cell differentiation Evidence suggests that variant Psc1 transcripts in ES cells have different length 3’UTR. Elements within 3’UTR sequences are known to regulate mRNA nuclear export, subcellular localisation, translation and stability (reviewed in Chen et al., 2006). It is therefore possible that Psc1 transcripts with variant 3’UTRs are differentially regulated.
Previous work has characterised the down regulation of Psc1 during ES cell differentiation by in situ hybridization and northern blot. Only the larger 6-7 kb Psc1 transcript was analysed in previous northern blot experiments (see Figure 1.1; Pelton et al., 2002). Experiments were performed to compare the expression of the 6-7 kb transcript containing the full length 3’UTR and the 4-5 kb transcripts with the shorter 3’UTRs during ES cell differentiation.
ES cells were differentiated as EBMs for 1, 2, 3 or 4 days (see sections 1.1 and 2.2.4.3). RNA was extracted and analysed by northern blot using the Schulz Psc1 coding sequence as the template for the probe (Fig. 3.7A). The ICM marker Rex1 showed loss of expression between ES cells and EBM2, and the pluripotency marker Oct4 was expressed in all cells, as expected (Rathjen et al., 2002; Fig. 3.7B).
The 6-7 kb and 4-5 kb Psc1 transcripts were detected in ES cells and EBM1-4 (Fig. 3.7Ai.). A single band was detected at 4-5 kb due to insufficient resolution of the northern blot. The 6-7 kb transcript was down regulated between EBM1 and EBM2, and expression was reduced to approximately 60% of ES cell expression in EBM on days 2, 3 and 4. The 4-5 kb transcripts were down regulated between ES cells and EBM1, with further down regulation in EMB2. Expression was reduced to approximated 30% of ES cell expression in EBM2, 3 and 4 (Fig. 3.7Aii.). These results show that the Psc1 transcripts with long and short 3’ UTRs are down regulated differently during ES cell differentiation.
105
Figure 3.7: Regulation of Psc1 3’UTR variants during ES cell differentiation. Psc1 3’UTR variants were analysed during ES cell differentiation by northern blot. ES cells were differentiated in suspension in MEDII for 1, 2, 3 and 4 days. A) i. Northern blots were performed using the Schulz Psc1 sequence as the probe template. A single upper band and a single lower band were detected, the lower band of the doublet was not observed due to insufficient resolution of the northern. GAPDH was used as a loading control. ii. Quantitation of the results: The 6-7 kb transcript was significantly down regulated between EBM1 and EBM2. The 4-5 kb transcripts were significantly down regulated between ES and EBM1, with further reduction from EBM1 to EBM2. Error bars = std dev; n=3 biological repeats. Significance: ++ = p <0.01. B) To validate the differentiation of the ES cells and correct formation of EBMs, northern blots were probed for the ICM marker Rex1 and the pluripotency marker Oct4. Quantitation of the results: Rex1 was down regulated by EBM2, and Oct4 expression was maintained through to EBM4, indicating the correct differentiation of the cells. GAPDH was used as a loading control. Error bars = std dev; n=3 biological repeats.
106
107
108
3.4 Discussion The determination of the Psc1 genomic sequence provides information on the complete sequence of Psc1, insight into the potential regulation of its mRNA via 5’ and 3’ UTR sequences, and the potential variation in the protein through splice variants. In the future, knowledge of the genomic sequence could be used in the generation of Psc1 knockout models to further research into Psc1 function.
3.4.1 Psc1 Splice variants Database analysis of mRNA and EST sequences found evidence for the alternative splicing of exons 5, 9 and 13.
3.4.2.1 Psc1 exon 5 splice variant Alternative splicing of exon 5 was suggested by the presence of two incomplete transcripts containing predicted intronic sequence upstream of exon 5, suggesting the use of an alternative 3’ splice site in the upstream intron. Both the sequences were incomplete at the 5’ end, starting within the intronic sequence 21 and 22 nt respectively upstream of the predicted splice site. As a result, the exact position of the alternative splice site was unable to be determined.
Two potential alternative 3’ splice sites were identified, with a GAG sequence 33 nt upstream and a TAG 35 nt upstream. The first splice site would generate a protein with an additional 11 amino acids in exon 5. As the Psc1 RS domain is found in exon 5, this has the potential to alter RS domain function, particularly by changing the protein structure. Use of the second potential splice site would induce a frame shift in the protein, resulting in a stop codon in the RS domain in exon 5 at amino acid 187. As the stop codon would be in exon 5, this would be likely to induce NMD, a quality control mechanism whereby mRNA with PTCs upstream of an exon-exon junction are degraded (see section 1.3.4). A study of alternatively spliced variants listed in databases has shown that many would be degraded in vivo due to PTC and induction of NMD (Hillman et al., 2004). Use of the second splice site could be used as a 109 mechanism to induce down regulation of Psc1 expression. AS-NMD-mediated regulation has been identified in a number of genes encoding RBPs and in other proteins involved in RNA metabolism (Cuccurese et al., 2005; Lareau et al., 2007a, 2007b; McGlincy and Smith, 2008; Ni et al., 2007; Saltzman et al., 2008, Saltzman et al., 2011). In many cases the RBPs auto-regulate the AS-NMD process as seen with SC35, where over expression of SC35 directly causes an alternative splicing event in the SC35 mRNA, leading to down regulation by NMD (Sureau et al., 2001). SRp20 auto-regulates its own homeostasis and uses AS-NMD mechanisms to cross-regulate the expression of other SR proteins including SC35, SRp40 and 9G8 (Anko et al., 2012).
3.4.2.2 Psc1 exon 9 splice variant Of the Psc1 sequences in the database, exon 9 was found to be spliced out of one sequence, but retained in ten others. Exon 9 does not contain any of the recognized Psc1 domains and has no significant homology with other sequences. To date the Psc1 splice variant lacking exon 9 has only been identified in ES cells and EPL cells, and is the minor transcript (<5%) when compared to the transcript containing exon 9. Both transcripts are, however, down regulated at a similar rate and extent as ES cells differentiate, suggesting that the down regulation of both transcripts is important for ES cell differentiation. Further work needs to be carried out to investigate if the splice variant lacking exon 9 is found in other cell types.
The functional significance of the removal of exon 9 from Psc1 remains unknown, however, as the experimental work in this thesis and other publications (Schulz, 1996; Kavanagh et al., 2005; Pelton et al 2002) was performed using the Schulz cDNA clone lacking exon 9, exon 9 function will need to be investigated.
3.4.3.4 Psc1 exon 13 splice variant A splice variant lacking exon 13 was identified in one database sequence. Exon 13 contains 56% of the predicted Psc1 RRM, and removal would significantly affect the
110 function of the protein by changing the RNA binding specificity or, more likely, by abolishing it completely. The remainder of the RRM sequence in exon 12 does not contain enough RRM homology to be recognized by the NCBI conserved domain database. SR proteins of the SC35- like and 9G8 -like subfamilies in Arabidopsis thaliana and Oryza satina have been found to undergo a conserved alternative splicing event that removes an exon from the RRM sequence resulting in transcripts with incomplete RRMs that are predicted to be non-functional (Iida and Go, 2006).
A Psc1 protein lacking a functional RRM could have multiple roles, for example through sequestering Psc1 binding partners away from full length Psc1, or through carrying out a non-RNA binding dependent function of its own.
To determine the function of the alternatively spliced Psc1 variants the function of full length Psc1 needs to be determined. Some characteristics of the Psc1 protein are known, such as subcellular localisation patterns and protein binding partners detailed in chapters 5 and 6 of this thesis. Experiments could be performed with Psc1 splice variants to see their effect on these aspects of Psc1 biology and, once a function for Psc1 is determined, splice variant specific RNAi could be used.
3.4.3 Psc1 transcripts containing variant 3’UTR sequences are expressed in ES cells In addition to splice variants within the Psc1 coding sequence, Psc1 transcripts containing variant 3’UTRs were also identified in this study. 3’UTR often contain cis- acting regulatory elements that are bound by microRNAs (miRNAs) and RNA-binding proteins (RBPs), and function to regulate mRNA 3’end processing, nuclear export, subcellular localisation, translation and stability (reviewed in Chen et al., 2006; Andreassi and Riccio, 2009; Fabian et al., 2010; van Kouwenhove et al., 2011). In addition many non-coding RNAs have been found to initiate from the 3’UTRs of protein coding genes (Carninci, 2009).
111
Variant 3’UTRs have been found previously in other SRrps. The SRrp SFRS14, a putative splicing factor, undergoes alternative 3’ end processing by alternative splicing. Alternative 3’end ESTs were found in wide range of tissues and the generation of alternate 3’ ends was conserved between human and mouse, suggesting functional significance. The conservation was not seen at the sequence level and is thought to reside in the secondary structure (Sampson and Hewitt, 2003). Pinin (pnn) is an SRrp that localises to the nucleus (N-pnn) and the desmosome of cell-cell adhesion (D-pnn). Northern blot analysis has detected two RNA isoforms that were determined to result from differential utilization of poly(A) sites. The relevance of the two isoforms is still unknown. The stability and localisation of the two forms has been compared and no significant differences were found. Expression of the long and short 3’UTR transcripts showed no significant difference between tissues (Leu and Ouyang, 2006).
3.4.3.1 The generation of alternative 3’UTRs through alternative poly(A) site selection Northern blot analysis of ES cell RNA detected three Psc1 transcripts. Based on the estimated sizes of the transcripts, the presence of three consensus poly(A) sequences in the Psc1 3’ UTR sequence, and the fact that only two transcripts were detected when a 3’UTR specific probe (754-1122 nt downstream of the stop codon) was used, it is proposed that use of the alternative poly(A) signals produces the three transcripts (detailed in section 3.3.1). Use of alternative poly(A) sites involves a number of factors and further work is needed to confirm this hypothesis.
Large scale analysis of polyadenylation in humans has found that the majority of genes have alternative polyadenylation sites (Ozsolak et al,. 2010; Millevoi et al,. 2010; Fu et al., 2011; Jan et al., 2011; Lutz, 2008; Shepard et al., 2011; Tian et al., 2005). The processing of mRNA at multiple poly(A) signals can be influenced by physiological conditions including cell growth, cell cycle position, differentiation and development, and also can be altered in pathological situations including cancer, inflammation and viral infection (Ji and Tian, 2009; Mayr and Bartel, 2009). A recent study in
112
Drosophila melanogaster has shown 3'UTR length shows broad trends across different tissues, with a generalised shortening in the testis and lengthening in the central nervous system observed. Genes encoding RNA binding proteins (RBPs) and transcription factors were preferentially subject to 3′ UTR extensions. These results suggest that alternative polyadenylation can be used as a gene regulatory mechanism in a tissue specific fashion (Smibert et al,. 2012).
3’ end processing and polyadenylation occurs in conjunction with splicing. The last exon of a gene has a poly(A) signal instead of a 5’ splice site. Processing and removal of the last intron involves interactions between splicing components at the 3’ splice site of the last exon and the polyadenylation and cleavage complex at the poly(A) signal. In mammalian mRNAs the poly(A) signal is defined by two primary sequence elements: the AAUAAA hexamer, or the frequent variant AUUAAA, found 10–30 nt upstream of the cleavage site and the U/GU-rich downstream sequence element (DSE) located 30 nt downstream of the cleavage site. Five trans-acting factors are required for 3' processing, including the PAP and the four multi-subunit protein complexes: CPSF, cleavage stimulation factor (CstF), and CFIm and CFIIm (Reviewed in Yongsheng et al., 2009; Millevoi et al., 2010).
The choice of alternative poly(A) sites is regulated through auxiliary regulatory elements and poly(A) factor concentration. The presence of auxiliary regulatory elements such as U1A splicing factor flanking or partially overlapping the DSE can repress the use of an alternative poly(A) site. Other trans-acting factors that can influence alternative poly(A) selection include hnRNP F and the neuron-specific members of a family of RNA-binding proteins, the Hu proteins (reviewed in Millevoi et al., 2010).
Differential expression of constitutive poly(A) factors such as CstF64 and the CFIm subunits, CFIm25 and CFIm68, can also redirect the 3’ end processing machinery to alternative poly(A) sites. In most cases, this results in the selection of alternative poly(A) signals that inefficiently recruit the polyadenylation machinery due to the
113 presence of suboptimal cis-acting elements (Takagaki et al., 1996; Takagaki et al., 1998; Sartini et al,. 2008).
Alternative polyadenylation often involves poly(A) signals that lack canonical sequences. Database analyses show that up to 30% of polyadenylation events do not appear to involve an AAUAAA hexamer (or AUUAAA) and 0.5% do not possess either core element. A recent study on 3’ end formation of the melanocortin 4 receptor gene has identified an upstream A-rich sequence element that, in conjunction with a strong U/GU-rich downstream element, may be responsible for up to a third of polyadenylation events in mammalian cells that are not mediated by a canonical AAUAAA hexamer (Nunes et al., 2010).
3.4.3.2 Elements found in 3’UTRs The existence of Psc1 transcripts with variant 3’UTR could play a role in the regulation of Psc1. Regulatory elements in the 3’UTR rely on a combination of primary and secondary structure (reviewed in Mignone et al., 2002). There are no general rules on how secondary structure functions (Chen et al., 2006). A number of specific elements with particular functions have been characterised such as U-rich upstream sequence elements, AU-rich elements, GC rich sequences, C- or pyrimidine rich elements, AG-rich elements, Iron-responsive elements (IREs), and selenocysteine insertion sequences (reviewed in Chen et al., 2006; Filipowicz et al., 2008). miRNAs are predicted to target the 3' UTR of most human protein-coding genes (Kedde and Agami, 2008).
3.4.3.3 Psc1 transcripts with alternative 3’UTRs may be important in ES cell differentiation The exact nature of the Psc1 3’UTR variants is still unknown. It is not known if the consensus sites are functional, or if some polyadenylation occurs through non- canonical polyadenylation sites. The biological function of the Psc1 3'UTR is also unknown. It is known that both isoforms with long 3’UTRs and short 3’UTRs are
114 down regulated as ES cells differentiate. The transcripts with the short 3’UTRs are down regulated earlier and to a greater extent than the ones with the long 3’UTRs. This may suggest that regulation of Psc1 through 3’ UTR elements is important in ES cell differentiation and that the variant may have different functions, perhaps through differential cellular localisation, or may be linked to alternatively spliced coding variants. Further work needs to be carried out to determine the composition of the transcripts with the variant 3’UTRs and their relationships to the splice variants. The effect of alternative 3’UTRs on Psc1 mRNA needs to be determined. It is possible that as ES cells differentiate the expression of 3’ end and poly(A) factors, or auxiliary regulatory factors, changes such that poly(A) variants of a number of proteins, including Psc1, change. This has been well characterised during sperm cell development where alternative polyadenylation plays a central role in controlling stage dependent expression of distinct transcription factor isoforms during spermatogenesis, and this is regulated by the nature and amount of cleavage and poly(A) complexes which differ considerably in meiotic and haploid stages of spermatogenesis (Wang et al., 2006).
3.4.4 Is Psc1 important in ES cells and ES cell differentiation? Microarray analysis analyzing the global changes in gene expression between ES cells and EBM3 cells has been performed (Rathjen lab, unpublished data). Analysis of these data in relation to genes involved in RNA metabolism showed most genes involved in mRNA metabolism either remain constant or are up regulated during ES-EBM3 differentiation (Table 3.2). Only three out of 33 (9%) were found to be down regulated in a manner similar to Psc1. In addition to down regulation during ES cell differentiation, alternative splice variants (+/- exon 9, section 3.2.2) of Psc1 and Psc1 isoforms with different 3’UTRs are expressed in ES cells. The 3’UTR isoforms showed differential down regulation during ES cell differentiation. The function of Psc1 in ES cells appears to be highly regulated at both the transcriptional and mRNA level, supporting the idea that Psc1 plays an important role in ES cell biology.
115
Table 3.2: Expression of RNA metabolism genes during ES cell differentiation. The gene expression profiles of ES cells and EBM3 cells were analysed by microarray (Rathjen Lab, data not published). The expression of genes with known or potential roles in RNA metabolism that were present on the array chip was compared between the two cell types. In contrast to the Psc1 expression profile, the majority of RNA metabolism proteins are unchanged or are up regulated during ES-EBM3 differentiation.
116
Genes up regulated Genes showing no change Genes down regulated during ES-EBM3 in expression during ES- during ES-EBM3 differentiation EBM3 differentiation differentiation
SRp40 (NM_009159) SC-35 (NM_011358) D8Ertd633e (BC011412) U2AF (X64587) D11Ertd730e (BC013810) Sf3b1 (NM_031179) SRp20 (NM_013663) Sf3a3 (BC009141) Srp14 (NM_009273) Sf3a2 (NM_013651) Sart1 (NM_016882) KHSRp (AF094696) Sart3 (NM_016926) Fusip1 (NM_010178) Srpk2 (NM_009274) Sr104 protein (AJ250690) Srpk1 (NM_016795) Hnrpa1 (X78885) Pabpc2 (NM_011033) Lsm4 (NM_015816) Pabpc1 (NM_008774) Cyln2 (AF289664) Zfr (NM_011767) Tarbp2 (NM_009319) MKi67 (AY030275) SRp25 (AB035383) Srrm1 (NM_016799) Luc712 (AF318301) Hnrpc (NM_016884) Lsm2 (AF204154) Snrpb2 (X63020) Pnn (NM_008891) SRp75 (NM_020587)
117
CHAPTER 4
THE PSC1 PROTEIN: MODIFICATION AND
EXPRESSION
118
CHAPTER 4: THE PSC1 PROTEIN: MODIFICATION AND EXPRESSION
4.1 Introduction The characterisation of Psc1 expression in early development and in the adult has been carried out through analysis of Psc1 RNA. The Psc1 transcript is down regulated in vitro as ES cells differentiate, and this correlates with expression in vivo, as Psc1 is down regulated in the early mouse embryo in cells of the inner cell mass as they differentiate to primitive ectoderm (Pelton et al., 2002). While Psc1 mRNA expression has been characterised, little is known about the stability or translational regulation of the transcript. Similarly, little is known about the stability or expression of the Psc1 protein. All Psc1 constructs used in this chapter and amino acid numbering were based on the Schulz Psc1 splice variant (see sections 3.1 and 3.2.2).
In order to study endogenous Psc1 protein anti-Psc1 antibodies were generated (Kavanagh et al., 2005). Two anti-Psc1 antibodies were made, directed against amino acids 635-713 (anti-Psc1#95), and amino acids 2-79 (anti-Psc1#96) of Psc1. The anti- Psc1#95 antibody, shown to recognize Psc1 by immunofluorescence, was subsequently affinity purified, and is herein referred to as anti-Psc1.
This chapter describes the characterisation of Psc1 protein, examining the multiple isoforms of Psc1 that are observed on western blotting and the expression pattern of Psc1 protein during ES cell differentiation. As part of this work, it was discovered that Psc1 is modified by O-GlcNAcylation, and investigation of this modification is presented.
4.2 Western blot analysis of Psc1 Anti-Psc1 was generated against a 79 amino acid fragment of Psc1 located between the RRM and C-domain (Fig. 4.1), and was shown to detect Psc1 by immunofluorescence
119
120
(Kavanagh et al., 2005). The region against which the antibody was raised showed no significant homology to other known proteins, including the Psc1 homologue Rbm26 (BAC34721, see Figure 1.7), when analysed using the NCBI BLAST program (http://www.ncbi.nlm.nih.gov). Tagged and endogenous Psc1 proteins were used to test the specificity of the antibody and its ability to detect Psc1 on western blots.
4.2.1 Detection of GFP-Psc1 by western blot To test the specificity of the anti-Psc1 antibody a tagged Psc1 protein was used. COS- 1 cells were transfected with a construct encoding Psc1 with an N-terminal GFP tag (Kavanagh et al., 2005), with a predicted molecular weight of 139 kDa. Lysate from these cells was analysed by western blot (Fig. 4.2A). Probing with anti-GFP antibody detected a band of the predicted size, around 140 kDa, and a higher band of around 180 kDa. Western blot of the same lysate probed with anti-Psc1 antibody detected the same two bands, and an additional two bands of approximately 120 kDa and 160 kDa that matched two bands detected in un-transfected COS-1 cell lysate (Fig. 4.2A).
Immunoprecipitation of GFP-Psc1 transfected COS-1 cell lysate with anti-GFP antibody, followed by western blotting with anti-GFP antibody, detected 140 kDa and 180 kDa bands. No bands were detected from untransfected COS-1 cells (Fig. 4.2B).
GFP antibody specifically detected and immunoprecipitated GFP-Psc1, which is seen as a protein of two distinct sizes when analyzed by western blot, probed with either anti-GFP or anti-Psc1. Bands of two distinct sizes were also detected in untransfected COS-1 lysate using the anti-Psc1 antibody.
4.2.2 Detection of endogenous Psc1 from ES cells Analysis of the genomic sequence and splice variants of Psc1 predicts a full length protein of 119 kDa and potential splice variants of 112 and 108 kDa (see section 3.2.2).
121
122
Western blot analysis of ES cell lysate using the anti-Psc1 antibody was performed. Two predominant bands were detected, a lower band approximately 120 kDa, and an upper band of approximately 160 kDa (Fig. 4.3A). Higher resolution of the upper band showed it to be a doublet (Fig. 4.3 B). Over a number of experiments the lower band was always detected at a lower intensity than the upper band, and in some experiments the lower band was not detected at all (Fig 4.3A). Whether this was due to the band not being present, or the detection was not sensitive enough in those experiments, is unknown. Pre-immune serum from the rabbit in which the Psc1 antibody was raised did not detect any distinct bands matching the sizes detected with anti-Psc1 (Fig. 4.3A).
Immunoprecipitation of ES lysate with anti-Psc1, followed by western blotting with anti-Psc1, again showed a lower band of around 120 kDa and an upper doublet of around 160 kDa (Fig. 4.3 C). These bands were not the result of the antibody being present in the immunoprecipitation experiment, nor were they detected when the western was probed with secondary antibody alone. These results showed that anti- Psc1 specifically detects, and is capable of immunoprecipitating, a protein that migrates around 120 kDa, the predicted size of Psc1, and a protein or proteins that migrate as a doublet around 160 kDa.
Together, these results suggest that the anti-Psc1 antibody specifically recognizes Psc1, and that endogenous Psc1 (from ES cells and COS-1 cells) and exogenously expressed GFP-Psc1 migrate through acrylamide gels as two distinct isoforms, with an apparent size difference of approximately 40 kDa. In addition, this work has demonstrated that the anti-Psc1 antibody can immunoprecipitate Psc1. The anti-Psc1 antibody is, therefore, a useful tool for the study of Psc1.
4.3 Psc1 is post-translationally modified: Identification of the Psc1 modification Western blot analysis of endogenous Psc1 showed two distinct Psc1 isoforms, the larger of which appears as a doublet. What appeared to be the equivalent isoforms were
123
124 seen for the GFP-Psc1 fusion protein, suggesting Psc1 undergoes post-translational modification. The following experiments were performed to identify the nature of the modification(s).
4.3.1. Psc1 does not undergo post-translational cleavage Experiments were performed to test the hypothesis that the upper Psc1 doublet represents full length Psc1, migrating slower than expected, and the lower band represents a cleaved form. To determine if the C-terminus of Psc1 is cleaved, Psc1-HA, a construct containing an HA tag attached to the C-terminus of Psc1 (Kavanagh et al., 2005), was expressed in COS-1 cells. Cell lysate was immunoprecipitated with anti- HA antibody, and analysed by western blot probed with either anti-HA or anti-Psc1 antibodies (Fig. 4.4). Consistent with endogenous Psc1 and GFP-Psc1, Psc1-HA was also detected as two distinct bands migrating approximately 40 kDa apart, indicating that the lower Psc1 band was not the result of C-terminal cleavage of Psc1.
4.3.2 The post-translational modification effecting Psc1 migration in SDS PAGE occurs outside the identified Psc1 domains. Some post-translational modifications can be predicted through identification of consensus sequences within a protein. Many such sites can be identified within the Psc1 protein sequence using analysis programs such as those found at http://expasy.org/tools/. Many of the predicted sites are false positives and potential modifications need to be experimentally validated. In an attempt to narrow the search for the Psc1 modifications and identify the sites of modification within Psc1, Psc1 mutant constructs were analysed by western blot.
Previously generated Psc1 constructs (Kavanagh et al., 2005) that contain GFP-Psc1 lacking individual domains (Psc1 Δ N-domain, Psc1 Δ Zn finger, Psc1 Δ RS domain, Psc1 Δ RRM, and Psc1 Δ C-domain; Fig. 4.5A) were transfected into COS-1 cells Cell lysates were analysed by western blot probed with anti-GFP antibody.
125
126
Figure 4.5: Detection of Psc1 domain mutants and Psc1 domains by western blot. A) Table of Psc1 constructs and their calculated molecular mass based on sequence. B) GFP-Psc1 constructs lacking the individual Psc1 domains were expressed in COS-1 cells and lysates were analysed by western blot probed with anti-GFP. Two Psc1 bands were seen for GFP-Psc1 N-domain (lane 1), GFP-Psc1 RS-domain (lane 3), GFP- Psc1 RRM-domain (lane 4), GFP-Psc1 C-domain (lane 5), and full length GFP-Psc1 (lane 6). Only the upper band was seen with the GFP-Psc1 Zn finger-domain (lane 2). C) GFP constructs containing the individual Psc1 domains were expressed in COS-1 cells and lysates were analysed by western blot probed with anti-GFP. All of the individual domain constructs were detected at the expected size, and were seen as a single band.
127
128
All of the Psc1 constructs lacking the individual domains migrated around 40 kDa higher than their predicted molecular mass (Fig. 4.5B). Lower bands equivalent to the predicted size of the constructs were seen for Psc1 Δ N-domain, Psc1 Δ RS domain, Psc1 Δ RRM, and Psc1 Δ C-domain. No lower band was detected for the Psc1 Δ Zn finger construct. This may indicate that removal of the Zn finger domain results in increased efficiency of protein modification, but this would require further experimentation as lower band detection has been shown to be inconsistent. Although the Δ RS domain protein was only predicted to be 0.9 kDa smaller than the Δ RRM protein, both the upper and lower bands were observed to migrate distinctly lower than the Δ RRM protein upper and lower bands. This may have been caused by a difference in structure between the two proteins; alternatively it could suggest that the RS domain undergoes modification that effects its migration in SDS-PAGE, such as phosphorylation, a common and well characterised RS domain modification (see section 1.3.6, reviewed in Gourisankar et al., 2011).
Previously generated Psc1 constructs (Kavanagh et al., 2005) that contain the individual Psc1 domains (N-domain, Zn finger, RS domain, RRM, and C-domain; Fig. 4.5A) linked to GFP, were also transfected into COS-1 cells and cell lysates were analysed by western blot probed with anti-GFP antibody. All of the individual domains ran at the expected size, and only one band was detected for each construct (Fig. 4.5C).
The ∆-domain constructs all migrated around 40 kDa higher than expected, indicating that the deletions did not remove the modification that affects Psc1 migration in SDS PAGE. Consistent with these results, when expressed individually, the Psc1 domains migrated at the predicted size. These results suggest that the modification occurs in regions of Psc1 outside of the identified Psc1 domains.
4.3.3 MALDI-TOF as a method to determine Psc1 post-translational modification In a further attempt to identify the Psc1 post-translational modification Matrix Assisted Laser Desorption Ionisation – Time of Flight (MALDI –TOF) mass spectrometry was
129 used. Both endogenous Psc1 from ES cells and exogenously expressed GFP-Psc1 from COS-1 cells were analysed by this method.
Endogenous Psc1 was isolated by immunoprecipitation from ES cell lysate using anti- Psc1 antibody, separated by SDS-PAGE and visualized using coomassie blue staining (Fig. 4.6A). Ten per cent of the sample was western blotted with anti-Psc1 antibody (Fig. 4.6B). The coomassie stain showed the presence of a band the size of the upper Psc1 band in the IP lanes that was not present in the “no antibody” control lane. A band of the size of the lower Psc1 band was unable to be detected by coomassie stain. It was detected by western blot, but at a lower intensity than the upper band.
The Psc1 upper band detected by coomassie staining was extracted from the gel, digested with trypsin, and analysed by MALDI-TOF. Eight fragments corresponding to Psc1 were identified (Fig. 4.6C, D), covering 20% of the total protein and confirming that the upper band is Psc1. Peptide masses that did not match Psc1 fragments were analysed by “FindMod” predictive software (http://expasy.org/tools/findmod/). No matches were found for Psc1 fragments containing modifications.
In an attempt to achieve greater fragment coverage and to analyse the lower Psc1 band, MALDI-TOF analysis was carried out on purified GFP-Psc1. GFP-Psc1 was expressed in COS-1 cells, immunoprecipitated with anti-GFP antibody, separated by SDS-PAGE and visualized using coomassie blue staining (Fig. 4.7A). Ten per cent of the sample was western blotted with anti-Psc1 (Fig. 4.7B). Using coomassie staining the upper GFP-Psc1 band could again be clearly identified in the IP lanes, but not in the control “no antibody” lane. The lower band was observed in the western blot, but unfortunately was not at a high enough concentration to be detected by coomassie stain. Despite this, proteins from the area of gel corresponding to the location of the lower band were extracted, digested with trypsin and analysed by MALDI-TOF. No fragments clearly corresponding to GFP-Psc1 were identified in the samples from this region (data not shown).
130
Figure 4.6: Mass spectrometry analysis of endogenous Psc1 from ES cells. Psc1 was immunoprecipitated from ES cell lysate with anti-Psc1 antibody. A) Coomassie stained gel from which the upper Psc1 band was removed for mass spectrometry. Lanes 1 and 2 show immunoprecipitate containing the Psc1 upper band and multiple background bands, the lower Psc1 band is not visible. The no-antibody control (lane 3) shows background bands only. B) Samples were analysed by western blot probed with anti-Psc1. Psc1 was detected as two bands in the ES cell lysate (lane 1), no Psc1 was detected in the immunoprecipitation no antibody control (lane 2), and two bands were detected in a 10% sample of the immunoprecipitate (lane 3). C) The upper Psc1 bands from A) were removed from the gel, and digested with trypsin and analysed by a Q-TOF2 mass spectrometer. The monoisotopic forms of the component ions (m/z) and their charge state (z) were used to calculate the mass of the peptide plus one proton ([M+H]+). These values were compared to the predicted values of Psc1 peptides using PAWS with an error tolerance of 50 p.p.m. 8 peptides matching Psc1 were identified. No peptides indicating Psc1 modifications were detected. D) Schematic showing location of the peptides from Psc1 identified in this experiment.
131
132
Figure 4.7: Mass spectrometry analysis of GFP-Psc1. GFP-Psc1 was expressed in COS-1 cells and immunoprecipitated with an anti-GFP antibody. A) Coomassie stained gel from which the upper GFP-Psc1 band was removed for mass spectrometry. Lanes 1 and 2 show immunoprecipitate containing the GFP-Psc1 upper band and multiple background bands, the lower GFP-Psc1 band is not visible. The no- antibody control (lane 3) shows background bands only. B) Samples were analysed by western blot probed with anti-Psc1. Two bands were detected in a 10% sample of the immunoprecipitate (lanes 1 and 2, red asterisks), no GFP-Psc1 was detected in the immunoprecipitation no antibody control (lane 3). C) The upper GFP-Psc1 bands from (A) were removed from the gel, digested with trypsin and analysed by a Q-TOF2 mass spectrometer. The monoisotopic forms of the component ions (m/z) and their charge state (z) were used to calculate the mass of the peptide plus one proton ([M+H]+). These values were compared to the predicted values of Psc1 peptides using PAWS with an error tolerance of 50 p.p.m. 2 peptides matching GFP and 12 peptides matching Psc1 were identified. The peptide 477-498 showed evidence of modification by O-GlcNAc. D) Schematic showing location within Psc1 of peptides identified in this experiment (red arrows). Blue arrow: O-GlcNAc modified peptide.
133
134
The upper GFP-Psc1 band detected by coomassie staining was extracted from the gel, digested with trypsin, and analysed by MALDI-TOF. Two fragments corresponding to GFP, and 12 fragments corresponding to Psc1 were identified (Fig. 4.7C, D), covering 17% of the total protein. Peptide masses that did not match Psc1 fragments were analysed by “FindMod”
predictive software (http://expasy.org/tools/findmod/). A peptide mass that matched an O-linked ß-N-acetylglucosamine (O-GlcNAc) modification of the Psc1 fragment AANIVIQTEPPVPVSVNSNVTR (amino acids 477-498) was identified. This identification was considered significant as the peptide co-eluted with the unmodified peptide of the same sequence, a behaviour characteristic of glycoproteins (Sparbier et al., 2005).
Although a potential regulator of Psc1 function, modification of Psc1 by O- GlcNAcylation is unlikely to be the cause of the Psc1 isoforms. Firstly O- GlcNAcylation of other proteins (such as SP1) does not affect the molecular weight or passage of the protein through an acrylamide gel (Hart et al., 2007). Secondly the unmodified form of the 477-498 fragment was found to co-elute with the modified fragment, showing they were both present in the upper Psc1 band. Further experiments need to be performed to determine the characteristics of the Psc1 protein isoforms, and the cause of their differential migration by SDS-PAGE.
4.4 Characterisation of Psc1 O-GlcNAcylation The amino acid fragment 476-498 was identified by MALDI-TOF mass spectrometry as potentially being O-GlcNAcylated. The following experiments were performed to confirm and characterise Psc1 O-GlcNAcylation.
4.4.1 Validation of Psc1 O-GlcNAcylation O-GlcNAcylation of Psc1 was examined by western blotting using an antibody that recognises O-GlcNAcylated proteins (Affinity Bioreagents). Anti-Psc1 antibody was 135 used to immunoprecipitate either endogenous Psc1 from ES and COS-1 cells, or GFP- Psc1 from transfected COS-1 cells. All samples were run on duplicate acrylamide gels, and analysed by western blot probed with either anti-Psc1 or anti-O-GlcNAc antibodies (Fig. 4.8). Psc1/GFP Psc1 was successfully immunoprecipitated from all samples, and probing of the duplicate blots showed that Psc1 protein was detected by the anti-O- GlcNAc antibody. This confirms the results obtained by MALDI-TOF showing that Psc1 is modified by O-GlcNAcylation. Both bands of the upper Psc1 doublet were reactive with the anti O-GlcNAc antibody. The lower Psc1 band was not detected in these experiments by the anti-Psc1 or the anti-O-GlcNAc antibody.
4.4.2 Location of Psc1 O-GlcNAc modification Identification of the exact site of Psc1 O-GlcNAcylation would allow examination of the effect of O-GlcNAcylation on Psc1 properties and function. MALDI-TOF identified the 21 amino acid fragment corresponding to residues 477-498 of Psc1 as being O-GlcNAcylated. O-GlcNAcylation occurs on serine and threonine residues and, although there is no defined consensus sequence for O-GlcNAcylation, around 50% of the sites that have been mapped so far contain a Pro-Val-Ser motif (reviewed in Hart, 2007). Psc1 fragment 477-498 contains four potential O-GlcNAcylation sites, T484, S491, S494 and T497, with S491 being part of a Pro-Val-Ser motif. (Fig. 4.9A).
To determine which residue is modified by O-GlcNAcylation, site directed mutagenesis was used to create O-GlcNAc mutants in which the serine/threonine residues between amino acids 477-498 were replaced with alanine (Fig. 4.9A). . A mutant lacking the entire region between amino acids 483 and 498, removing all four serine/threonine residues, was also created (Fig. 4.9A). All mutants were generated in the GFP-Psc1 expression construct (Kavanagh et al., 2005).
The O-GlcNAc mutant constructs were expressed in COS-1 cells and immunoprecipitated with anti-Psc1 antibody. Samples were run on duplicate
acrylamide gels, and analysed by western blot probed with either anti-Psc1 or anti-O-
136
137
138
GlcNAc antibodies. All mutants were expressed, immunoprecipitated and detected with anti-Psc1. All constructs were reactive with the anti-O-GlcNAc antibody (Fig. 4.9B), suggesting that O-GlcNAcylation of Psc1 occurs on residues in addition to those within the fragment identified by mass spectrometry.
To determine if mutation of the potential O-GlcNAc sites in the region (477-498) affects O-GlcNAcylation of Psc1, semi-quantitative analysis was performed. The mutant constructs and a wild type control were expressed in COS-1 cells and immunoprecipitated with anti-Psc1 antibody. Equal volumes of immunoprecipitate were run on duplicate acrylamide gels, and analysed by western blot probed with either anti-Psc1, or anti-O-GlcNAc antibodies. The blots were developed using Enhanced Chemi-Fluorescence (ECF), allowing for the quantification of the emitted signals (Fig. 4.10A). Quantification of the results showed that, compared to the O-GlcNAcylation detected on wild type GFP-Psc1, the mutants showed a reduction of between approximately 40-45% (Fig. 4.10B). This suggests that the Psc1 fragment originally identified by MALDI-TOF is O-GlcNAcylated and that additional O-GlcNAcylation sites are present within Psc1. The individual mutant proteins and the ∆O-GlcNAc construct showed approximately the same level of reduction in O-GlcNAcylation suggesting that modification of one residue in the 484-497 region is sufficient to disrupt modification within the region. These results do not clarify which of the potential sites are modified, and potentially all four site are modified.
4.4.3 Additional locations of Psc1 O-GlcNAc modification In an attempt to identify the other sites of O-GlcNAc modification within Psc1, analysis of the Psc1 domain mutants (Psc1 Δ N-domain, Psc1 Δ Zn finger, Psc1 Δ RS domain, Psc1 Δ RRM, and Psc1 Δ C-domain) and Psc1 individual domains (N-domain, Zn finger, RS domain, RRM, and C-domain), was carried out (see Fig. 4.5A for description of constructs; Kavanagh et al., 2005). The constructs were expressed in COS-1 cells and immunoprecipitated with anti-GFP antibody. Samples were run on duplicate acrylamide gels, and analysed by western blots probed with either anti-GFP
139
Figure 4.10: Semi-quantitative analysis of the Psc1 O-GlcNAc mutants. The GFP-Psc1-O-GlcNAc mutants (see Figure 4.9A) were expressed in COS-1 cells and immunoprecipitated with anti-Psc1. A) Equal volumes of the immuoprecipitate was run on duplicate western blots, probed with either anti-Psc1 or anti-O-GlcNAc, and detected with ECF. B) Quantitative analysis using Quantity One software (Bio-Rad). The reactivity of the Psc1 O-GlcNAc mutants to the O-GlcNAc antibody was standardised against reactivity to the Psc1 antibody. All Psc1 O-GlcNAc mutants showed between ~ 30-50% reduction in reactivity to the O-GlcNAC antibody when compared to wildtype GFP- Psc1. Error bars = std dev. N = 3 biological repeats. All reductions of signal compared to GFP-Psc1 were significant with p = <0.01. There was no significant difference between the Psc1 O-GlcNAc mutants.
140
141 or anti-O-GlcNAc antibodies (Fig. 4.11A). All the mutants were detected by the anti- O-GlcNAc antibody. The Psc1 Δ RS domain mutant, however, showed a very small amount of reactivity to the anti-O-GlcNAc antibody in relation to the amount of the protein detected by anti-GFP. This suggests that the Psc1 RS domain is also a site for O-GlcNAcylation, or that the RS domain is required for O-GlcNAc of other sites in the protein. The individual Psc1 domains were expressed, immunoprecipitated and analysed in the same manner, and were not detected by the anti-O-GlcNAc antibody (Fig. 4.11B). Repeated attempts to detect the RS domain with anti-O-GlcNAc antibody failed (results not shown), suggesting that if the RS domain is modified by O-GlcNAc the RS domain alone does not contain either the correct consensus sequence or the correct secondary structure to be modified.
4.4.4 O-GlcNAcylation of Psc1 477-498 does not affect Psc1 sub-cellular localisation One of the characterised effects of O-GlcNAcylation is in the regulation of subcellular localisation for proteins such as Stat5 and Tau (Guinez et al., 2005; Lefebvre et al., 2003). The effect of the ∆O-GlcNAc mutation on Psc1 subcellular localisation was examined in COS-1 cells using fluorescence microscopy. GFP-Psc1∆O-GlcNAc localised to speckles within the nucleus and the cytoplasm, and in the same ratio seen with wildtype Psc1 (Fig. 4.12). When co-expressed with wildtype Psc1-HA construct (Kavanagh et al., 2005), GFP-Psc1∆ O-GlcNAc was found to completely co-localise with Psc1-HA, both in the nucleus and in the cytoplasm (Fig. 4.13). This suggests that the O-GlcNAcylation of Psc1 between amino acids 484-497 does not play a role in the subcellular localisation of Psc1.
4.5 Expression of Psc1 protein in differentiating ES cells The down regulation of the Psc1 transcript has been well characterised in the early mouse embryo and during ES cell differentiation (Pelton et al., 2002). However, it is unknown if the Psc1 protein follows this pattern. As an in-vitro model of early
142
Figure 4.11: O-GlcNAc modification of Psc1 domains. A) i. GFP-Psc1 constructs lacking the individual Psc1 domains were expressed in COS-1 cells, immunoprecipitated with anti-GFP, run on duplicate western blots and probed with either anti-Psc1 or anti-O-GlcNAc antibodies. All constructs were detected by both antibodies, however GFP-Psc1 RS-domain (lane 3), showed minimal reactivity to the O-GlcNAc antibody compared to full length Psc1. ii. Repeat sample of GFP-Psc1 RS-domain showing reduction in O-GlcNAc activity compared to full length GFP-Psc1. B) Constructs containing the individual Psc1 domains linked to GFP were expressed in COS-1 cells, immunoprecipitated with anti-GFP, run on duplicate western blots and probed with either anti-GFP or anti-O-GlcNAc antibodies. Full length GFP-Psc1 was detected by anti-O-GlcNAc (lane 1), however none of the individual GFP-Psc1 domains were.
143
144
145
146 embryonic development, ES cell differentiation was examined by western analysis to determine the expression of the Psc1 protein.
ES cells were differentiated as EBMs for 1, 2, 3 or 4 days (see sections 1.1 and 2.2.4.3). Samples were collected and analysed by western blot using anti-Psc1 antibody (Fig. 4.14). Psc1 protein was detected in all cell types. Total Psc1 protein remained constant between ES cells and EBM3 with a significant decrease observed at EBM4 to approximately 45% of the amount of Psc1 detected in ES cells (Fig. 4.14B). Analysis of the individual Psc1 isoforms showed differential regulation (Fig. 4.14B). The Psc1 upper band remained constant between ES cells and EBM3, with a significant decrease observed at EMB4 to approximately 25% of the amount detected in ES cells. The Psc1 lower band remained constant from ES to EBM4. In ES cells there is approximately 1.7 times more upper band to lower band, however by EBM4, the lower band is the predominant one, with an upper to lower band ratio of 0.56.
4.6 Discussion The anti-Psc1 antibody has facilitated the analysis of Psc1 protein expression and has shown that Psc1 undergoes post-translational modification, including multiple sites of O-GlcNAcylation.
4.6.1 Psc1 protein isoforms show variant migration in SDS PAGE Analysis of Psc1 by western blot detects bands of two distinct sizes, a single band of approximately 120 kDa (consistent with the calculated size), and an upper doublet of approximately 160 kDa. The identity of all three bands was confirmed as Psc1 by the use of N- and C- terminal epitope tagged Psc1 proteins. The upper bands were also confirmed to contain Psc1 by mass spectrometry. As all three bands were detected with exogenously expressed tagged-Psc1 cDNA constructs, the size difference could not be caused by splice variants showing Psc1 is post-translationally modified. The Drosophila homologue of Psc1, swm, has been shown to migrate as multiple bands of approximately 90, 130 and 150 kDa by western blot; the multiple isoforms of swm
147
148 were detected when a swm cDNA construct was exogenously expressed suggesting that it is post-translationally modified (Hurt et al., 2009). In chapter 6 of this thesis a yeast two hybrid screen to identify Psc1 binding partners is described. The Psc1 bait protein used in the screen, BD-Psc1, ran as a doublet around 30-40 kDa higher than expected when expressed in yeast cells (see section 6.2). Unlike mammalian cells, however, no bands of the predicted protein size were detected. These data suggest that in yeast, Drosophila and mammalian cells similar modifications occur leading to the doublet and a modified form of Psc1 that migrates in SDS-PAGE larger than the predicted size.
Attempts to identify the post-translational modifications responsible for the differently migrating Psc1 bands were unsuccessful. It was shown that Psc1 is not post- translationally cleaved and that it is modified by O-GlcNAcylation between amino acids 477-498 and at other sites. O-GlcNAc is a small, uncharged modification that usually does not alter the migration of proteins in gel electrophoresis, even on high resolution 2-dimensional gels (Hart et al., 2007). Some O-GlcNAc modified proteins have been reported to migrate slower than expected, such as ELF1, which has a molecular mass of 68 kDa, but migrates at 98 and 80 kDa. This is thought to be due to a combination of O-GlcNAc modification and phosphorylation (Juang et al., 2002). The O-GlcNAc of Psc1 region 477-498 does not cause the 40 kDa size shift, as the unmodified 477-498 fragment was also detected by mass spectrometry from the same upper band sample. The modification of Psc1 by other forms of glycosylation seems unlikely as these glycosylated proteins typically localise to luminal compartments and the cell surface, locations Psc1 is not found.
Aberrant migration in SDS-PAGE of SR and SRrp is often reported. SRp75 is observed to migrate with an apparent molecular mass of 93 kDa, although the calculated mass is only 57 kDa. SRrp130 has a calculated molecular mass of 93 kDa, but migrates at approximately 130 kDa. Other SR proteins such as SRp20, SRp30a, SRp30b and SRp55 are all seen to migrate at a higher molecular mass than predicted by their sequence. It is believed this is caused, at least in part, by extensive
149 phosphorylation of the proteins, particularly of their RS domains, as treatment of these proteins with phosphatases results in migration closer to that of their predicted size (Zahler et al., 1993; Zimowska et al., 2003). It is likely that phosphorylation affects the migration of Psc1 in SDS-PAGE; there are 52 high confidence phosphorylation sites predicted in the Psc1 sequence (NetPhos 2.0, score >0.9, http://www.cbs.dtu.dk/services/NetPhos/). Of these, 46 % are located in the RS domain, yet the RS domain mutant protein (Psc1 Δ RS domain) displayed both the upper and lower isoforms of the Psc1 protein, with a size difference of approximately 40 kDa (Fig. 4.5). Therefore, it seems unlikely that phosphorylation of RS alone causes the 40 kDa difference in Psc1 isoforms.
The SRrp Pinin has a predicted molecular mass of 88 kDa, but is observed to migrate around 140 kDa on SDS gels, similar to the shift seen for Psc1. Post-translational modification is considered to contribute to this shift, but it is thought that other factors, such as cross-linking to other proteins or atypical protein folding, are likely to be involved (Ouyang and Sugrue, 1996). Protein folding resulting in non-globular proteins is a common factor among proteins that migrate slower than predicted by SDS-PAGE (Himmler et al., 1989).
Psc1 is modified by O-GlcNAc, and the Psc1 RS domain is very likely phosphorylated. It seems most likely that a combination of the two, in association with a structural change (potentially caused by a particular O-GlcNAc and/or phosphorylation modification) causes the shift in mobility. Further experiments with phosphatases and O-GlcNAc inhibitors, along with mutant analysis would provide useful information. Comparison of Psc1 expressed in yeast and mammalian cells may provide insight into the post-translational modification that occurs on Psc1. Some post-translational modification in yeast differs from that in mammalian cells; for example yeast do not contain tyrosine kinases, and although N-glycosylation does occur in yeast, the oligosaccharide residues attached differ from mammalian cells (Wildt et al., 2005; Osborne et al., 1996). To compare the two, the same Psc1 construct containing either the same or no tag, contained in vectors with mammalian and yeast promoters could be
150 compared by western blot. If the products were different in size this could indicate glycosylation with different sugars. In addition, production of Psc1 in yeast with modifications could be used to produce and purify larger amounts for analysis by mass spectrometry. Further experiments to determine the functional difference in the Psc1 isoforms, for example whether the modification determines nuclear versus cytoplasmic localisation, and the cellular pathways that trigger the modifications will contribute to the understanding of Psc1 function.
4.6.2 O-GlcNAc modification In this work Psc1 was shown to be O-GlcNAcylated in at least two locations. O- GlcNAc modification involves the addition of N-acetylglucosamine to the hydroxyl group of serine or threonine residues. O-GlcNAc rapidly cycles on and off, similar to phosphorylation/dephosphorylation and this is regulated by two enzymes; uridine diphospho-N-acetylglucosamine:polypeptide beta-N-acetylglucosaminyltransferase (OGT) and O-GlcNAcase (OGA), which are responsible for the addition and removal of the O-GlcNAc modification respectively (reviewed in Vocadlo, 2012). The specificity of both enzymes is determined by their transient associations with other proteins to create multiple specific holoenzymes, allowing the single enzyme to modify specific sites on different proteins (Cheung et al., 2008). Identifying the exact site of O- GlcNAc modification of a protein is difficult due to the lack of a recognisable consensus motif for OGT or OGA. The activity of OGT is also dependent on levels of UDP-GlcNAc, which rapidly changes in concentration in response to a multitude of nutrient and environmental factors. O-GlcNAcylation is therefore very sensitive and responsive to the extracellular environment (Wells et al., 2001; Slawson et al., 2006). O-GlcNAc abnormalities underlie insulin resistance and glucose toxicity in diabetes, neurodegenerative disorders and dysregulation of tumor suppressors and oncogenic proteins in cancer (Reviewed in Hart et al., 2011; Whelan et al., 2008; Issad et al., 2010; Dias and Hart, 2007; Chatham and Marchase, 2010; Kamemura et al., 2002).
151
Many proteins with a diverse range of functions have been identified as being modified by O-GlcNAc, and it seems likely that O-GlcNAc modification has a significant role in RNA metabolism. Multiple core ribosomal proteins are O-GlcNAcylated, suggesting that O-GlcNAc modification may play a role in regulating mRNA translation and ribosome biogenesis (Zeidon et al., 2010). In addition, a recent large scale mass spectrometry based screen to identify O-GlcNAc modified proteins identified many proteins involved in RNA metabolism, including proteins of the hnRNP family, PABPC1, and Splicing factor 1 (SF1) (Soulard et al., 1993; Teo et al., 2010). Psc1 and the Psc1 homologue Rbm26 were also identified in the screen.
4.6.2.1 Potential functional significance of O-GlcNAc modification of Psc1 O-GlcNAc of proteins has been shown to have multiple effects including regulation of subcellular localisation, stability, and protein-protein interactions. (Slawson and Hart, 2003). O-GlcNAc of Pax6, Stat5 and Tau correlates with nuclear localisation of these proteins and it has been suggested that for some proteins O-GlcNAcylation may act as a signal for nuclear residence (Guinez et al., 2005; Lefebvre et al., 2003). O-GlcNAc has also been shown to effect cytoplasmic localisation, with a role in regulating the trafficking of β-catenin and E-cadherin to the cell surface of epithelial cells (Hart et al., 2007). O-GlcNAc modification can affect a protein through regulating and changing binding partners, for example the stress response protein Hsp70 is an O-GlcNAc binding protein. O-GlcNAcylation can have multiple effects on a single protein. For example O-GlcNAcylation of the transcription factor Sp1 leads to translocation into the nucleus, while a reduction in O-GlcNAc modification on Sp1 leads to degradation, and both hyper-GlcNAcylation and hypo-GlcNAcylation impair Sp1 activity (Wells et al., 2003; Brasse-Lagnel et al., 2003). Psc1 has been shown to be O-GlcNAc modified at a minimum of two sites suggesting that O-GlcNAcylation could regulate Psc1 in more than one way. The role of O-GlcNAc of Psc1 remains unknown. Immunofluorescence studies with a Psc1 construct lacking amino acids 484-497 showed that O- GlcNAcylation of this region did not regulate Psc1 subcellular localisation.
152
4.6.2.2 Future experiments on the O-GlcNAc modification of Psc1 Recent advances in mass spectrometry have led to large improvements in the identification of PTM sites on proteins. Electron-based, unimolecular dissociation MS, combined with higher energy collisional dissociation (HCD) MS can reliably map O- GlcNAc modification sites within a protein (Myers et al., 2013), and is a technique that could be used to identify the amino acids of Psc1 on which O-GlcNAc modifications occurs. Future studies on the effect of O-GlcNAc on Psc1 could make use of new compounds developed for the study of O-GlcNAcylation, such as highly selective inhibitors of OGA that can be used at nanomolar concentrations on live cells, and novel UDP-GlcNAc/UDP analogues that act as OGT inhibitors (Dorfmueller et al., 2010; Banerjee et al., 2013; Ostrowski et al., 2013). O-GlcNAc modification is highly responsive to the environment. The environmental factors and resultant signaling pathways that result in the O-GlcNAc of Psc1 will need to be determined to understand the significance of this modification of Psc1.
4.6.3 Characterisation of Psc1 protein expression during ES cell differentiation In this study the anti-Psc1 antibody was used to examine expression of endogenous Psc1 protein in differentiating ES cells. As ES cells differentiate Psc1 protein was seen to remain constant until EBM4, when expression dropped to approximately 45% of that in ES cells. This drop was attributed to a reduction in the upper band at EBM4, as the lower band remained constant. This demonstrates a difference between the expression of Psc1 mRNA, which is down regulated between ES and EBM2 cells (section 3.3.2), and Psc1 protein. A recent study of O-GlcNAc modification in differentiating ES cells showed that total O-GlcNAcylation decreased in differentiating ES cells, as did the expression of OGT (Kim et al., 2009). Potentially the O-GlcNAc of Psc1 could change as ES cells differentiate and O-GlcNAc is down regulated, and this may further regulate the function of Psc1 during this time.
153
4.6.4. Conclusion Psc1 was found to undergo multiple post-translational modifications; at least two sites of O-GlcNAcylation, and an unidentified modification that results in altered migration in SDS PAGE. This suggests that Psc1 can be regulated on multiple levels that may affect function, either directly or through alteration of subcellular localisation. In addition, the post-translational modification of Psc1 that resulted in the upper and lower bands was shown to vary during ES cell differentiation. Psc1 mRNA expression data presented in chapter 3 showed differential down regulation of the 3’UTR variant Psc1 transcripts during ES cells differentiation (section 3.3.2). Combined, these data show a high level of regulation of Psc1 at both the RNA and protein level during this early stage of development.
154
CHAPTER 5
IDENTIFICATION OF PSC1 INTERACTING
PROTEINS: INVESTIGATION OF
CANDIDATE PROTEINS
155
CHAPTER 5: IDENTIFICATION OF PSC1 INTERACTING PROTEINS: INVESTIGATION OF CANDIDATE PROTEINS
5.1 Introduction The sequence of Psc1 strongly suggests a role in RNA metabolism but the functions of Psc1 remain unknown. The identification of proteins that interact with Psc1 is a key step in determining Psc1 function. To identify Psc1 interacting proteins two independent approaches were taken. Firstly candidate proteins were identified from the literature and tested to determine if they interacted and/or localised with Psc1. The second approach was to identify Psc1 interacting proteins in a yeast two hybrid screen. The yeast two hybrid experiments are documented in chapter 6.
This chapter details experiments to determine if Psc1 interacts and/or co-localises with known proteins. Candidate proteins (SC35, SF2/ASF, S6, GW182, Coilin, Pabpn1) were chosen based on their function in RNA metabolism, and/or their sub cellular localisation.
5.2 Psc1 interacts with RS domain containing proteins Two key features of the Psc1 protein are the RS and RNA binding domains. These domains are found in the SR and SR-related family of proteins. This family of proteins is well characterised for its roles in splicing and multiple other elements of RNA metabolism, and these proteins are known to interact with one another through their RS domains (see section 1.3). It is already known that Psc1 co-localises with the SR proteins SF2/ASF and SC35 to nuclear speckles (Kavanagh et al., 2005). Experiments were carried out to determine if Psc1 interacts with SF2/ASF and SC35, and in addition to ask if Psc1 interacts with itself.
To determine if there was an interaction between Psc1 and SC35, SF2/ASF or itself, co-immunoprecipitation was performed. A C-terminally HA-tagged Psc1 was co-
156 expressed in COS-1 cells with GFP-SC35, GFP-SF2/ASF, GFP-Psc1 or GFP. Lysates were immunoprecipitated with either anti-GFP or anti-Psc1 antibodies and analysed by western blot (Fig. 5.1). Psc1-HA was immunoprecipitated with anti-GFP when co- expressed with GFP-SC35, GFP-SF2/ASF, or GFP-Psc1. Psc1-HA was not immunoprecipitated when expressed with GFP alone (Fig. 5.1 A, B, E). Attempts to perform the reciprocal immunoprecipitation using anti-Psc1 and probing for GFP-SC35 or GFP-SF2/ASF were more difficult to interpret as both proteins ran very close to the IgG bands (Fig. 5.1 C, D). Compared to the control lane of GFP alone, however, additional bands were observed. These results show that Psc1 interacts with SC35, SF2/ASF and itself.
To determine if the interaction of Psc1 with SC35, SF2/ASF and itself was a direct interaction or as part of a complex of proteins a yeast two hybrid based approach was used. A full description of the yeast two hybrid system is presented in chapters 2 and 6. Briefly; Psc1, SC35 and SF2/ASF were cloned into expression vectors from the CLONTECH Matchmaker 3 Two-Hybrid System. Psc1 was expressed as a fusion protein with the binding domain of the yeast GAL4 protein (BD-Psc1), SC35, SF2/ASF and Psc1 were all expressed as fusion proteins with the activation domain of the yeast GAL4 protein (AD-SC35, AD-SF2/ASF, AD-Psc1). When co-expressed, interaction of BD-Psc1 with AD-SC35, AD-SF2/ASF or AD-Psc1 activates expression of reporter genes (HIS3 and ADE2) under the control of a GAL4 promoter. The experiments were performed in a histidine and adenine deficient yeast strain (AH109) such that interaction of the proteins allowed yeast to grow on histidine and adenine deficient media.
AH109 yeast was co-transformed with BD-Psc1 and AD-SC35, AD-SF2/ASF or AD- Psc1 (Fig. 5.2). Yeast transformed with BD-Psc1 and AD-Psc1 was able to grow on media lacking both histidine and adenine. Yeast transformed with BD-Psc1 and AD- SC35 or AD-SF2/ASF was not. These results showed that Psc1 interacts directly with itself but were unable to prove a direct interaction between Psc1 and SC35 or SF2/ASF, suggesting that the interaction of Psc1 with SC35 or SF2/ASF shown by the co-immunoprecipitation experiments is likely to be as part of a protein complex. 157
Figure 5.1: Psc1 co-immunoprecipitates with SC35, SF2/ASF and itself. A) Psc1-HA was co-expressed with GFP-SC35 in COS-1 cells, immunoprecipitated with anti-GFP antibody and analysed by western blot probed with anti-Psc1 antibody. Psc1-HA co-immunoprecipitated with GFP-SC35 (lane 1) but not when expressed with GFP alone (lane 2). Psc1 was expressed in lysate (lane 3). B) Psc1-HA was co-expressed with GFP-SF2/ASF in COS-1 cells, immunoprecipitated with anti-GFP antibody and analysed by western blot probed with anti-Psc1 antibody. Psc1-HA co-immunoprecipitated with GFP-SF2/ASF (lane 1), but not when expressed with GFP alone (lane 2). C) Psc1-HA was co-expressed with GFP-SC35 in COS-1 cells, immunoprecipitated with anti-Psc1 antibody and analysed by western blot probed with anti-GFP antibody. The size of SC35 seen in the lysate (lane 1) was of similar size to the IGG band from the control GFP alone immunoprecipitation (lane 3). The Psc1-HA/GFP-SC35 immunoprecipitation (lane 2) was inconclusive, a band of the right size is detected (red asterisk) but may be an artefact of the IGG. D) Psc1-HA was co-expressed with GFP-SF2/ASF in COS-1 cells, immunoprecipitated with anti-Psc1 antibody and analysed by western blot probed with anti-GFP antibody. The size of SF2/ASF seen in the lysate (lane 1) was of similar size to the IGG band from the control GFP alone immunoprecipitation (lane 3). The Psc1- HA/GFP-SF2/ASF immunoprecipitation (lane 2) was inconclusive, a band of the right size is detected (red asterisk) but may be an artefact of the IGG. E) GFP-Psc1 and Psc1-HA were co-expressed in COS-1 cells, immunoprecipitated with anti-GFP, and analysed on duplicate western blots probed with anti-GFP or anti- HA antibodies. Anti-GFP immunoprecipitated GFP-Psc1 and Psc1-HA (lane 1). Psc1- HA was not immunoprecipitated when expressed with GFP alone (lane 2). GFP-Psc1 and Psc1-HA were expressed in lysate (lane 3).
158
159
160
161
In an attempt to determine the domain of Psc1 responsible for homo-dimerization, Psc1 mutant proteins lacking the N-domain, the RS domain and C-domain were cloned into Yeast two hybrid expression vectors and expressed as fusion proteins with the binding domain of the yeast GAL4 protein (BD-∆N-domain, BD-∆RS-domain, and BD-∆C- domain). The RS domain was chosen as it is a known protein-protein interaction domain (Manley and Tacke, 1996; Labourier et al., 1999), and the N-domain and C- domain were chosen as they are of unknown function.
The mutant constructs were coexpressed with AD-Psc1 in AH109 yeast (Fig. 5.3). The yeast were able to grow on media lacking both histidine and adenine, showing that Psc1 self interaction is likely to be mediated by regions outside of the N-domain, RS domain and C-domain.
5.3 Psc1 cytospeckles: comparison to cytoplasmic RNA metabolism proteins One of the unique characteristics of Psc1 is its localisation to speckles within the cytoplasm termed “cytospeckles” (see section 1.4.2). The functional relevance of cytospeckles is unknown, as is the identity of any cytospeckle component other than Psc1. Previous work has shown that cytospeckles do not co-localise with the endoplasmic reticulum, mitochondria, lysosomes, or the actin cytoskeleton, however, they do show partial co-localisation with microtubules (Kavanagh et al., 2005). In an attempt to identify a function for cytospeckles, the localisation of other proteins that function in cytoplasmic RNA metabolism was investigated.
5.3.1 Psc1 cytospeckles do not co-localise with the S6 ribosomal protein mRNA translation and protein synthesis occur throughout the cytoplasm on ribosomes which may or may not be associated with the rough ER. Ribosomes consist of a large riboprotein complex and form from the 40S and 60S ribosomal subunits (reviewed in Ramakrishnan, 2002). To determine if Psc1 cytospeckles co-localise with sites of mRNA translation, the S6 ribosomal protein was used as a marker. The S6 ribosomal protein is a component of the small ribosomal subunit, and phosphorylation of S6 in
162
163 response to growth factors and mitogens is known to increase translation (reviewed in Meyuhas et al., 2009). COS-1 cells were transfected with GFP-Psc1, then fixed and stained using an anti-S6 antibody (Fig. 5.4). Although both GFP-Psc1 and the S6 protein localised to punctuate speckles throughout the cytoplasm, close analysis of the staining showed that there was no co-localisation between the two proteins (Fig. 5.4Aii.). This suggests that Psc1 cytospeckles are not sites of mRNA translation.
5.3.2 Psc1 cytospeckles do not co-localise with GWBs Glycine- and tryptophan-rich cytoplasmic processing bodies (GW bodies)/ processing bodies (P bodies) localise to punctate structures within the cytoplasm and have a role in RNA metabolism. GWBs function in RNA silencing pathways, 5’-3’ mRNA degradation, RNAi, mRNA transport and stabilization. They contain translationally inactive mRNA, translation repression machinery, multiple decay factors and complexes such as the deadenylase protein Ccr4, the decapping complex Dcp1a/1b/Dcp2, and the exonuclease Xrn1. GWBs are juxtaposed to, transiently interact with, and share components with stress granules (SGs), which function to process aggregates of stalled translation preinitiaion complexes that occur during stress. GWBs also contain components of siRNA/miRNA pathways including the RNA-induced silencing complex (RISC) and the protein Argonaute2 (reviewed in Fritzler et al., 2007).
GWBs are highly dynamic structures, which change in size and number in response to nutrient availability, cell cycle, and cell proliferation. They are electron dense, 100-300 nm in diameter, and have no limiting membrane. They are named after the 182 kDa protein GW182 that was first localised to GWBs. GW182 is an autoantigen found in Lupus patients that contains multiple glycine (G) and tryptophan (W) repeats, as well as an RNA binding domain (Eystathioy et al., 2003). GW182 is thought to function in translational repression by interfering with mRNA circularization and recruitment of the deadenylase complex through interaction with PABPC1 (Zekri et al., 2009).
164
Figure 5.4: GFP-Psc1 does not co-localise with the S6 ribosomal protein. COS-1 cells expressing GFP-Psc1 were fixed and stained with anti-S6 antibody and visualised by indirect immuno-fluorescence. A) i. Anti-S6 (red) appeared as a diffuse speckled pattern throughout the cytoplasm, and was excluded from the nucleus. GFP-Psc1 localised to speckles in the nucleus and cytoplasm. ii. The white box in (i.) indicates the area of enlargement, showing the -S6 cytoplasmic speckles do not co-localise with GFP-Psc1 cytospeckles (green). B) -rabbit TRITC secondary antibody control. Nuclei were stained with Hoechst (blue). Size bars represent 10 µm.
165
166
To determine if Psc1 cytospeckles co-localise with GWBs an anti-GW182 antibody was obtained (a kind gift from Dr Martin Friztler). COS-1 cells stained with anti- GW182 show GWBs as punctuate cytoplasmic structures (Fig. 5.5). When GFP-Psc1 was expressed in COS-1 cells and the cells stained with anti-GW182 antibody, GFP- Psc1 cytospeckles were not found to co-localise with GW182, showing that Psc1 cytospeckles are not GWBs (Fig. 5.6A). In some cells expression of GFP-Psc1 did cause an alteration in the localisation of GW182 to larger, perinuclear structures in addition to GWBs (Fig. 5.6B). These structures were also seen when GFP alone was expressed (Fig. 5.6Biii.) suggesting they are artifacts resulting from exogenous gene over expression.
5.4 Psc1 does not localise to cajal bodies Most nuclear Psc1 is found in SC35 containing nuclear speckles, however, Psc1 is also found in smaller, more rounded, unidentified nuclear speckles that do not contain SC35 (see section 1.4.1.1; Kavanagh et al., 2005). A candidate for the identity of these additional speckles is the Cajal body.
The Cajal body is a small (0.5-1 μm in diameter), non-membrane bound nuclear organelle that is frequently localised to the nucleolar periphery. It is a dynamic structure that is seen to move, split and rejoin the nucleoplasm, with the size and number of cajal bodies dependent on the cell’s metabolic activity and the cell cycle stage (Gall, 2000; Cioce and Lamond, 2005). The Cajal body functions in snRNP biogenesis and recycling prior to the recruitment of snRNPs to the spliceosome. It is the site for the final steps in snRNP maturation, including snRNA base modification, U4/U6 annealing and snRNA-protein assembly. It also plays a role in the assembly of RNA polymerase I, II and III complexes (reviewed in Stanek and Neugebauer, 2006).
The protein Coilin was the first Cajal body marker discovered; the N-terminus of Coilin is required for Cajal body formation and the C-terminus for the accumulation of snRNPs within Cajal bodies (Andrade et al., 1991; Raska et al., 1991). To determine if
167
168
Figure 5.6: GFP-Psc1 cytospeckles do not co-localise with GWBs. COS-1 cells expressing GFP-Psc1 were fixed and stained with anti-GW182 and GWBs were visualised by indirect immuno-fluorescence. A) i. GWB staining (red) and GFP-Psc1 cytospeckles (green) localise in distinctly different staining patterns. ii. The white box in (i.) indicates the area of enlargement, showing GFP-Psc1 cytospeckles do not co-localise with GWBs. B) i. In many cells expression of GFP-Psc1 causes GWBs to become enlarged and irregular in shape. GFP-Psc1 does not co-localise with the enlarged GWBs ii. Enlarged GWBs occur even when GFP-Psc1 is localised in the nucleus only (Left hand cell; right hand cell shows normal GWBs). iii. Enlarged GWBs occur when GFP alone is expressed in COS-1 cells. Nuclei were stained with Hoechst (blue). Size bars represent 10 µm.
169
170
171
Psc1 localised to Cajal bodies immunofluorescence using an anti-Coilin antibody was performed. COS-1 cells stained with anti-Coilin identified the Cajal bodies as rounded structures in the nucleus, which varied in number between cells (Fig. 5.7A). When GFP-Psc1 was expressed in COS-1 cells and the cells stained with anti-Coilin antibody, GFP-Psc1 and Cajal bodies were often found to occur in the same regions of the nucleus (Fig. 5.7Bi). However, clear examples of GFP-Psc1 exclusion from regions of Cajal body staining were seen (Fig. 5.7 Bii, iii), showing that Psc1 does not co- localise with Coilin, with any apparent co-localisation likely to be an artifact of the microscopy. These results were confirmed by confocal microscopy (data not shown).
5.5 Psc1 interacts and co-localises with Pabpn1 In 2003 the results from a study to create a proteome interaction map of Drosophila melanogaster was published (Giot et al., 2003: FlyGRID The Drosophila General Repository for Interaction Datasets: http://biodata.mshri.on.ca/flygrid). A yeast two- hybrid-based approach had been used to generate a map with a high level of confidence showing 4679 proteins and 4780 interactions. In this study swm, the Drosophila homologue of Psc1, was found to interact with poly(A) binding protein 2 (PABP2; known as poly(A) binding protein nuclear 1, Pabpn1, in mammals).
Pabpn1 functions to facilitate and regulate poly(A) tail addition to nascent RNA transcripts. The 3’ end processing and addition of a poly(A) tail to an mRNA transcript can affect mRNAs’ nuclear export, translation and stability. Pabpn1 interacts directly with cleavage and polyadenylation specific factor (CPSF) and poly(A) polymerase (PAP), and leads to the activation of PAP activity. Pabpn1 is predominantly a nuclear protein, but is known to shuttle to the cytoplasm and has a role in the nuclear export of poly(A) mRNA (reviewed in Kühn and Wahle, 2004; Apponi et al., 2010). Experiments were performed to investigate the interaction of mouse Pabpn1 and mouse Psc1.
172
Figure 5.7: Immunofluorescence detection of the Cajal body marker Coilin in COS-1 cells. A) COS-1 cells were fixed and stained with anti-coilin and Cajal bodies were visualised by immuno-fluorescence. Cajal bodies (red) were detected as small punctate speckles that varied in number in the nucleus (red arrow heads) i. Single Cajal bodies; ii. 2-3 Cajal bodies. iii. Anti-rabbit TRITC secondary antibody control. B) COS-1 cells expressing GFP-Psc1 were fixed and stained with anti-coilin and Cajal bodies were visualised by indirect immunofluorescence. Although Cajal bodies (red) occurred in the same regions as GFP-Psc1 (green) nuclear speckles (i. red arrowhead), clear examples of GFP-Psc1 exclusion from regions of Cajal body staining were seen (ii., iii. red arrowheads). Nuclei were stained with Hoechst (blue). Size bars represent 10 µm
173
174
175
To confirm an interaction between Psc1 and Pabpn1 co-immunoprecipitation was performed. Psc1-HA and GFP-Pabpn1 (a kind gift from Dr A. Calado; Calado et al., 2000a) were co-expressed in COS-1 cells, lysates were immunoprecipitated with anti- GFP antibody, and analysed by western blot (Fig.5.8). Analysis of lysate from the tranfected cells showed that both Psc1-HA and GFP-Pabpn1 were expressed. Although predicted to run at a molecular weight of 61 kDa (33 kDa + GFP 28 kDa), GFP- Pabpn1 was detected as a single band around 75-80 kDa. Immunoprecipitation of GFP- Pabpn1 with anti-GFP resulted in immunoprecipitation of GFP-Pabpn1 and Psc1-HA. This was not seen when Psc1-HA was expressed with GFP alone. These results confirm the interaction between Psc1 and Pabpn1, and show that it is conserved between Drosophila and mammals.
Pabpn1 has previously been shown to localise to the nucleus and to nuclear speckles, and has been found to shuttle between the nucleus and the cytoplasm (Calado et al., 2000a; Calado et al., 2000b). To investigate the sub cellular localisation of Pabpn1 and its relationship to Psc1, GFP-Pabpn1 was expressed in COS-1 cells (Fig.5.9). GFP- Pabpn1 was seen to localise exclusively to the nucleus. The majority of cells showed a diffuse staining pattern throughout the nucleus but excluding nucleoli, however, some cells did show localisation to nuclear speckles. This matched previous descriptions of GFP-Pabpn1 localisation and is similar to endogenous Pabpn1 (Calado et al., 2000a).
When GFP-Pabpn1 was co-expressed with Psc1-HA the two proteins were found to co- localise within the nucleus (Fig. 5.10A). Both Pabpn1 and Psc1 were found to localise to nuclear speckles (Fig. 5.10Ai., ii.) in addition to diffuse staining throughout the nucleus (Fig. 5.10Aiii.). Although Psc1 expressed alone does show some diffuse staining in the nucleus, the majority of Psc1 in the nucleus is normally found in nuclear speckles. The exogenous expression of Pabpn1 appears to cause a redistribution of Psc1 from nuclear speckles. GFP-Pabpn1 was not seen to localise to the cytoplasm even when co-expressed Psc1-HA localised to cytospeckles (Fig. 5.10B).
176
177
178
Fig 5.10: GFP-Pabp2 co-localises with Psc1-HA in the nucleus, but not in the cytoplasm: COS-1 cells expressing GFP-Pabp2 and Psc1-HA were fixed, stained with anti-HA and analysed by immunofluorescence. A) Psc1-HA (red) co-localises with GFP-Pabp2 (green) to (i) nuclear speckles, (ii) larger nuclear speckles and (iii) diffuse throughout the nucleus. B) GFP-Pabp2 does not localise to the cytoplasm or cytospeckles, even when co- expressed Psc1-HA localises to cytospeckles. Nuclei stained with Hoechst (blue). Size bars represent 10 µm
179
180
181
These results show that the interaction between Psc1 and Pabpn1 is conserved between Drosophila and mammals, and that they appear to interact in the nucleus, but not in cytospeckles.
5.6 Discussion In this chapter experiments were performed to further characterise Psc1 through identification of protein binding partners, or through identification of proteins that co- localise with Psc1.
5.6.1 Psc1 interacts in a complex with SC35 and SF2/ASF As Psc1 is an SR-related protein experiments were performed to investigate potential interactions with other RS domain containing proteins, SC35, SF2/ASF and Psc1 itself. Psc1 was shown to co-immunoprecipitate with SC35 and SF2/ASF but to not directly interact with either. This suggests that Psc1 is found in a multiprotein complex with SC35 and SF2/ASF. SC35 and SF2/ASF participate in a wide range of RNA related processes, including splicing, mRNA nuclear export, mRNA stability and mRNA translation with most steps involving complexes of multiple proteins and both coding and non-coding RNA (see section 1.3). Many studies have focused on characterising proteins involved in the spliceosome and various splicing complexes, with 40 publications reporting the results of over 135 individual MS experiments analysing the protein make up of endogenous splicing complexes isolated from cells or complexes assembled in vitro (reviewed in Cvitkovic and Jurica, 2013). From these studies, one has identified Psc1 as a spliceosomal associated protein (Chen et al., 2007). The Chen study isolated large (>200S) endogenous splicing complexes in the form of supraspliceosomes or polyspliceosomes that are known to form in vivo (reviewed in Azubel et al., 2006; ), and isolated over 300 spliceosomal associated proteins, in contrast to the ~200 proteins identified in other studies that used in vitro assembled spliceosomes. As Psc1 has only been identified in one study this would suggest that Psc1 is not a core component of the spliceosome or spliceosomal complexes. It remains possible, however, that under the right conditions Psc1 may interact with spliceosomal
182 complexes and potentially form a complex with SC35 or SF2/ASF during splicing. To identify the complexes and processes which involve Psc1 and SC35/SF2/ASF identification of other proteins in the complex would need to be pursued, for example by immunoprecipitation of the complexes followed by protein identification by mass spectrometry, as has been used successfully to identify and quantitate the many proteins associated with the spliceosome and various spliceosomal complexes (Merz et al., 2007; Tkacz et al., 2010; Bessonov et al., 2010; Yates et al., 2009).
5.6.2 Psc1 self interacts Psc1 was shown to interact with itself by co-immunoprecipitation and this interaction was shown to be direct using yeast two hybrid assays. The self interaction of Psc1 has a number of potential functions. It may regulate Psc1 through a direct effect on the structure or behaviour of the Psc1 protein, or through the blocking or promotion of interaction with other Psc1 binding proteins. Psc1 self interaction may increase the efficiency of Psc1 function by facilitating localised concentration of Psc1, and may be linked to the creation of Psc1 speckles including cytospeckles.
5.6.3 Psc1 speckles are not sites of cajal bodies, RNA translation or GWBs In addition to SC35 containing nuclear speckles, Psc1 also localises to uncharacterised nuclear speckles that do not contain SC35 and to speckles in the cytoplasm or “cytospeckles”. In this study other RNA metabolism proteins that have punctate localisation patterns were examined for co-localisation with Psc1.
It was found that Psc1 did not co-localise with the Cajal body marker protein coilin, showing that the Psc1 non-SC35 nuclear speckles are not cajal bodies. Psc1 cytospeckles were found to not co-localise with the S6 ribosomal protein or GW182, showing that cytospeckles are not sites of translation or GWBs/P bodies.
183
5.6.4 Mouse Psc1 interacts with Pabpn1 Psc1 and Pabpn1 were shown to interact by co-immunoprecipitation showing that the interaction between Psc1/swm and Pabpn1/PABP2 is conserved between Drosophila and mouse. In the Drosophila study the interaction was shown by yeast two hybrid to be direct (Giot et al., 2003). The domains of interaction remain unknown and require further study.
The functions of the Psc1 domains remain largely unknown, however the domains of Pabpn1 are well characterised. Pabpn1 has three identified domains, a glutamate rich N-terminal domain, a central ribonucleoprotein type RNA binding domain (RNP domain), and an arginine rich C-terminal domain that contains an RGG type RNA binding domain (Kuhn and Wahle 2004; Kuhn et al., 2003). The RNP domain binds specifically to poly(A) RNA, whereas the C-terminal RBD binds non-specifically to RNA and other polyanions (Kuhn et al., 2003, Melo et al., 2003). The RNP is essential but not sufficient for poly(A) RNA binding, with full affinity only seen in presence of the C-terminal domain (Kuhn et al., 2003). The C-terminus has been found to promote self association of Pabpn1, binding to PAP and CPSF, and contains a nuclear localisation sequence (Kuhn et al., 2003; Calado et al., 2000a; Calado et al., 2000b). The N-terminal domain is not required for RNA binding but is essential for the stimulation of PAP during polyadenylation, and appears to inhibit unwanted PAP binding in the absence of RNA (Kerwitz et al., 2003).
5.6.5 Potential functions of the interaction between Psc1 and Pabpn1
5.6.5.1 A role for Psc1 and Pabpn1 in mRNA nuclear export Pabpn1 is known to have a role in the nuclear export of mRNA. Pabpn1 is a nuclear/cytoplasmic shuttling protein (Calado et al., 2000a) and undergoes carrier mediated export and import functions via interaction of the C-terminal domain with transportin (Calado et al., 2000b). Pabpn1 is found bound to RNA while docking at the nuclear pore and on the cytoplasmic side of the nuclear envelope (Benoit et al., 2005). 184
In vivo removal of Pabpn1 by siRNA leads to nuclear accumulation of poly(A) RNA (Apponi et al., 2010), and mRNA lacking a functional poly(A) tail is retained in the nucleus (Mangus et al., 2003). Further evidence of the role of Pabpn1 in the nuclear export of mRNA has come from a study researching mRNA nuclear export in Drosophila (Farny et al., 2008). A genome wide screen was performed in Drosophila S2 cells using RNAi to identify proteins whose deletion caused a deficit in poly(A) RNA nuclear export. This study identified PABP2 and 71 other proteins. Swm was also identified in this screen. This would suggest that the interaction of Pabpn1 and Psc1 may function in the process of poly(A) mRNA nuclear export.
Further detail of this process has come to light from research on another protein identified in the Drosophila nuclear export study (Farny et al., 2008). CG6694/dZC3H3, a protein containing three CCCH type Zn fingers, similar to the swm/Psc1 Zn finger, and showing sequence homology to Drosophila CPSF, has been shown to mediate mRNA export by binding directly to the mRNA export protein NXF1 (Tap in humans), which in turn interfaces with the nuclear pore complex. dZC3H3 has been shown to bind to 28 proteins, including PABP2 and swm. The interaction between dZC3H3 and PABP2 or dZC3H3 and swm is partially sensitive to RNAse treatment, and purification of poly(A) RNA co-immunoprecipitates dZC3H3 and swm. This has led to a model where dZC3H3, swm, PAPB2 and NXF1 function together in a complex to export mRNA that may be held together by the tethering of a common RNA molecule as well as protein-protein interactions. Human ZC3H3 was shown to have a conserved role in nuclear export of mRNA, with siRNA resulting in nuclear accumulation of poly(A) RNA (Hurt et al., 2009).
The role of Psc1 in nuclear export of mRNA requires further investigation. The interaction of dZC3H3 with swm was reported after the experimental work for this thesis was completed. It seems likely that Psc1 and ZC3H3 interact in mammalian cells, but this would need to be confirmed. As SF2/ASF is known to be involved in mRNA nuclear export, and Psc1 and SF2/ASF were shown to co-immunoprecipitate,
185 determining whether Psc1 and SF2/ASF interact in the context of mRNA nuclear export should be investigated.
5.6.5.2 Pabpn1 and its role in polyadenylation and 3’end processing Pabpn1 is best characterised in its role in polyadenosine tail extension. The addition of a poly(A) tail to an RNA transcript involves a large protein complex containing many trans-acting factors such as CPSF, CstF, CFIm, CFIIm, and PAP. In vitro, Pabpn1 has been shown to directly interact with CPSF and PAP and both stimulate rapid, processive poly(A) addition, and control the length of the tail to approximately 250 nt through the termination of processive elongation (Mandel et al., 2008; Kuhn et al., 2004). The mechanism is thought to involve the binding of Pabpn1 to RNA causing an approximately 80% increase in the affinity of PAP for RNA, without any direct effect on the catalytic efficiency of PAP (Kerwitz et al., 2003).
In vivo, the role of Pabpn1 in polyadenylation is still being determined. The removal of Pabpn1 by siRNA in mouse myoblasts has been shown to cause a reduction in mRNA poly(A) tail length of approximately 50% (Apponi et al., 2010). PABPN1 depletion from human cells, however, has been shown to have no effect on poly(A) tail length (Bhattacharjee and Bag, 2012). Depletion of PABPN1 was accompanied by nuclear accumulation of PABP4, a little studied member of the PABP family that is normally localised in the cytoplasm. PABP4 was associated with the poly(A) tract of pre-mRNA and CPSF in PABPN1 depleted cells, suggesting some level of compensation and redundancy (Bhattacharjee and Bag, 2012). In humans, mutations in the PABPN1 gene cause the disease oculopharyngeal muscular dystrophy (OPMD) (reviewed Brais, 2009). In diseased muscle cells from OPMD patients poly(A) tail length is not affected, suggesting PABPN1 is not required for polyadenylation in these cells (Calado et al., 2000b). In OPMD tissue mRNA 3'UTR length, however, has been found to be affected (Jenal et al., 2012; de Klerk et al., 2012). Recent research has shown that Pabpn1 is a key regulator of alternative cleavage and polyadenylation (APA) in mammalian cells, playing a key role in the determination of the 3'UTR length, and thereby potential
186 regulatory control, of mRNA. Pabpn1 is thought to coordinate 3'end processing complexes and play a role in recognition of the poly(A) sites, in addition to any role it may have in polyadenylation itself (de Klerk et al., 2012; Jenal et al., 2012). The complexes involved in 3’end processing are well studied and to date Psc1 has not been identified (Shi et al., 2009; Mandel et al., 2008). It seems unlikely, therefore, that Psc1 is involved in 3’end processing and poly(A) tail extension directly.
5.6.5.3 Pabpn1 and exosome activity/deadenylation In Drosophila oocytes and early embryos maternal mRNAs such as Oskar and cyclin B are stored in the cytoplasm and regulated through the control of poly(A) tail length such that mRNA with short tails are lengthened to activate translation and mRNA with long tails are shortened to deactivate translation (reviewed in Barckmann et al., 2013). PABP2 functions in these cells to bind maternal transcripts and facilitate poly(A) tail shortening through interaction with the deadenylase CCR4.
In S.Pombe the PABP2 yeast homologue Pab2 was found to function in the synthesis of small nucleolar RNAs (snoRNAs), and promote poly(A) trimming through the recruitment of the nuclear exosome. The exosome consists of 9 catalytically inactive peptides and the 3’-5’ exonuclease Rrp41/Dis3. In the nucleus, exosome activity can also be associated with the 3’-5’ exonuclease Rrp6, with Rrp41 and Rrp6 having distinct roles in RNA processing (Perreault et al., 2007; Lemay et al., 2010). Pab2 was shown to interact directly with Rrp6. Rrp6 was identified as a protein involved in mRNA nuclear export in the Drosophila screen that also identified PABP2, dZCH3C3 and swm (Farny et al., 2008). RNAi of dZCH3C3 leads to hyperadenylation of RNA potentially suggesting a fault in exosome processing (Hurt et al., 2009).
In human cells, siRNA knockdown of PABPN1 identified a class of PABPN1- sensitive long noncoding RNAs (lncRNAs). PABPN1 has been shown to promote lncRNA turnover via a polyadenylation-dependent mechanism whereby PABPN1- sensitive lncRNAs are targeted by the RNA exosome complex. Although most of the
187 lncRNAs misregulated in PABPN1-depleted cells are uncharacterised, some of the genes encoding PABPN1-sensitive lncRNAs are host to small nuclear (sno) RNAs and small Cajal body-specific (sca) RNAs in their introns (Beaulieu et al., 2012). In humans, most snoRNAs reside in intronic sequences, a fraction of which are found in introns of non-protein coding genes (Dieci et al., 2009). Nuclear exosome processing, mRNA nuclear export, Pabpn1 and ZCH3C3 all appear to be linked, suggesting that Psc1 could potentially be involved with exosome activity and possibly snoRNA biogenesis.
5.6.5.4 Pabpn1 and its role in translation Pabpn1 is mostly nuclear and generally associates with transcripts prior to splicing. It can, however, co-purify with the cytoplasm and remain associated with mRNA during the pioneer round of translation (Hosada et al., 2006). The exact role of Pabpn1 in translation is unknown, but studies have shown that it associates with several ribosomal proteins, translation factors, and polysomes (Lemieux et al., 2009; Lemay et al., 2010). Some studies suggest that pioneer translation augments the removal of Pabpn1, replacing it with PABPC1. In yeast, ultracentrifugation experiments have identified Pab2 in ribosome containing fractions, with approximately 25% of Pab2 found to be ribosome associated, consistent with a role in translating mRNPs beyond pioneer translation (Lemieux et al., 2009). The role of Pabpn1 in translation is yet to be determined. Psc1 did not co-localise with the S6 ribosomal protein suggesting that Psc1 is not associated with ribosomes. Further biochemical studies such as fractionation experiments need to be conducted to see if Psc1 remains associated with Pabpn1 in the cytoplasm following nuclear export, and in the polysome fractions. Co-localisation experiments with Pabpn1 and Psc1 showed that Pabpn1 was not detectable in the cytoplasm and did not co-localise with Psc1 to cytospeckles.
The extent of Pabpn1 function is not well understood. A mass spectrometry based screen to identify binding partners found proteins with a wide range of RNA related functions, including ribosomal proteins, translation factors, PABPC, PAP, RNA
188 helicase Mtr4, 5’-3’ exonuclease Exo2, mRNA decapping subunit Dcp2, nuclear cap binding protein Cbp80, mRNA export proteins Thp1, Mtr10 and Mtr2, Sof1 snoRNA binding and ribosome biogenesis (Lemieux et al., 2009). The functional relevance of the interaction between Pabpn1 and Psc1 could potentially impact on multiple aspects of RNA metabolism.
5.6.6 Summary In this chapter the identity of non SC35 Psc1 nuclear speckles and Psc1 cytospeckles was not resolved. Psc1 was shown to interact in a complex with SC35 and SF2/ASF, and directly interact with itself and Pabpn1. The interaction of Psc1 and Pabpn1 seems likely to be involved in the nuclear export of mRNA, and would be the first identified function to be attributed to Psc1. It also seems possible that Psc1 may be involved with other aspects of Pabpn1 function, such as nuclear exosome activity and potentially snoRNA maturation.
189
CHAPTER 6
IDENTIFICATION OF PSC1 INTERACTING
PROTEINS USING A YEAST TWO HYBRID
SCREEN
190
CHAPTER 6: IDENTIFICATION OF PSC1 INTERACTING PROTEINS USING A YEAST TWO HYBRID SCREEN
6.1 Introduction Psc1 amino acid sequence and subcellular localisation suggest a role for Psc1 in RNA metabolism. Other SR and SRrps function in multiple steps of RNA biology from splicing to RNA translation and degradation. Identification of Psc1 interacting proteins could provide information on the processes in which Psc1 is involved, its mechanism of action, as well as providing clues to its potential role in developmental processes.
This chapter details the use of a yeast two hybrid screen to identify Psc1 interacting proteins. A number of positive interactors were identified, including the SRrp Sart1. Further investigation of the relationship between Psc1 and Sart1 is presented in this chapter.
6.2 Yeast two hybrid screen details To identify proteins that interact with Psc1 the MATCHMAKER GAL4 Two-Hybrid System 3 (CLONTECH) was used to screen a testis cDNA library (see section 2.3.6.2). As Psc1 was originally isolated from ES cells and has a potential role in early development, an ES cell cDNA library was first preference. As an ES cell library was not available at the time of this screen a testis cDNA library was chosen, based on the pluripotent nature of the germ cells and the high expression of Psc1 in the testis (determined by western blot, data not shown). In the yeast two hybrid screen, Psc1 was expressed as a fusion protein with the Gal4 binding domain (BD-Psc1) and proteins from the mouse testis cDNA library were expressed as fusion proteins with the Gal4 activation domain (AD-library). The yeast two hybrid screen was performed in AH109 yeast, a strain in which the expression of the essential amino acids histidine (His) and adenine (Ade) are under the control of a Gal4 upstream activation sequence (UAS).
191
To test that the BD-Psc1 construct was correctly expressed in the AH109 yeast, extract from transformed yeast was analyzed by western blot probed with anti-Psc1 antibody. A doublet of approximately 160 kDa was seen in extract from the transformed yeast, but not in the untransformed control (Fig. 6.1). The BD-Psc1 fusion protein has a predicted molecular weight of 132 kDa. The protein detected on the western blot was larger than expected and seen as a doublet, similar to what is observed in mammalian cells (see section 4.2), suggesting that post-translational modification of Psc1, as seen in mammalian cells, also occurs in yeast.
To ensure that the BD-Psc1 construct did not activate the reporter genes by itself, yeast expressing BD-Psc1 were grown on plates lacking His, or lacking His and Ade. While the yeast was capable of growing on complete media, no growth was seen on either of the deficient media, demonstrating that BD-Psc1 alone was unable to activate the reporter genes (data not shown).
To perform the screen, vectors containing the testis cDNA library were transformed into yeast expressing BD-Psc1. The transformed yeast was plated on –Leu, - Trp, -His plates to select for transformants that contained both AD and BD vectors and showed interaction between Psc1 and the library protein: 604 colonies grew. To reduce false positives and increase the level of stringency, the 604 colonies were re-streaked onto – Leu, - Trp, -His, -Ade plates. Thirteen of the 604 colonies grew. DNA was isolated from the 13 colonies and the library insert was sequenced (Table 6.1). Clones #4 (ATP- synthase) and #10 (Mitochondrial Ribosomal protein L48) were identified as common yeast two hybrid false positives (www.fccc.edu/research/labs/golemis/InteractionTrapIn Work.html) and were not investigated further. Clones 1 and 3 were unidentified cDNA sequences that were completely uncharacterised. Clones 2, 9, 11 and 12 were cDNA sequences that contained identified domains but were themselves uncharacterised and clones 5, 6, 7, 8 and 13 were characterised proteins.
192
193
Colony sequence reference # Gene name 1 MGI:2685897 unidentified cDNA 2 MGI:1913977 HRAS-like suppressor family, member 5 (Hrasls5) 3 MGC:58365 unidentified cDNA 4 MGI:1913293 ATP-Synthase * 5 MGI:1098824 Outer Dense fiber of Sperm 2 (ODF2) Hepatocyte growth factor-Regulated tyrosine kinase 6 MGI:104681 Substrate (HRS) 7 MGI:1341822 Eukaryotic Initiation Factor 4H (eIF4H) Squamous cell carcinoma Antigen Recognized by T-cells 1 8 MGI:1309453 (Sart1) 9 MGI:1914437 Zinc Finger MYND domain containing 19 (Zmynd19) 10 MGI:1289321 Mitochondrial Ribosomal protein L48 * 11 MGI:2674071 MORN repeat containing 2 (Morn2 ) Oligonucleotide/Oligosaccharide binding fold containing 2A 12 MGI:1923258 (Obfc2A) 13 MGI:102553 Cysteine Rich Secretory Protein 1 (CRISP-1)
Table 6.1: Psc1 interacting proteins identified in yeast two hybrid screen. * common yeast two hybrid false positive.
194
6.2.1 Uncharacterised Psc1 interacting proteins Clone #2 was identified as the gene HRAS-Like Suppressor family, member 5 (Hrasls5, MGI:1913977 ). Hrasls5 was identified in a genomic screening process (Kawai J et al., 2001). The HRAS like suppressor family are calcium-independent phosphatidylethanolamine N-acytlytransferases, but little more is known about them.
They function to N-acylate phosphatidylethanolamine (PE) to form N- acylphosphatidylethanolamine, the initial step in the biosynthetic pathway of bioactive N-acylethanolamines, including the endocannabinoid anandamide and the anti- inflammatory substance N-palmitoylethanolamine. They have also been shown to acylate other phospholipids such as phosphatidylcholine (Jin et al., 2009).
Clone #9 was identified as the gene Zinc Finger MYND domain containing 19
(Zmynd19, MGI:1914437 ). A MYND domain is a zinc finger domain named after the proteins it was originally identified in; Myeloid translocation protein 8, Nervy, and Deaf1. MYND domains are characterised by a cysteine repeat motif and were first identified as a protein-protein interaction domain of nuclear proto-oncogenes involved in the regulation of gene transcription. More than 100 MYND containing proteins have been identified. The function of most of them, however, remains unknown (Bachner et al., 2002). Zmynd19 was identified in a screen (Ko et al., 2000) and has no known function.
Clone #11 was identified as the gene MORN repeat containing 2 (Morn2, MGI:2674071). Multiple repeats of membrane occupation and recognition nexus (MORN) motifs have been shown to target proteins to plasma membranes, and can regulate subcellular localization between nuclear and plasma membranes (Ma et al., 2006). Morn2 is an uncharacterised protein, originally identified in a screen (Strausberg et al., 1999).
Clone #12 was identified as the gene Oligonucleotide/Oligosaccharide binding fold containing 2A (Obfc2A, MGI:1923258). Obfc2A was identified in a screen (Strausberg et al., 1999), and contains potential nucleic acid binding domains.
195
6.2.2 Characterised Psc1 interacting proteins Of the potential Psc1 interacting proteins identified in the yeast two hybrid screen, the characterised genes can provide the most information as to the function of Psc1. To confirm the interaction of these clones with Psc1 in the yeast two hybrid system, the constructs containing clones 5-8, and 13 were retransformed into yeast containing Psc1 and grown on –Leu, - Trp, -His, -Ade plates (Fig. 6.2). Clone 12 was also retested due to its potential role in nucleic acid binding. Yeast colonies grew for clones 5-8, 12, but not 13.
Clone #5 was identified as the gene Outer Dense fiber of Sperm 2 (ODF2, MGI:1098824). ODF2 was originally isolated as a major component of the outer dense fibers of the sperm flagellum. The outer dense fibers surround the microtubules of the axoneme of the sperm tail act to maintain the elastic properties of the tail and protect it from shear stress during epididymal transport and ejaculation (Baltz et al., 1990). ODF2 was initially thought to be a testis specific protein, but has since been found as a component of the centrosome in most cell types, and is expressed at low levels in all tissues thus far tested (Nakagawa et al., 2001; Salmon et al., 2006). Although its role within the centrosome is unknown, ODF2 has been shown to interact with both the centrosome and microtubules (Donkor et al., 2004) and an ODF2 knockout F9 cell line was found to be defective in the generation of primary cilia (Ishikawa et al., 2005). ODF2 is strongly conserved between species (97% homology between mouse and human) and ODF2 knockout mice show pre-implantation lethality, suggesting that ODF2 performs a critical function within the cell (Petersen et al., 1999; Salmon et al., 2006).
Clone #6 was identified as the gene Hepatocyte growth factor-Regulated tyrosine kinase Substrate (Hrs, MGI:104681). Hrs is ubiquitously expressed, with high expression levels found in the brain (Komada and Kitamura, 1995; Tsujimoto et al., 1999). Within the cell Hrs localises to punctate regions within the cytoplasm, and has been localised to the surface of early endosomes (Komada and Kitamura, 1995), the limiting membranes of multivesicular bodies (MVBs) (Tsujimoto et al., 1999), and in
196
197 neurons has been shown to localise to large dense core secretory granules (Kwong et al., 2000). Hrs is tyrosine phosphorylated in response to growth factors and cytokines (Komada et al., 1999) and is thought to play a role in the regulation of exocytosis, endocytosis and intracellular trafficking via the vesicular network (Komada et al., 2001, Hasdemir et al., 2007).
Clone #7 was identified as the gene Eukaryotic Initiation Factor 4H (eIF4H, MGI:1341822). eIF4H was originally isolated as a gene found in the 500KB region of human chromosome 7 that is commonly deleted in Williams syndrome, a multisystem developmental disorder (Osborne et al., 1996). eIF4H has been shown to stimulate protein synthesis through interactions with eIF4A, a DEAD box RNA helicase that functions to unwind the secondary structure in the 5’UTR of mRNA to facilitate the binding of the mRNA to the 40S ribosomal subunit (Richter et al., 1999; Rogers et al., 2001). eIF4H is thought to act via protein-protein interactions to stabilize the conformational changes that occur in eIF4A, and thereby enhance the ATP hydrolysis and helicase activities of eIF4A (Richter et al., 1999). eIF4H is ubiquitously expressed, although expression levels between tissues vary, with the highest expression seen in skeletal muscle (Richter et al., 1999).
Clone #8 was identified as the gene Squamous cell carcinoma Antigen Recognized by T-cells 1 (Sart1, MGI:1309453). Functionally, Sart1 has been characterised as the 110kDa SR-related protein of the U4/U6.U5 tri-snRNP (Makarova et al., 2001). Sart1 contains an N-terminal RS domain, and is essential for the recruitment of the tri-snRNP to the pre-spliceosome in order to form the mature and catalytically active spliceosome complex. It has also been shown to function as a transcriptional activator in response to hypoxia (Gupta et al., 2000), and is found as an antigen in a number of cancers and autoimmune disorders (Shichijo et al 1998; Wheatley et al., 2002; Valenta et al., 1998).
Clones 6, 7 and 8 (Hrs, eIF4H and Sart1) were chosen for further characterisation and confirmation of their interaction with Psc1 in mammalian cells.
198
6.3.1 Interaction between Psc1 and Hrs in mammalian cells The interaction between Psc1 and Hrs was chosen for further investigation and validation due to the punctate staining pattern of Hrs in the cytoplasm, similar to the cytospeckles seen with Psc1. To test the interaction of Psc1 with Hrs in mammalian cells, full length mouse Hrs was cloned from the pBS-Hrs construct (a kind gift from Dr Kitamura; Komada and Kitamura, 1995), and cloned into an EGFP mammalian expression vector (Clontech). When expressed in COS-1 cells a protein of the predicted size was detected by western blot probed with anti-GFP (data not shown).
To validate the interaction between Psc1 and Hrs, GFP-Hrs and Psc1-HA (Kavanagh et al., 2005) were co-expressed in COS-1 cells and co-immunoprecipitation was performed with either anti-GFP or anti-HA antibodies. Despite repeated attempts, immunoprecipitation of Psc1 failed to co-immunoprecipitate Hrs, and vice versa, suggesting that Psc1 may not interact with Hrs in mammalian cells.
The visualisation of GFP-Hrs in COS-1 cells showed punctuate staining at the periphery of vesicular structures throughout the cytoplasm (Fig. 6.3). As had previously been reported (Tsujimoto et al., 1999), overexpression of Hrs resulted in the formation of enlarged vesicles (Fig. 6.3ii.). Co-expression of Psc1-HA and GFP-Hrs showed no co-localisation between Psc1 cytospeckles and Hrs coated vesicles (Fig. 6.4), demonstrating that Psc1 cytospeckles are not related to the membrane bound vesicles found in the endosome network.
6.3.2 Interaction between Psc1 and eIF4H in mammalian cells The interaction between Psc1 and eIF4H was chosen for further investigation and validation due to the role of eIF4H in the translation of mRNA. To test the interaction of Psc1 with eIF4H in mammalian cells, full length mouse eIF4H was amplified by PCR using mouse ES cell cDNA and cloned into an EGFP mammalian expression vector (Clontech). When expressed in COS-1 cells a protein of the predicted size was detected by western blot probed with anti-GFP (data not shown).
199
200
201
To validate the interaction between Psc1 and eIF4H observed in the yeast two hybrid screen, GFP-eIF4H and Psc1-HA were co-expressed in COS-1 cells and co- immunoprecipitation was performed with either anti-GFP or anti-HA antibodies. Despite repeated attempts, immunoprecipitation of Psc1 failed to co-immunoprecipitate eIF4H, and vice versa.
As eIF4H is a small protein of 25 kDa, it was possible that the 28 kDa EGFP tag may have interfered with the interaction between Psc1 and eIF4H. A FLAG-eIF4H construct, with a 1 kDa FLAG tag attached to the N-terminus of eIF4H, was generated using PCR and cloned into the XMT2 mammalian expression vector. When expressed in COS-1 cells a protein of the predicted size was detected by western blot probed with anti-FLAG (data not shown). FLAG-eIF4H and Psc1-HA were co-expressed in COS-1 cells and immunoprecipitation experiments were performed, but failed to demonstrate co-immunoprecipitation of Psc1 and eIF4H.
Visualisation of GFP-eIF4H in COS-1 cells showed cytoplasmic localization with a high concentration around the nucleus (Fig. 6.5). This is similar to the localization of the ribosomal S6 subunit (see section 5.3.1), and consistent with localization to the ribosome rich endoplasmic reticulum. Co-expression with Psc1-HA showed no co- localisation between Psc1 cytospeckles and eIF4H (Fig. 6.5). Consistent with the lack of co-localisation with the ribosomal S6 subunit (see section 5.3.1), the lack of co- localisation of Psc1 and eIF4H suggest that Psc1 cytospeckles are not related to sites of mRNA translation.
6.4 Interaction between Psc1 and Sart1 in mammalian cells The interaction between Psc1 and Sart1 was chosen for further investigation and validation due to the role of Sart1 in RNA metabolism and because Sart1 and Psc1 are both members of the SR related protein family.
202
203
To test the interaction between Psc1 and Sart1 in mammalian cells, a FLAG-Sart1 construct, consisting of full length Sart1 with an N-terminal FLAG tag, was generated by PCR using mouse testis cDNA and cloned into the XMT2 mammalian expression vector. The construct was expressed in COS-1 cells and analysed by western blot probed with an anti-FLAG antibody (Fig. 6.6A). A band of approximately 110 kDa was detected in the transfected cell lysate, but not the untransfected control. Although endogenous Sart1 has a predicted molecular weight of 90 kDa it has been observed as a band at 110 kDa in SDS-PAGE, an effect attributed to the glutamic rich region between amino acids 450-600 (Makarova et al., 2001). FLAG-Sart1 would therefore be expected to migrate at an apparent molecular mass of approximately 111 kDa (with the 1 kDa tag). To confirm the identity of the 110 kDa band as FLAG-Sart1, the samples were analysed by western blot probed with an anti-Sart1 antibody (anti-C110 antibody; Makarova et al., 2001; a kind gift from Dr Lührmann). A band of the same size as that detected with the anti-FLAG antibody was detected in the transfected cell lysate, and an endogenous Sart1 band of a very similar size was detected in the untransfected COS-1 cell lysate (Fig. 6.6A), confirming the identity of the 110 kDa band as FLAG- Sart1.
To test the ability of Psc1 and Sart1 to interact in mammalian cells, GFP-Psc1 and FLAG-Sart1 were co-transfected into COS-1 cells. Lysates were immunoprecipitated with either anti-Psc1, anti-FLAG or anti-Sart1 antibodies. The samples were analysed by western blot (Fig.6.6B). Immunoblotting with anti-Sart1 antibody showed Sart1 was immunoprecipitated with both the anti-FLAG and anti-Sart1 antibodies, and was able to be co-immunoprecipitated with Psc1 using the anti-Psc1 antibody. Probing with anti-Psc1 showed that Psc1 was immunoprecipitated with anti-Psc1 antibody, and was able to be co-immunoprecipitated with Sart1 using either the anti-FLAG or anti-Sart1 antibodies. Neither Psc1 nor Sart1 were immunoprecipitated in the negative control without antibody.
To ensure the co-immunoprecipitation of Psc1 and Sart1 was not an artefact of overexpression, or linked to the GFP or FLAG tag, the interaction of endogenous Psc1
204
Figure 6.6: Psc1 and Sart1 co-immunoprecipitate in mammalian cells. A) FLAG-Sart1 was transfected in COS-1 cells, and lysate analysed by western blot. Anti-FLAG antibody detected a band of 110 kDa (lane 2) that is not detected in lysate from untransfected COS-1 cells (lane 1). Anti-Sart1 antibody detected a band of the same size as FLAG-Sart1 detected in lane 2 (lane 4), and endogenous Sart1 (110kDa) in lysate from untransfected COS-1 cells (lane 3). B) GFP-Psc1 and FLAG-Sart1 were transfected into COS-1 cells, and immunoprecipitated with anti-Psc1 antibody, anti-FLAG antibody, anti-Sart1 antibody or no antibody as indicated. Samples were loaded on duplicate western blots and probed with either anti-Psc1 antibody or anti-Sart1 antibody. Neither Psc1 nor Sart1 were immunoprecipitated when no antibody was used (lane 1). Immunoprecipitation of Psc1 with anti-Psc1 also precipitated Sart1 (lane 2). Immunoprecipitation of Sart1 with either anti-FLAG or anti-Sart1 also precipitated Psc1 (lanes 3, 4). GFP-Psc1 and FLAG-Sart1 bands are detected in the lysate (lane 5). C) Endogenous Psc1 was immunoprecipitated from ES cell lysate with anti-Psc1 antibody. Samples were loaded on duplicate western blots and probed with either anti- Psc1 antibody or anti-Sart1 antibody. Endogenous Psc1 and endogenous Sart1 are detected in ES cell lysate (lanes 1, 4). Neither Psc1 nor Sart1 are immunoprecipitated with no antibody (lanes 2, 5). Immunoprecipitation of Psc1 with anti-Psc1 (lane 3) also precipitated Sart1 (lane 6).
205
206
207 and Sart1 was investigated. ES cell lysate was immunoprecipitated with anti-Psc1 antibodies and analysed by western blot (Fig. 6.6C). Probing with anti-Psc1 showed that Psc1 was successfully immunoprecipitated from ES cells. Probing with anti-Sart1 showed that endogenous Sart1 co-immunoprecipitated with Psc1. Co- immunoprecipitation, coupled with the interaction detected in the yeast two hybrid screen, confirm that Psc1 and Sart1 are genuine interacting proteins, and interact in mammalian cells.
6.4.1 Interaction of Sart1 with Psc1 domain mutants Further investigation of the interaction between Psc1 and Sart1 was carried out with the aim of identifying the region(s) of Psc1 required for the interaction with Sart1. Of the Psc1 domains (see section 1.2), three were chosen to be tested directly for their interaction with Sart1: the N-domain which shares homology with hPRP3P, a protein found with Sart1 in the tri-snRNP complex (Wang et al., 1997); the RS domain, a potential protein-protein interaction domain (Manley and Tacke, 1996; Labourier et al.,1999); and the C-domain, a domain shared between members of the ARRS family of proteins that is of unknown function (Kavanagh et al., 2005).
Psc1 constructs lacking individual domains (Psc1 Δ N-domain, Psc1 Δ RS domain, and Psc1 Δ C-domain) were cloned from GFP-Δ Psc1 constructs (Kavanagh et al., 2005) into the pGBKT7D vector (Clontech) and expressed as Gal4-binding domain fusion proteins (BD-Psc1Δ domain). The mutant Psc1 constructs were co-transformed into AH109 yeast together with pACT2-Sart1 (AD-Sart1), and streaked onto -His and - His/-Ade plates (Fig. 6.7). All the yeast grew on the selection plates, showing interaction between Sart1 and all three Psc1 deletion mutants.
These results suggest neither the N-domain, the RS domain, nor the C-domain of Psc1 is solely responsible for the interaction with Sart1. The interaction between the individual domains of Psc1 and Sart1 was also investigated using immunofluorescence, and the results are presented in section 6.7.2 below.
208
Figure 6.7: Interaction of Psc1 domain mutants and Sart1 using yeast two hybrid. BD-Psc1 constructs lacking individual domains (BD-Psc1 Δ N-domain, BD-Psc1 Δ RS domain, and BD-Psc1 Δ C-domain) and full length BD-Psc1 were transformed into AH109 yeast together with AD-Sart1. Yeast was streaked on i.) -Leu/-Trp/-His and ii.)- Leu/-Trp/-His/-Ade plates. All yeast grew on the selection plates.
209
210
6.5 Developmental expression of Sart1 The successful co-immunoprecipitation of endogenous Sart1 and Psc1 from ES cell lysate suggests that Sart1 and Psc1 may functionally interact in ES cells. Psc1 mRNA and protein are known to be down regulated as ES cells differentiate (Pelton et al., 2002; section 4.5). The regulation of Sart1 during ES cell differentiation was investigated. To determine the developmental regulation of the Sart1 protein, northern and western blots were carried out on extracts from ES cells and differentiated ES cells (EBM1-4).
The ES and EBM1-4 extracts used to investigate Psc1 mRNA and protein expression in chapters 3 and 4 (see section 3.3.2, and section 4.5) were used to investigate the expression of Sart1. Northern blot analysis of RNA extracted from ES cells and EBM1-4 cells showed Sart1 mRNA levels remain constant during ES cell differentiation to EBM4 (Fig. 6.8A). Western blot analysis of protein extracts from the same ES-EBM4 series showed that Sart1 protein also remains constant during ES cell differentiation (Fig. 6.8B).
6.6 Distribution of Psc1 and Sart1 after subcellular fractionation Sart1 has been identified as a component of the tri-snRNP, and functions in the recruitment of the tri-snRNP to the pre-spliceosome complex (Makarova et al., 2001). To investigate the relationship between Psc1, Sart1 and the tri-snRNP complex, subcellular fractionation experiments were performed.
Nuclear extract from ES cells was separated by centrifugation on a 15-45% sucrose gradient. The gradient was fractionated and the fractions were analysed for the presence of Sart1 and Psc1 by western blot (Fig. 6.9). Sart1 was found to be concentrated in fractions 9-11 and 13-20, and Psc1 eluted predominantly in fractions 14-20, with the highest concentration seen in fractions 17 and 18, suggesting that Sart1 is involved in two different sized complexes, and association of Psc1 with Sart1 in the cell is only occurring in one of these.
211
Figure 6.8: Sart1 expression during ES-EBM4 differentiation. RNA and lysate from ES cells and EBMs 1-4 were analysed for Sart1 expression. A) i. Northern blot analysis with Sart1 probe, GAPDH used as a loading control. ii. Semi-quantitative analysis of the data: Expression of Sart1 RNA from EBM 1-4 was normalised against Sart1 expression in ES cells. Error bars = std dev. N=3 biological repeats. B) i. Western blot with anti-Sart1 antibody, anti-Actin was used as a loading control. ii. Semi-quantitative analysis of the data: Expression of Sart1 protein from EBM 1-4 was normalised against Sart1 expression in ES cells. Error bars = std dev. N=3 biological repeats.
212
213
214
Attempts were made to determine the localisation of the spliceosomal complexes in the gradient through characterisation of the snRNA combinations present in each fraction. Using previously published methods this was attempted by ethidium bromide staining, silver staining, and 3’end labeling of the snRNA. None of these methods was successful. Previously published experiments have shown that the tri-snRNP complex elutes in fractions 15-17 (Meister et al., 2001) and 17-19 (Maita et al., 2005), and that other snRNPs (U1, U2, U4/U6 and U5) all elute earlier and are smaller than the tri- snRNP. These results suggest that the high concentration of Psc1 in fractions 17 and 18 may indicate the localization of Psc1 with Sart1 in the tri-snRNP complex, however further experiments would need to be performed to support this.
6.7 Subcellular localization of Sart1 and Psc1 Subcellular fractionation experiments had previously characterised full length Sart1 as a nuclear protein (Shichijo et al., 1998), but the subnuclear localization of Sart1 was not determined. In addition, a truncated form of Sart1 has been found in the cytoplasm of some cancer cells and in some autoimmune diseases (Valenta et al., 1998, Shichijo et al, 1998). To characterise the subnuclear localisation of Sart1, and to determine where in the cell Psc1 and Sart1 may interact, the subcellular localization pattern of Sart1 was investigated using immunofluorescence.
6.7.1 Subcellular localization of Sart1 FLAG-Sart1 was transfected into COS-1 cells and stained with either anti-FLAG or anti-Sart1 antibodies (Fig. 6.10). FLAG-Sart1 localised exclusively to the nucleus, and was found to be both diffuse and concentrated in apparent nuclear speckles (Fig. 6.10i, iii.). In many cells (approximately 67%) FLAG-Sart1 was also found in large, often distorted nuclear structures (Fig. 6.10ii, iv.). These staining patterns were observed when cells were stained with either anti-FLAG or anti-Sart1 antibodies. The localisation pattern of Sart1 varied from cell to cell, potentially caused by variation in expression levels of FLAG-Sart1 within the population of transfected cells.
215
Figure 6.10: FLAG-Sart1 localises to the nucleus, and to speckles within the nucleus. FLAG-Sart1 was transfected into COS-1 cells. The cells were fixed, stained with anti- FLAG antibody and analysed by immunofluorescence. FLAG-Sart1 (red) showed i.) diffuse nuclear localisation and localisation to nuclear speckles, ii.) localisation to large irregular shaped structures. The same patterns were observed when cells were stained with anti-Sart1 antibody (iii., iv.). Nuclei were stained with Hoechst (blue). Size bars represent 10 µm.
216
217
218
The localisation of endogenous Sart1 protein was investigated using COS-1 cells fixed and stained with anti-Sart1 antibody (Fig. 6.11). The staining pattern was similar to that observed with expression of FLAG-Sart1, showing diffuse nuclear staining, a few putative nuclear speckles, and localisation to larger nuclear structures. Bright field microscopy of the cells suggested that these structures were nucleoli. Compared to over expressed FLAG-Sart1, endogenous Sart1 showed limited localization to nuclear speckles (Fig. 6.11Aii.), and while endogenous Sart1 localised to the putative nucleoli in approximately 90% of cells, these did not show the gross distortions seen with over expressed FLAG-Sart1.
To confirm the localization of Sart1 to nucleoli, p160 Myb-binding protein, a nuclear protein that interacts with the Myb transcription factor and has been shown previously to localise predominantly to the nucleolus (Tavner et al., 1998), was used as a nucleolar marker protein. COS-1 cells were transfected with FLAG-Sart1, then fixed and stained with anti-FLAG and anti-p160 antibodies (Fig. 6.12). FLAG-Sart1 was found to co- localise with p160, confirming the localization of Sart1 to nucleoli (Fig. 6.12i). FLAG- Sart1 localisation to nucleoli showed a large amount of variation. FLAG-Sart1 was seen in the nucleoli of some transfected cells, but not in others (Fig. 6.12ii). In some cells the over expression of FLAG-Sart1 appeared to disrupt the shape and size of nucleoli, and the localization of p160 within the nucleoli (Fig. 6.12iii). The appearance of Sart1 in nucleoli did not appear to be cell cycle related. Nucleoli vary in number during the cell cycle, such that multiple nucleoli form during G1, but fuse to one or a few nucleoli 1-2 hrs after entry into interphase (Savino et al., 2001). Sart1 was seen in the nucleolus of cells with a range of 1-8 nucleoli, and in some cells Sart1 was found within one or some of the nucleoli in the cell, but not in all (Fig. 6.12i).
6.7.2 Psc1 and Sart1 subcellular co-localisation To investigate where in the cell Sart1 and Psc1 co-localise and potentially interact, GFP-Psc1 was co-expressed with FLAG-Sart1 in COS-1 cells, the cells were fixed and stained with anti-FLAG antibodies (Fig. 6.13). Both GFP-Psc1 and FLAG-Sart1
219
Figure 6.11: Localisation of endogenous Sart1. A) COS-1 cells were stained with anti-Sart1 antibody and analysed by immunofluorescence. i.) Sart1 was detected throughout the nucleus and in large structures that, by bright field microscopy, appeared to be nucleoli. ii.) anti-Sart1 antibody also detected Sart1 in nuclear speckles. B) The staining pattern seen with anti-Sart1 antibody was not an artefact of the anti- rabbit TRITC secondary antibody. Nuclei stained with Hoechst (blue). Size bars represent 10 µm.
220
221
Figure 6.12: Sart1 localises to nucleoli. FLAG-Sart1 was transfected into COS-1 cells. The cells were fixed, stained with anti- FLAG antibody, and anti-p160 antibody, a marker for nucleoli. Sart1 showed a variety of localisation patterns. i.) In some cells Sart1 (red) co-localised with p160 (green). ii.) In some cells Sart1 was absent from the anti-p160 stained nucleoli. iii.) In some cells showing large distorted nucleoli, p160 was relocalised to the nucleolar periphery. Nuclei were stained with Hoechst (blue). Size bars represent 10 µm.
222
223
Figure 6.13: GFP-Psc1 co-localises with FLAG-Sart1 in the nucleus, and to nuclear speckles. GFP-Psc1 and FLAG-Sart1 were transfected into COS-1 cells. The cells were fixed, stained with anti-FLAG antibody and analysed by immunofluorescence. GFP-Psc1 (green) co-localised with FLAG-Sart1 (red) i.) diffuse throughout the nucleus, excluding the nucleoli, ii.) to nuclear speckles, iii.) but not to the small nuclear periphery Psc1 speckles (red arrows), iv.). Sart1 does not localise with Psc1 to cytospeckles, v.) Antibody control: GFP-Psc1 was transfected into COS1 cells and stained with anti-FLAG antibody. No cross reactivity with Psc1 was seen. Nuclei stained with Hoechst (blue). Size bars represent 10 µm.
224
225
226 showed some diffuse staining in the nucleus (Fig 6.13i). GFP-Psc1 was seen to co- localise with FLAG-Sart1 to nuclear speckles (Fig. 6.13ii, iii). In some cells GFP-Psc1 was seen in speckles, predominantly at the nuclear periphery, that did not contain Sart1 (Fig. 6.13iii), similar to the non-SC35 containing Psc1 nuclear speckles previously reported (Kavanagh et al., 2005). In cells containing Psc1 localised to the cytoplasm in cytospeckles, Sart1 remained nuclear (Fig. 6.13iv). GFP-Psc1 was not cross-reactive to the anti-FLAG antibody (Fig. 6.13v). In some cells GFP-Psc1 was found localised with Sart1 in nucleoli, a location in which Psc1 is normally not detected (Fig. 6.14). This demonstrates that over expression of Sart1 can cause the localisation of Psc1 to the nucleolus.
The localisation of GFP-Psc1 to nucleoli when co-expressed with FLAG-Sart1 was potentially the result of a direct interaction between Psc1 and Sart1. In an attempt to test this theory FLAG-Sart1 was co-expressed with GFP-Psc1 mutants lacking the individual Psc1 domains (Kavanagh et al., 2005). Mutant constructs of all the Psc1 domains (Psc1 Δ N-domain, Psc1 Δ Zn-finger, Psc1 Δ RS domain, Psc1 Δ RRM, and Psc1 Δ C-domain) were tested to see if removal of individual domains resulted in the loss of Psc1 localisation to the nucleoli when co-expressed with FLAG-Sart1. FLAG- Sart1 and GFP-Psc1 domain mutants were co-expressed in COS-1 cells and the cells were fixed and stained with anti-FLAG antibodies (Fig. 6.15). All Psc1 mutants were capable of localisation to the nucleoli when expressed with FLAG-Sart1. These results are in agreement with yeast two hybrid experiments (see section 6.4.1) which showed that Psc1 did not interact with Sart1 through the N-domain, RS domain or C-domains. Alternatively, localisation of Psc1 to nucleoli may not be due to a direct interaction between Psc1 and Sart1, but may be caused by a disruption in the pathways and metabolism with which Psc1 and Sart1 are involved.
The subcellular co-localisation of endogenous Sart1 and Psc1 was also compared. GFP-Psc1 was expressed in COS-1 cells and the cells were fixed and stained with anti- Sart1 antibodies (Fig. 6.16). GFP-Psc1 and endogenous Sart1 showed limited co- localisation compared to GFP-Psc1 and FLAG-Sart1. While Psc1 was seen to localise
227
228
229
Figure 6.16: Endogenous Sart1 shows limited co-localisation with GFP-Psc1: GFP-Psc1 was transfected into COS-1 cells. The cells were fixed, stained with anti- Sart1 antibody and analysed by immunofluorescence. GFP-Psc1 (green) co-localises with FLAG-Sart1 (red) i) to nuclear speckles, ii) but not to nucleoli, iii) and not to all nuclear speckles. Nuclei stained with Hoechst (blue). Size bars represent 10 µm.
230
231 to nuclear speckles, endogenous Sart1 was not highly concentrated at these sites (Fig 6.16i.). In many instances Psc1 nuclear speckles showed no co-localisation with Sart1 (Fig. 6.16iii.). Although Sart1 localised to nucleoli, GFP-Psc1 appeared to be excluded from these sites (Fig. 6.16ii.).
6.8 Discussion The identification of Psc1 interacting proteins was chosen as an approach to characterise Psc1 function, both in the cell and during development. A yeast two hybrid screen was performed and identified a number of potential Psc1 interacting proteins. Of these the SRrp Sart1, a protein essential for the formation of the mature spliceosome, was confirmed as a Psc1 interacting protein, and the interaction of Psc1 and Sart1 was investigated further.
6.8.1 Yeast two hybrid screen of testis cDNA for Psc1 interacting proteins The yeast two hybrid screen identified 12 potential Psc1 interacting proteins of which four were characterised proteins (ODF2, Hrs, eIF4H and Sart1). The relationship between Psc1 and Hrs, eIF4H and Sart1 was investigated further; ODF2 was not investigated further in this study. The uncharacterised interactors identified in the screen provide little insight into function at this stage, although clone 12 contained sequence suggesting an ability to bind nucleic acid, consistent with the prospective role of Psc1 in RNA metabolism. Psc1 has been shown by yeast two hybrid to interact directly with itself and with Pabpn1 (chapter 5). Neither of these proteins was identified in the screen, despite both being expressed in testis. The presence of Psc1 in the cDNA library was confirmed (as determined by PCR, data not shown). This suggests that the screen was not exhaustive in its identification of Psc1 interacting proteins and that a repeat of the screen should identify other interacting proteins. Proteins not expressed in testis and those requiring post-translational modifications not found in yeast in order to interact with Psc1 would also have been missed in this screen.
232
6.8.2 Interaction between Psc1 and Hrs Further investigation of Psc1 and Hrs was unable to confirm the interaction detected in the yeast two hybrid screen. Co-immunoprecipitation experiments with Psc1 and Hrs were unsuccessful and immunofluorescence failed to show co-localisation. It remains possible that Psc1 and Hrs can interact in mammalian cells under a set of conditions that were not present in the experiments performed or within cells other than COS-1. A GFP-Hrs construct was used for these experiments and while it is possible that the 28 kDa GFP tag interfered with the potential interaction between Hrs and Psc1, the sub- cellular localization of GFP-Hrs was consistent with that previously reported (Tsujimoto et al., 1999), suggesting that the GFP tag did not significantly interfere with the correct localisation of Hrs.
As expected, Hrs was found to localise to punctuate cytoplasmic structures. These have previously been shown to correspond to the cytoplasmic membranes of endosomes and multivesicular bodies (Tsujimoto et al., 1999). Psc1 did not co-localise with Hrs to these structures, demonstrating that Psc1 cytospeckles are not related to the vesicular endosome network.
6.8.3 Interaction between Psc1 and eIF4H eIF4H was identified as a Psc1 interacting protein in the yeast two hybrid screen. eIF proteins and other ribosomal associated proteins are often identified as false positives in yeast two hybrid screens, but due to the role of eIF4H in RNA metabolism the validity of the interaction was not instantly discounted. Given that the interaction was unable to be confirmed by co-immunoprecipitation or co-localisation in COS-1 cells, it seems unlikely that eIF4H and Psc1 are genuine interacting proteins.
GFP-eIF4H showed similar subcellular localization to the S6 ribosomal subunit, localizing throughout the cytoplasm with a high perinuclear concentration. This is consistent with the localization pattern of a protein involved in translation, with localization to ribosomes on the rough endoplasmic reticulum surrounding the nucleus,
233 and on free ribosomes throughout the cytoplasm (reviewed in Ramakrishnan, 2002). Psc1 cytospeckles did not co-localise with eIF4H or the S6 ribosomal subunit, suggesting that Psc1 is not directly involved in mRNA translation, and is not associated with mRNA at the time of translation.
6.8.4 Sart1: A Psc1 binding protein Sart1 was identified as a Psc1 interacting protein in the yeast two hybrid screen, and the interaction was confirmed by co-immunoprecipitation from mammalian cells. The function of the interaction between Sart1 and Psc1 was not determined in this study. A relationship between Sart1, Psc1 and nucleoli was discovered in co-localisation studies.
Sart1 is a reasonably large protein of 800 amino acids and, like Psc1, is an SRrp containing an N-terminal RS domain. No other known motifs have been identified in the Sart1 sequence (Makarova et al., 2001). Sart1 is also known as hypoxia associated factor (HAF1), HomS1, and 110 kDa SR-related protein of the U4/U6.U5 tri-snRNP.
Mammalian Sart1 functions as a component of the U4/U6.U5 tri-snRNP complex, and plays an essential role in the recruitment of the tri-snRNP to the spliceosome, facilitating the transition of the pre-spliceosome (complex A) to the mature spliceosome (complex B) with immuno-depletion or antibody blocking of Sart1 inhibiting pre-mRNA splicing in vitro (Makarova et al., 2001). The Sart1 orthologue in S. cerevisiae, snu66p, has been identified as a component of the yeast tri-snRNP and is essential for the first step of splicing in vitro. Pull-down experiments have shown Sart1 interacts with both the tri-snRNP and U2snRNP, consistent with a role in the recruitment of the tri-snRNP to the pre-spliceosome complex (Gottschalk et al., 1999).
In addition to its role in splicing Sart1 has been shown to affect transcription, being capable of binding to the erythropoietin promoter and a region of the 5’UTR of vascular endothelial growth factor (VEGF), to enhance the hypoxia induced expression of these genes (Gupta et al., 2000). A link between spliceosome proteins and hypoxia
234 has been found in the condition retinitis pigmentosa (RP). Mutations in a number of proteins associated with the tri-snRNP such as PAP1 (RP9), PRPF31 (RP11), PRPF8 (RP13) and PRPF3 (RP18) are linked with retinitis pigmentosa. Despite global expression of these proteins, mutations only cause degeneration in the retina, an effect thought to be linked to the high oxygen consumption and cyclical oxygenation changes related to dark-adaptation found in the outer retina. It has been suggested that the high energy levels needed for splicing require increased oxygen levels to generate enough ATP, and therefore splicing related proteins are linked to, and able to react and respond to, hypoxia (Schmidt-Kastner et al., 2008).
Sart1 has been identified as an antigen in multiple cancers and as an autoantigen in patients with severe atopic dermatitis and asthma. In a study looking for tumor rejection antigens recognised by cytotoxic T lymphocytes Sart1 was identified and characterised as a protein expressed in the nucleus of all proliferating cells and as a truncated protein in the cytosol of esophageal squamous cell carcinomas (SCCs), lung SCCs, and head and neck SCCs (Shichijo et al., 1998). Sart1 has also been identified as an antigen in uterine cancers (Matsumoto et al., 1998) and brain tumours (Imaizumi et al., 1999). The antigenic region of the protein was localised to the C-terminus of Sart1 (Shichijo et al., 1998).
The C-terminus of Sart1 is also the antigenic component found in some autoimmune conditions causing severe atopic dermatitis and asthma (Wheatley et al., 2002; Valenta et al., 1998). Using Sart1 reactive IgE antibodies from an atopic dermatitis patient, Sart1 was detected as 38 and 55 kDa proteins in A431 epithelial carcinoma cells. Subcellular localisation experiments on HepG2 cells using immunoelectron microscopy showed cytoplasmic localisation of Sart1, and localisation inside endosomes/multivesicular bodies, consistent with the processing and presentation of Sart1 as an antigen (Valenta et al., 1998).
235
6.8.4.1 Sart1 and Psc1 directly interact Overexpressed FLAG-Sart1, and endogenous Sart1, were shown to co- immunoprecipitate with Psc1, confirming the interaction detected in the yeast two hybrid screen and the interaction of the proteins in mammalian cells. The interaction between Psc1 and Sart1 by yeast two hybrid showed that there is a direct interaction between the two proteins. The region of interaction between Psc1 and Sart1 appears to lie outside the N-, RS- and C- domains of Psc1, or potentially multiple Psc1 domains may be capable of binding to Sart1. The region(s) of Sart1 that interact with Psc1 were not investigated in this work, and the full-length Sart1 sequence was present in the yeast two hybrid clone that was identified in the screen, offering no insight into the region of interaction. Sart1 contains an N-terminal RS domain, but no other known motifs have been identified in the protein sequence.
6.8.4.2 Subcellular localisation of Sart1 The subcellular localisation of Sart1 has not been investigated previously using immunofluorescence. Overexpressed FLAG-Sart1 and endogenous Sart1 localised exclusively to the nucleus, and both showed localisation to nucleoli in some cells. FLAG-Sart1 was also detected in nuclear speckles. Endogenous Sart1, however, showed little detectable nuclear speckle localisation. This suggested that Sart1 localised to nuclear speckles when in excess, consistent with the proposed role of nuclear speckles as storage sites.
Neither FLAG-Sart1 nor endogenous Sart1 (detected with the anti-C110 Sart1 antibody) was observed in the cytoplasm in this study. Previous studies investigating the antigenic properties of Sart1 as either a cancer antigen or an autoantigen have shown a truncated form of Sart1 localised in the cytoplasm of many cancer cell lines, and in skin sections using subcellular fractionation and immunoelectron microscopy (Valenta et al., 1998; Shichijo et al., 1998). The immunoelectron microscopy study localised cytoplasmic Sart1 inside endosomal/multivesicular bodies, subcellular compartments that are known to play a role in antigen processing and presentation. The
236 anti-C110 Sart1 antibody used in our study did not detect cytoplasmic Sart1 and may be unable to recognise the epitopes expressed when the protein is processed. Alternatively truncated Sart1 may not have been present in the COS-1 and HeLa cells used in this study. Further studies using antibodies that are able to detect truncated Sart1 and/or cell lines that contain cytoplasmic Sart1 could be used to determine if there is a relationship between Psc1 cytospeckles and cytoplasmic Sart1. Given the endosomal/MVB localisation of Sart1, however, co-localisation seems unlikely as Psc1 cytospeckles do not co-localise with endosomes/MVBs (see section 6.8.3).
6.8.4.3 Sart1 is able to localise to nucleoli The localisation of Sart1 to nucleoli has not previously been reported. Nucleoli function primarily as the site of ribosome biogenesis in eukaryotic cells, forming at the end of mitosis around the tandemly repeated clusters of rDNA genes. Within nucleoli the transcriptional and processing machinery required to generate the ribosomal subunits are concentrated. Recent studies have identified a wide range of proteins within the nucleolus, suggesting additional functions beyond ribosome biogenesis for this subnuclear compartment (reviewed in Boisvert et al., 2007; Mao et al., 2011; Shaw et al., 2012).
Although Sart1 localises to nucleoli, it has not as yet been identified as having a role in ribosome biogenesis, despite extensive research in that area. It seems more likely that Sart1 is involved in a non ribosomal function of the nucleolus. Evidence suggests that nucleoli have a role in covalent RNA modification and protein assembly of multiple RNP complexes such as the snRNPs (Mao et al., 2011; Shaw et al., 2012). As Sart1 is a component of the U4/U5.U6 tri-snRNP spliceosome complex it may locate to nucleoli as part of the tri-snRNP maturation process. For example, all snRNAs of the tri-snRNP localise to nucleoli and nucleoli have been found to contain all trans-acting factors responsible for the O-methylation and pseudouridine modification of mammalian U6 snRNA (Gerbi et al., 2002; Tycowski et al., 1998; Ganot et al., 1999; Lange and Gerbi et al., 2000).
237
6.8.4.4 Sart1 over expression disrupts nucleoli Sart1 in nucleoli showed considerable variation. FLAG-Sart1 was seen in the nucleolus of some transfected cells but not in others, and in some cells Sart1 was found within one or some of the nucleoli in the cell, but not in all (Fig. 6.12i). In contrast, endogenous Sart1 was seen in either every nucleolus within a cell, or none (Fig. 6.11). FLAG-Sart1 was observed in the nucleoli of approximately 67% of cells, whereas endogenous Sart1 was observed in the nucleoli of approximately 90% of cells. The variation seen in the localisation of FLAG-Sart1 and difference from endogenous Sart1 suggests that when overexpressed Sart1 localisation is disrupted.
Over expression of Sart1 appears to affect nucleolar structure and localisation of other nucleolar proteins. In many cells, overexpression of Sart1 caused the nucleolus to appear enlarged and grossly distorted (Fig. 6.10). The ability of Sart1 over expression to disrupt nucleolar structure is also evident by the over expression of Sart1 causing the relocalisation of p160 to concentrated points at the edge of nucleoli (Fig. 6.12iii). This pattern of localisation has been reported to occur when ribosome biogenesis is impaired by inhibiting rDNA transcription, or rRNA processing and/or transport is inhibited e.g. by physiological conditions or by actinomycin D. Under these conditions nucleolar components are seen to segregate and form a unique structure known as a nucleolar cap, which surrounds the central nucleolar body (Hadjiolova et al., 1995; Shav-tal et al., 2005). Overexpression of Sart1 causes the relocalisation of p160 into such caps at the nucleolar periphery (Fig. 6.12iii).
6.8.4.5 Sart1 over expression causes changes in the localisation of Psc1 in nucleoli Overexpression of Sart1 was found to affect the localisation of Psc1. Neither endogenous Psc1 nor GFP-Psc1 has been observed by immunofluorescence to localise to nucleoli, however, when co-expressed with FLAG-Sart1, Psc1 is observed in the nucleolus in some cells. The nucleolar proteome database (NOPdb) contains more than 4500 proteins that have been identified as nucleolar proteins through the analysis of purified human nucleoli (from HeLa cells) using mass spectrometry. In this database
238 the human Psc1 protein KIA1311 is present (Leung et al., 2006; Ahmad et al., 2009). The positive identification of Psc1 in the nucleolar database and endogenous Sart1 in the nucleolus by immunofluorescence gives a potential location for the normal interaction of Psc1 and Sart1 in the cell.
The protein makeup of the nucleolus is in constant flux (Phair and Misteli, 2000; Chen and Huang, 2001; Olson and Dundr, 2005), therefore it is possible that Psc1 localisation to nucleoli is a transient association, or alternatively, specific cellular conditions or cell types are required for Psc1 to localise to the nucleolus. Overexpression of Sart1 results in the visible localisation of Psc1 to nucleoli. It is possible that the binding of Sart1 directly to Psc1 may recruit Psc1 to the nucleoli or that the disruption of the nucleolus that Sart1 causes, or even the disruption of the particular pathway through which Psc1 normally passes could result in Psc1 becoming trapped in the nucleolus. Other proteins that are described as nucleolus- excluded by immunofluorescence, such as SF2 (Caceres et al., 1997), were identified in the nucleolar database screen and have been shown to associate with the nucleolus as a result of drug-induced transcriptional inhibition, and UV light induced DNA damage (Anderson et al., 2005; Sakashita et al., 2010). The effect of overexpression of Sart1 on the localisation of other SR and SRrps such as SF2 should be investigated.
Further experiments with Sart1 are needed to determine both the relationship between Sart1 and Psc1 and the link this has to nucleoli. Identifying the regions of Sart1 and Psc1 that mediate their interaction with each other would facilitate the generation of mutants that could be used to determine if the localisation of Psc1 to the nucleolus by Sart1 was due to a direct interaction or as a result of nucleolar disruption. Experiments to block certain cellular processes such as transcription, translation, or spliceosome formation could be performed to determine if Psc1 can be localised to the nucleolus by a mechanism other than Sart1 overexpression. The reason for localisation of both Sart1 and Psc1 to the nucleolus is unknown, and perhaps the co-localisation of Psc1 and Sart1 in the nucleolus is the key to their functional interaction.
239
6.8.4.6 What is the function of an interaction between Psc1 and Sart1? This study has shown that Psc1 interacts directly with Sart1. The location of the interaction was not determined, but is potentially in nuclear speckles, the nucleolus or both. The function of the interaction between Psc1 and Sart1 is unknown. Sart1 has a role in the recruitment of the tri-snRNP to the pre-spliceosome and as discussed in section 5.6.1, Psc1 has been identified as a spliceosomal associated protein in one study (Chen et al., 2007). In many other studies of the spliceosome and spliceosomal complexes Psc1 was not identified (reviewed in Cvitkovic and Jurica, 2012), suggesting that while Psc1 is unlikely to be a core component of the spliceosome and spliceosomal complexes, it can associate with the spliceosome under the right conditions, and this interaction potentially involves Sart1. In the cell fractionation analysis undertaken, Sart1 segregated in two regions of the gradient. Psc1 was predominantly present in only one of these, suggesting that Sart1 is present in complexes containing Psc1 and complexes that lack Psc1, which presumably have different roles or activities. Attempts to show co-fractionation of snRNPs and Psc1 were inconclusive (data not shown). Further experiments are required to determine if Psc1 and Sart1 interact in the context of the tri-snRNP. Repeats of the gradient experiments and experiments that examine the ability of Psc1 to promote or block the progression of the pre-spliceosome to the mature spliceosome could be carried out.
240
CHAPTER 7
FINAL DISCUSSION
241
CHAPTER 7: FINAL DISCUSSION
Psc1 contains a functional RNA binding domain and an RS domain, classifying it as a member of the SRrp family of proteins and suggesting a functional role in RNA metabolism. Work in this thesis has found that Psc1 interacts with Pabpn1 and Sart1, and that Psc1 mRNA and protein undergo multiple forms of regulation, supporting a model in which Psc1 could play multiple roles in the processing and regulation of RNA (Fig. 7).
7.1: Is Psc1 an RNA export protein? A role for Psc1 in mRNA nuclear export is still to be established. The results in this thesis, coupled with research on the Drosophila homologue swm, however, support this as a likely function. Psc1 was shown to interact with Pabpn1. This interaction is conserved between Drosophila and mouse and interaction between swm and PABP2, the Drosophila homologue of Pabpn1, has been demonstrated (Giot et al., 2003). In Drosophila, swm and PABP2 function together in an mRNA export complex (Hurt et al., 2009). This complex also contains dZC3H3, an mRNA export protein that directly interacts with the core mRNA export receptor NXF1 (TAP1 in mammals). The function of both Pabpn1 and ZC3H3 in mRNA export has been shown to be conserved in mammalian cells (Benoit et al., 2005; Apponi et al., 2010; Hurt et al., 2009). This supports a model in which Psc1 functions in mRNA nuclear export through the formation of a complex with Pabpn1 and ZC3H3 (Fig. 7E). The Psc1/Pabpn1/ZC3H3 complex would facilitate the nuclear export of the bound mRNA transcript through an interaction with TAP1, which in turn interfaces with the nuclear pore complex, resulting in the transcript being transported into the cytoplasm. Following the export of the transcript the Psc1/Pabpn1/ZC3H3 complex may disassociate at the nuclear envelope or continue to interact with and regulate the mRNA in the cytoplasm (Fig. 7F). There is evidence that Pabpn1 remains attached to mRNA in the cytoplasm (Hosada et al., 2006), and Psc1 is known to localise to the cytoplasm in cytospeckles.
242
243
To confirm the proposed role for mammalian Psc1 in mRNA export, experiments need to be performed to show that a reduction of Psc1 protein levels leads to nuclear accumulation of mRNA, as previously demonstrated for swm, PABP2 and ZC3H3 (Hurt et al., 2009; Farny et al., 2008). Furthermore, interaction between Psc1 and mammalian ZC3H3 needs to be demonstrated to confirm composition and conservation of the export complex. The interaction between Psc1 and TAP1 should also be investigated to see if Psc1 interacts directly with the core RNA export machinery or is dependent on other TAP1 binding proteins, such as ZC3H3, in order to function in RNA export. An interaction between swm and NXF1 has not been tested. To test what happens after export, the presence of Pabpn1/ZC3H3/RNA in cytoplasmic Psc1- containing complexes needs to be determined.
It is unclear when the Psc1/Pabpn1/ZC3H3 export complex would form. Pabpn1 binds to pre-mRNA during 3'end formation. Potentially, Pabpn1 bound mRNA interacts with Psc1 and ZC3H3 at or near the nuclear envelope to facilitate nuclear export (Fig. 7E). Alternatively, the Psc1/Pabpn1/ZC3H3 complex could form around the time of 3'end processing and potentially regulate poly(A) tail addition (Fig. 7C). This complex would then escort the mRNA to the nuclear envelope and regulate nuclear export through interaction with TAP1 (Fig 7D, E). Pabpn1 can function in the regulation of polyadenylation of the pre-mRNA transcript, and there is evidence that removal of both swm and dZC3H3 can result in transcript hyperadenylation (Hurt et al., 2009; Yamamoto-Hino et al., 2010). Blocked RNA export has been extensively linked to transcript hyperadenylation, however, recent evidence suggests that this may be due to export factors directly participating in 3'end processing events (reviewed in Glaunsinger et al., 2010). Splicing and 3' end processing are linked, and Psc1 has been identified as a spliceosomal associated protein (Chen et al., 2007); this also supports an association between Psc1 and pre-mRNA and favours the formation of a Psc1/Pabpn1/ZC3H3 complex on the mRNA during 3’ end formation. Experiments testing a function for Psc1 and ZC3H3 in 3'end formation, either through direct involvement or through regulation of Pabpn1, could help determine the timing and complete function of the complex.
244
In this thesis Psc1 was found to interact in a complex with the SR protein SF2/ASF. SF2/ASF is a nucleo-cytoplasmic shuttling protein that has been shown to interact directly with TAP/NXF1, and can activate export of mRNA (Huang et al., 2003). The model of Psc1 as an mRNA export protein could also involve SF2/ASF. SF2/ASF may be part of the Psc1/Pabpn1/ZC3H3 mRNA export complex, or alternatively Psc1 may interact with export complexes that are determined by the nature of the mRNA transcript involved. SF2 has been shown to have the ability to affect the translation and stability of specific transcripts (Sanford et al., 2005; Sanford et al., 2004; Lemaire et al., 2002), suggesting protein composition of mRNA export complexes could play important regulatory role for mRNA in the cytoplasm
7.2: What is Psc1 target mRNA? A model which identifies Psc1 as an mRNA export protein raises the question of which transcripts are regulated by Psc1 and, importantly, what is the cellular and biological effect of the regulation. No mRNA targets have been identified for Psc1. However, a specific mRNA target has been identified for swm. Swm was found to be a key regulator of the nuclear export of the transcript for the enzyme α1,3-fucosyltransferase (FucTA), a glycosyltransferase that directly catalyzes α1,3-fucosylation (Yamamoto- hino et al., 2010). α1,3-fucosylation of proteins is a post-translational modification that is abundant in Drosophila neural cells and essential for correct neural development, cellular function, and fly behaviour. dsRNA knockdown of swm caused a nearly 10 fold increase in FucTA mRNA in the nucleus compared to control cells, demonstrating a role for swm in the nuclear export of FucTA mRNA. Knockdown of swm was also found to decrease transcription and increase poly(A) tail length of FucTA mRNA; no effects on RNA stability, 5'end processing, or splicing were detected.
In mammals, duplication events have resulted in multiple homologues of FucTA. FUT3, FUT4, FUT5, FUT6, FUT9, FUT10, and FUT11 all function to catalyze α1, 3- fucosylation and are best characterised for their role in the modification of cell surface carbohydrate structures, such as the Sialyl Lewisx antigen, and play important roles in
245 fertilization, immune response and cancer metastasis (reviewed in: Clark et al., 2013; Schultz et al., 2012; Luhn et al., 2012). The Fut genes provide a target to test transcript specific Psc1 binding, and whether or not RNA targets are conserved between swm and Psc1. Within the RRM of the ARRS family of proteins two unique motifs are found
(P(X)3N(X)7HF(X)2FG(X)3N and A(X)2A(X)2S(X)5NNRFI(X)3W; Kavanagh et al., 2005) suggesting the possibility that the RNA targets of the ARRS proteins are conserved between species. In a model in which Psc1 does interact with Fut mRNA the conservation of this interaction from Drosophila to mammals would imply the importance of Psc1 and Psc1 homologues in the regulation of the α1, 3 fucosylation post- translational modification. Psc1 would also be implicated as a regulator of processes in fertilization, immune response and cancer metastasis. The binding and regulation of Fut mRNA by Psc1 needs to be tested and the potential effect of Psc1 on α1, 3 fucosylation investigated. Regardless of whether or not Psc1 regulates the Fut genes a screen should be performed to identify other Psc1 mRNA targets.
7.3: Psc1 interacts with Sart1 In this study Sart1 was found to interact directly with Psc1; the function of this interaction is still to be determined. Sart1 is involved in tri-snRNP recruitment to the spliceosome (Makarova et al., 2001), and has been shown to regulate transcription, enhancing expression of VEGF and erythropoietin in response to hypoxia (Gupta et al., 2000). In ES cells Sart1 was shown to be part of at least two differently sized complexes. Psc1 predominantly eluted with the larger of the Sart1 containing fractions, fitting a model where Sart1 may have multiple functions but not all of them involve an interaction with Psc1. The fractions that contained both Psc1 and Sart1 correspond to fractions consistent with complexes the size of the tri-snRNP (Meister et al., 2001; Maita et al., 2005). Multiple proteomic studies have been performed to identify proteins that interact with the spliceosome and spliceosomal complexes (reviewed in Cvitkovic and Jurica, 2012). Psc-1 has been identified in one of these studies (Chen et al., 2007), suggesting a model where Psc1 is unlikely to be a core spliceosomal component, but under the right conditions, and perhaps with specific transcripts, Psc1
246 does associate with the spliceosome through an interaction with Sart1 (Fig. 7B). Psc1 has not yet been shown to function in transcriptional regulation, however, swm was found to increase transcription of FucTA (Yamamoto-hino et al., 2010), suggesting the possibility that Psc1 and Sart1 may also interact in the context of transcriptional regulation of specific genes (Fig. 7A).
Isolation and identification through mass spectrometry of the Sart1 interacting proteins from different size fractions needs to be performed to better understand the alternative Sart1 functions and what role or roles Psc1 plays. Experiments need to be performed to test the effect of Psc1 on spliceosome formation and the effect of Psc1 on Sart1 interaction with the tri-snRNP and spliceosome.
7.4: Psc1 and Sart1 co-localise to the nucleoli Co-localisation studies in this thesis found that Sart1 localised to nucleoli, and over expression of Sart1 resulted in visualization of Psc1 in nucleoli, a stark contrast to previous observations in which Psc1 was found to be specifically excluded (Kavanagh et al, 2005). A search of a nucleolar protein database found endogenous Psc1 is associated with nucleoli under normal conditions (Leung et al, 2006; Ahmad et al., 2009). These results suggest a model where Psc1 and Sart1 may functionally interact in the nucleoli. Further research on the functional relationship between Psc1 and Sart1 is needed to clarify the reason for their nucleolar localisation. Although the main function of nucleoli is ribosome biogenesis multiple other functions have also be found to take place (reviewed in Boisvert et al., 2007). A possible link between the nucleolus and a Sart1/Psc1 complex is the processing of the snRNA components of the tri-snRNP. All snRNAs of the tri-snRNP have been found to localise to nucleoli (Gerbi 2002) and U6 snRNA maturation occurs in nucleoli (Tycowskiet et al., 1998; Ganot et al., 1999; Lange and Gerbi et al., 2000). A number of RNA binding proteins have recently been found to function in both mRNA and non coding RNA metabolism, including ASF/SF2 and Pabpn1 (Wu et al., 2010; Beuleiu et al., 2012).
247
7.5: Regulation of a multifunctional Psc1 In the model of Psc1 function presented in figure 7 the many suggested roles of Psc1 in RNA metabolism would require multiple levels of regulation for Psc1 to function correctly. Work in this thesis has shown that Psc1 is regulated in a variety of ways. Psc1 RNA was found to be alternatively spliced and variant 3’UTRs were detected. Psc1 protein was found to undergo multiple post-translational modifications. It is modified in such a way that migration in SDS-PAGE is altered, and it is O- glycosylated at more than one site. Although not tested in this thesis it would be expected that Psc1 is also phosphorylated. Almost all known O-GlcNAcylated proteins are also phosphoproteins (Wang and Hart, 2008). Cross-talk between these two post- translational modifications is extensive, and can arise both by competition for occupancy at the same or proximal sites and modification of the others enzymatic machinery (Wang et al., 2008; Hart et al., 2011). Together O-GlcNAcylation and phosphorylation potentially permit an almost continuous analogue control of a protein’s function, allowing for multiple distinct molecular interactions (Hart et al., 2011; Hart et al., 2007). Further study of Psc1 modification, the pathways that lead to modification, and the biological triggers, will be required to fully understand Psc1 function.
7.6: What is the biological significance of Psc1? In addition to the study of Psc1 as an RNA binding protein, the question of the biological role of Psc1 in cells and organisms arises. Previous work on Psc1 has shown that it is down regulated in early embryo development as the cells of the inner cell mass differentiate into primitive ectoderm, and work in this thesis has further characterised the down regulation of Psc1 RNA and protein in the ES-EPL cell model system, supporting a role for Psc1 in early development. Beyond this there are very few precise mapping details of Psc1 expression available and no knockout mouse has been generated. One study that generated a genome-wide transcriptome atlas of the 14.5 day mouse embryo detected high levels of Psc1 in the olfactory epithelium and vomeronasal organ (Diez-Roux et al, 2011). The expression of Psc1 during
248 development and in the embryo and adult needs to be better mapped to find out where and when it is important. Swm has been shown to be a negative regulator of Hedgehog signaling downstream of the Smo receptor (Casso et al., 2008), an area of research that is likely to be worth pursuing in an effort to understand Psc1 function. The potential role Psc1 may have in Hedgehog regulated development will depend on when and where Psc1 is expressed. Expression patterns will also be important in determining the biological significance of Psc1 α1,3-fucosylation regulation if Psc1 is proven to regulate expression of any of the Fut proteins.
Psc1 has not yet been linked to any diseases, however a GCG repeat expansion within Pabpn1 causes the disease oculopharyngeal muscular dystrophy (OPMD), a dominant late onset disease characterised by muscle weakness mostly in the eyelids and pharynx, and at the cellular level by intranuclear inclusions. GCG expanded Pabpn1 is fully active in poly(A) tail extension in vivo, and OPMD tissue shows no defect in poly(A) tail length, suggesting that the expansion may affect one of the other Pabpn1 functions or that the nuclear aggregates themselves may cause OPMD (reviewed Brais, 2009). Recent work has shown that Pabpn1 has a role in the selection of alternative polyadenylation sites, and tissue from OPMD patients shows an overall reduction in 3'UTR length, suggesting a possible cause of disease (de Klerk et al., 2012; Jenal et al., 2012). In this thesis experiments showed that Psc1 and Pabpn1 co-localise in the nucleus and in nuclear speckles, with some of the speckles seemingly very intense, potentially indicating Pabpn1 aggregates (Fig. 5.10). This can be readily tested in future experiments as Pabpn1 aggregates are insoluble in 1M KCL or 0.1% SDS, whereas nuclear speckles are soluble. There is currently no genetic link between OPMD and Psc1 in humans. However, if study of OPMD tissue shows Psc1 in Pabpn1 aggregates then potentially the sequestering of Psc1 to the inclusions could play a role in some aspects of OPMD pathology.
The model of Psc1 function that has been proposed (Fig. 7) describes Psc1 as a chaperone type protein that functions to accompany and regulate specific transcripts as they are processed and transported through the nucleus into the cytoplasm. This model
249 is consistent with the binding partners of Psc1, Pabpn1 and Sart1, having multiple and different roles in RNA metabolism, and the localisation of Psc1 to multiple sites in the nucleus. Psc1 is proposed to function in transcription and nuclear export, and to potentially influence spliceosome formation and polyadenylation through regulation of Sart1 and Pabpn1 respectively. Following the export of the transcript, the Psc1/Pabpn1/ZC3H3 complex may disassociate at the nuclear envelope or continue to interact with and regulate the mRNA in the cytoplasm. The function of Psc1 localisation to the nucleolus remains unknown, as do the identity and function of Psc1 cytospeckles. While these may have an as yet unidentified role in mRNA metabolism, the possibility of a role in non-coding RNA metabolism also exits.
250
REFERENCES
251
REFERENCES:
Ahmad, Y., Boisvert, F.-M., Gregor, P., Cobley, A. and Lamond, A. I. (2009). NOPdb: Nucleolar Proteome Database--2008 update. Nucleic Acids Res. 37, D181–D184.
Andersen, J. S., Lam, Y. W., Leung, A. K. L., Ong, S.-E., Lyon, C. E., Lamond, A. I. and Mann, M. (2005). Nucleolar proteome dynamics. Nature 433, 77–83.
Anderson, P. and Kedersha, N. (2006). RNA granules. J. Cell Biol. 172, 803–808.
Andrade, L. E., Chan, E. K., Raska, I., Peebles, C. L., Roos, G. and Tan, E. M. (1991). Human autoantibody to a novel protein of the nuclear coiled body: immunological characterization and cDNA cloning of p80-coilin. J. Exp. Med. 173, 1407–1419.
Andreassi, C. and Riccio, A. (2009). To localize or not to localize: mRNA fate is in 3′UTR ends. Trends Cell Biol. 19, 465–474.
Änkö, M.-L., Müller-McNicoll, M., Brandl, H., Curk, T., Gorup, C., Henry, I., Ule, J. and Neugebauer, K. M. (2012). The RNA-binding landscapes of two SR proteins reveal unique functions and binding to diverse RNA classes. Genome Biol. 13, R17.
Apponi, L. H., Leung, S. W., Williams, K. R., Valentini, S. R., Corbett, A. H. and Pavlath, G. K. (2010). Loss of nuclear poly(A)-binding protein 1 causes defects in myogenesis and mRNA biogenesis. Hum. Mol. Genet. 19, 1058–1065.
Ashton-Beaucage, D., Udell, C. M., Lavoie, H., Baril, C., Lefrançois, M., Chagnon, P., Gendron, P., Caron-Lizotte, O., Bonneil, E., Thibault, P., et al. (2010). The exon junction complex controls the splicing of MAPK and other long intron- containing transcripts in Drosophila. Cell 143, 251–262.
252
Awasthi, S. and Alwine, J. C. (2003). Association of polyadenylation cleavage factor I with U1 snRNP. RNA 9, 1400–1409.
Azubel, M., Habib, N., Sperling, R. and Sperling, J. (2006). Native spliceosomes assemble with pre-mRNA to form supraspliceosomes. J. Mol. Biol. 356, 955–966.
Bächner, D., Kreienkamp, H. J. and Richter, D. (2002). MIZIP, a highly conserved, vertebrate specific melanin-concentrating hormone receptor 1 interacting zinc- finger protein. FEBS Lett. 526, 124–128.
Ballut, L., Marchadier, B., Baguet, A., Tomasetto, C., Séraphin, B. and Le Hir, H. (2005). The exon junction core complex is locked onto RNA by inhibition of eIF4AIII ATPase activity. Nat. Struct. Mol. Biol. 12, 861–869.
Baltz, J. M., Williams, P. O. and Cone, R. A. (1990). Dense fibers protect mammalian sperm against damage. Biol. Reprod. 43, 485–491.
Banerjee, P. S., Hart, G. W. and Cho, J. W. (2013). Chemical approaches to study O-GlcNAcylation. Chem. Soc. Rev. 42, 4345–4357.
Barckmann, B. and Simonelig, M. (2013a). Control of maternal mRNA stability in germ cells and early embryos. Biochim. Biophys. Acta 1829, 714–24.
Barckmann, B. and Simonelig, M. (2013b). Control of maternal mRNA stability in germ cells and early embryos. Biochim. Biophys. Acta 1829, 714–24.
Barnard, D. C., Li, J., Peng, R. and Patton, J. G. (2002). Regulation of alternative splicing by SRrp86 through coactivation and repression of specific SR proteins. RNA 8, 526–533.
Baurén, G. and Wieslander, L. (1994). Splicing of Balbiani ring 1 gene pre-mRNA occurs simultaneously with transcription. Cell 76, 183–192.
253
Beaulieu, Y. B., Kleinman, C. L., Landry-Voyer, A. M., Majewski, J. and Bachand, F. (2012). Polyadenylation-Dependent Control of Long Noncoding RNA Expression by the Poly(A)-Binding Protein Nuclear 1. PLoS Genet. 8,.
Bedard, K. M., Daijogo, S. and Semler, B. L. (2007). A nucleo-cytoplasmic SR protein functions in viral IRES-mediated translation initiation. EMBO J. 26, 459– 467.
Benoit, B., Mitou, G., Chartier, A., Temme, C., Zaessinger, S., Wahle, E., Busseau, I. and Simonelig, M. (2005). An essential cytoplasmic function for the nuclear poly(A) binding protein, PABP2, in poly(A) tail length control and early development in Drosophila. Dev. Cell 9, 511–522.
Berget, S. M. (1995). Exon recognition in vertebrate splicing. J. Biol. Chem. 270, 2411-2414.
Bessonov, S., Anokhina, M., Krasauskas, A., Golas, M. M., Sander, B., Will, C. L., Urlaub, H., Stark, H. and Lührmann, R. (2010). Characterization of purified human Bact spliceosomal complexes reveals compositional and morphological changes during spliceosome activation and first step catalysis. RNA 16, 2384– 2403.
Beyer, A. L. and Osheim, Y. N. (1988). Splice site selection, rate of splicing, and alternative splicing on nascent transcripts. Genes Dev. 2, 754–765.
Bhattacharjee, R. B. and Bag, J. (2012). Depletion of Nuclear Poly(A) Binding Protein PABPN1 Produces a Compensatory Response by Cytoplasmic PABP4 and PABP5 in Cultured Human Cells. PLoS One 7 (12).
Black, D. L. (2000). Protein diversity from Alternative Splicing: A challenge for Bioinformatics and Post-Genome Biology. Cell 103, 367-370.
Blanchette, M., Labourier, E., Green, R. E., Brenner, S. E. and Rio, D. C. (2004). Genome-wide analysis reveals an unexpected function for the Drosophila splicing
254
factor U2AF50 in the nuclear export of intronless mRNAs. Mol. Cell 14, 775– 786.
Blencowe, B. J. (2000). Exonic splicing enhancers: mechanism of action, diversity and role in human genetic diseases. Trends Biochem. Sci. 25, 106–110.
Blencowe, B. J. (2006). Alternative splicing: new insights from global analyses. Cell 126, 37–47.
Blencowe, B. J., Issner, R., Nickerson, J. A. and Sharp, P. A. (1998). A coactivator of pre-mRNA splicing. Genes Dev. 12, 996–1009.
Boelens, W. C., Jansen, E. J., van Venrooij, W. J., Stripecke, R., Mattaj, I. W. and Gunderson, S. I. (1993). The human U1 snRNP-specific U1A protein inhibits polyadenylation of its own pre-mRNA. Cell 72, 881–892.
Boisvert, F.-M., van Koningsbruggen, S., Navascués, J. and Lamond, A. I. (2007). The multifunctional nucleolus. Nat. Rev. Mol. Cell Biol. 8, 574–585.
Bond, C. S. and Fox, A. H. (2009). Paraspeckles: nuclear bodies built on long noncoding RNA. J. Cell Biol. 186, 637–644.
Bono, F., Gehring, N. H. (2011). Assembly, disassembly and recycling: the dynamics of exon junction complexes. RNA Biol. 8, 1-6.
Botquin, V., Hess, H., Fuhrmann, G., Anastassiadis, C., Gross, M. K., Vriend, G. and Schöler, H. R. (1998). New POU dimer configuration mediates antagonistic control of an osteopontin preimplantation enhancer by Oct-4 and Sox-2. Genes Dev. 12, 2073–2090.
Boucher, L., Ouzounis, C. A., Enright, A. J. and Blencowe, B. J. (2001). A genome- wide survey of RS domain proteins. RNA 7, 1693–1701.
255
Bourgeois, C. F., Lejeune, F. and Stévenin, J. (2004). Broad specificity of SR (serine/arginine) proteins in the regulation of alternative splicing of pre-messenger RNA. Prog. Nucleic Acid Res. Mol. Biol. 78, 37–88.
Bradley, A., Evans, M., Kaufman, M. G. and Robertson E. (1984). Formation of germ-line chimaeras from embryo-derived teratocarcinoma cell lines. Nature 309, 255-6.
Brais, B. (2009). Oculopharyngeal muscular dystrophy: a polyalanine myopathy. Curr. Neurol. Neurosci. Rep. 9, 76–82.
Brasse-Lagnel, C., Fairand, A., Lavoinne, A. and Husson, A. (2003). Glutamine stimulates argininosuccinate synthetase gene expression through cytosolic O- glycosylation of Sp1 in Caco-2 cells. J. Biol. Chem. 278, 52504–52510.
Brown, J. M., Green, J., das Neves, R. P., Wallace, H. A. C., Smith, A. J. H., Hughes, J., Gray, N., Taylor, S., Wood, W. G., Higgs, D. R., et al. (2008). Association between active genes occurs at nuclear speckles and is modulated by chromatin environment. J. Cell Biol. 182, 1083–1097.
Buchwald, G., Ebert, J., Basquin, C., Sauliere, J., Jayachandran, U., Bono, F., Le Hir, H. and Conti, E. (2010). Insights into the recruitment of the NMD machinery from the crystal structure of a core EJC-UPF3b complex. Proc. Natl. Acad. Sci. U. S. A. 107, 10050–10055.
Caceres, J. F. and Krainer, A. R. (1993). Functional analysis of pre-mRNA splicing factor SF2/ASF structural domains. EMBO J. 12, 4715–4726.
Cáceres, J. F., Misteli, T., Screaton, G. R., Spector, D. L. and Krainer, A. R. (1997). Role of the modular domains of SR proteins in subnuclear localization and alternative splicing specificity. J. Cell Biol. 138, 225–238.
256
Cáceres, J. F., Screaton, G. R. and Krainer, A. R. (1998). A specific subset of SR proteins shuttles continuously between the nucleus and the cytoplasm. Genes Dev. 12, 55–66.
Calado, A. and Carmo-Fonseca, M. (2000a). Localization of poly(A)-binding protein 2 (PABP2) in nuclear speckles is independent of import into the nucleus and requires binding to poly(A) RNA. J. Cell Sci. 113 ( Pt 1, 2309–2318.
Calado, A., Kutay, U., Kühn, U., Wahle, E. and Carmo-Fonseca, M. (2000b). Deciphering the cellular pathway for transport of poly(A)-binding protein II. RNA 6, 245–256.
Carninci, P. (2009). Molecular biology: The long and short of RNAs. Nature 457, 974–975.
Cartegni, L., Maconi, M., Morandi, E., Cobianchi, F., Riva, S. and Biamonti, G. (1996). hnRNP A1 selectively interacts through its Gly-rich domain with different RNA-binding proteins. J. Mol. Biol. 259, 337–348.
Casso, D. J., Liu, S., Iwaki, D. D., Ogden, S. K. and Kornberg, T. B. (2008). A screen for modifiers of hedgehog signaling in Drosophila melanogaster identifies swm and mts. Genetics 178, 1399–1413.
Cazalla, D., Zhu, J., Manche, L., Huber, E., Krainer, A. R. and Cáceres, J. F. (2002). Nuclear export and retention signals in the RS domain of SR proteins. Mol. Cell. Biol. 22, 6871–6882.
Chambers, I., Colby, D., Robertson, M., Nichols, J., Lee, S., Tweedie, S. and Smith, A. (2003). Functional expression cloning of Nanog, a pluripotency sustaining factor in embryonic stem cells. Cell 113, 643–655.
Chang, Y.-F., Imam, J. S. and Wilkinson, M. F. (2007). The nonsense-mediated decay RNA surveillance pathway. Annu. Rev. Biochem. 76, 51–74.
257
Chatham, J. C. and Marchase, R. B. (2010). The role of protein O-linked beta-N- acetylglucosamine in mediating cardiac stress responses. Biochim. Biophys. Acta 1800, 57–66.
Chen, L.-L. and Carmichael, G. G. (2009). Altered nuclear retention of mRNAs containing inverted repeats in human embryonic stem cells: functional role of a nuclear noncoding RNA. Mol. Cell 35, 467–478.
Chen, D. and Huang, S. (2001). Nucleolar components involved in ribosome biogenesis cycle between the nucleolus and nucleoplasm in interphase cells. J. Cell Biol. 153, 169–176.
Chen, J.-M., Férec, C. and Cooper, D. N. (2006). A systematic analysis of disease- associated variants in the 3’ regulatory regions of human protein-coding genes I: general principles and overview. Hum. Genet. 120, 1–21.
Chen, Y.-I. G., Moore, R. E., Ge, H. Y., Young, M. K., Lee, T. D. and Stevens, S. W. (2007). Proteomic analysis of in vivo-assembled pre-mRNA splicing complexes expands the catalog of participating factors. Nucleic Acids Res. 35, 3928–3944.
Cheng, H., Dufu, K., Lee, C.-S., Hsu, J. L., Dias, A. and Reed, R. (2006). Human mRNA export machinery recruited to the 5’ end of mRNA. Cell 127, 1389–1400.
Cheung, W. D., Sakabe, K., Housley, M. P., Dias, W. B. and Hart, G. W. (2008). O-linked beta-N-acetylglucosaminyltransferase substrate specificity is regulated by myosin phosphatase targeting and other interacting proteins. J. Biol. Chem. 283, 33935–33941.
Cioce, M. and Lamond, A. I. (2005). Cajal bodies: a long history of discovery. Annu. Rev. Cell Dev. Biol. 21, 105–131.
Clark, G. F. (2013). The role of carbohydrate recognition during human sperm-egg binding. Hum. Reprod. 28, 566–77.
258
Cmarko, D., Verschure, P. J., Martin, T. E., Dahmus, M. E., Krause, S., Fu, X. D., van Driel, R. and Fakan, S. (1999). Ultrastructural analysis of transcription and splicing in the cell nucleus after bromo-UTP microinjection. Mol. Biol. Cell 10, 211–223.
Colwill, K., Feng, L. L., Yeakley, J. M., Gish, G. D., Cáceres, J. F., Pawson, T. and Fu, X. D. (1996). SRPK1 and Clk/Sty protein kinases show distinct substrate specificities for serine/arginine-rich splicing factors. J. Biol. Chem. 271, 24569– 24575.
Cooke, C., Hans, H. and Alwine, J. C. (1999). Utilization of splicing elements and polyadenylation signal elements in the coupling of polyadenylation and last-intron removal. Mol. Cell. Biol. 19, 4971–4979.
Cowper, A. E., Cáceres, J. F., Mayeda, A. and Screaton, G. R. (2001). Serine- arginine (SR) protein-like factors that antagonize authentic SR proteins and regulate alternative splicing. J. Biol. Chem. 276, 48908–48914.
Cuccurese, M., Russo, G., Russo, A. and Pietropaolo, C. (2005). Alternative splicing and nonsense-mediated mRNA decay regulate mammalian ribosomal gene expression. Nucleic Acids Res. 33, 5965–5977.
Cvitkovic, I. and Jurica, M. S. (2013). Spliceosome database: a tool for tracking components of the spliceosome. Nucleic Acids Res. 41, D132–41.
Das, R., Yu, J., Zhang, Z., Gygi, M. P., Krainer, A. R., Gygi, S. P. and Reed, R. (2007). SR proteins function in coupling RNAP II transcription to pre-mRNA splicing. Mol. Cell 26, 867–881.
Davuluri, R. V, Suzuki, Y., Sugano, S. and Zhang, M. Q. (2000). CART classification of human 5’ UTR sequences. Genome Res. 10, 1807–1816.
De Klerk, E., Venema, A., Anvar, S. Y., Goeman, J. J., Hu, O., Trollet, C., Dickson, G., den Dunnen, J. T., van der Maarel, S. M., Raz, V., et al. (2012).
259
Poly(A) binding protein nuclear 1 levels affect alternative polyadenylation. Nucleic Acids Res. 40, 9089–101.
De Lima Morais, D. A. and Harrison, P. M. (2010). Large-scale evidence for conservation of NMD candidature across mammals. PLoS One 5, e11695.
Dias, W. B. and Hart, G. W. (2007). O-GlcNAc modification in diabetes and Alzheimer’s disease. Mol. Biosyst. 3, 766–772.
Dieci, G., Preti, M. and Montanini, B. (2009). Eukaryotic snoRNAs: A paradigm for gene expression flexibility. Genomics 94, 83–88.
Diem, M. D., Chan, C. C., Younis, I. and Dreyfuss, G. (2007). PYM binds the cytoplasmic exon-junction complex and ribosomes to enhance translation of spliced mRNAs. Nat. Struct. Mol. Biol. 14, 1173–1179.
Diez-Roux, G., Banfi, S., Sultan, M., Geffers, L., Anand, S., Rozado, D., Magen, A., Canidio, E., Pagani, M., Peluso, I., et al. (2011). A high-resolution anatomical atlas of the transcriptome in the mouse embryo. PLoS Biol. 9,.
Dong, X., Zavitz, K. H., Thomas, B. J., Lin, M., Campbell, S. and Zipursky, S. L. (1997). Control of G1 in the developing Drosophila eye: rca1 regulates Cyclin A. Genes Dev. 11, 94–105.
Donkor, F. F., Mönnich, M., Czirr, E., Hollemann, T. and Hoyer-Fender, S. (2004). Outer dense fibre protein 2 (ODF2) is a self-interacting centrosomal protein with affinity for microtubules. J. Cell Sci. 117, 4643–4651.
Dorfmueller, H. C. and van Aalten, D. M. F. (2010). Screening-based discovery of drug-like O-GlcNAcase inhibitor scaffolds. FEBS Lett. 584, 694–700.
Eldridge, A. G., Li, Y., Sharp, P. A. and Blencowe, B. J. (1999). The SRm160/300 splicing coactivator is required for exon-enhancer function. Proc. Natl. Acad. Sci. U. S. A. 96, 6125–6130.
260
Ellis, J. D., Llères, D., Denegri, M., Lamond, A. I. and Cáceres, J. F. (2008). Spatial mapping of splicing factor complexes involved in exon and intron definition. J. Cell Biol. 181, 921–934.
Eperon, I. C., Makarova, O. V, Mayeda, A., Munroe, S. H., Cáceres, J. F., Hayward, D. G. and Krainer, A. R. (2000). Selection of alternative 5’ splice sites: role of U1 snRNP and models for the antagonistic effects of SF2/ASF and hnRNP A1. Mol. Cell. Biol. 20, 8303–8318.
Eulalio, A., Behm-Ansmant, I. and Izaurralde, E. (2007). P bodies: at the crossroads of post-transcriptional pathways. Nat. Rev. Mol. Cell Biol. 8, 9–22.
Evans, M. J. and Kaufman, M. H. (1981). Establishment in culture of pluripotential cells from mouse embryos. Nature 292, 154–156.
Eystathioy, T., Jakymiw, A., Chan, E. K. L., Séraphin, B., Cougot, N. and Fritzler, M. J. (2003). The GW182 protein colocalizes with mRNA degradation associated proteins hDcp1 and hLSm4 in cytoplasmic GW bodies. RNA 9, 1171–1173.
Fabian, M. R., Sonenberg, N. and Filipowicz, W. (2010). Regulation of mRNA translation and stability by microRNAs. Annu. Rev. Biochem. 79, 351–379.
Fakan, S. (1994). Perichromatin fibrils are in situ forms of nascent transcripts. Trends Cell Biol. 4, 86–90.
Farny, N. G., Hurt, J. A. and Silver, P. A. (2008). Definition of global and transcript- specific mRNA export pathways in metazoans. Genes Dev. 22, 66–78.
Filipowicz, W., Bhattacharyya, S. N. and Sonenberg, N. (2008). Mechanisms of post-transcriptional regulation by microRNAs: are the answers in sight? Nat. Rev. Genet. 9, 102–114.
Foley, E. and Sprenger, F. (2001). The cyclin-dependent kinase inhibitor Roughex is involved in mitotic exit in Drosophila. Curr. Biol. 11, 151–160.
261
Fritzler, M. J. and Chan, E. K. L. (2007). GW Bodies, P bodies and components of the miRNA pathway. In Autoantibodies, pp. 257–262.
Fu, Y., Sun, Y., Li, Y., Li, J., Rao, X., Chen, C. and Xu, A. (2011). Differential genome-wide profiling of tandem 3’ UTRs among human breast cancer and normal cells by high-throughput sequencing. Genome Res. 21, 741–747.
Gall, J. G. (2000). Cajal bodies: the first 100 years. Annu. Rev. Cell Dev. Biol. 16, 273–300.
Ganot, P., Jády, B. E., Bortolin, M. L., Darzacq, X. and Kiss, T. (1999). Nucleolar factors direct the 2’-O-ribose methylation and pseudouridylation of U6 spliceosomal RNA. Mol. Cell. Biol. 19, 6906–6917.
Gay, P. and Contamine, D. (1993). Study of the ref(2)P locus of Drosophila melanogaster. II. Genetic studies of the 37DF region. Mol. Gen. Genet. 239, 361– 370.
Gehring, N. H., Kunz, J. B., Neu-Yilik, G., Breit, S., Viegas, M. H., Hentze, M. W. and Kulozik, A. E. (2005). Exon-junction complex components specify distinct routes of nonsense-mediated mRNA decay with differential cofactor requirements. Mol. Cell 20, 65–75.
Gerbi, S. A. and Lange, T. S. (2002). All small nuclear RNAs (snRNAs) of the [U4/U6.U5] Tri-snRNP localize to nucleoli; Identification of the nucleolar localization element of U6 snRNA. Mol. Biol. Cell 13, 3123–3137.
Ghosh, G. and Adams, J. A. (2011). Phosphorylation mechanism and structure of serine-arginine protein kinases. FEBS J. 278, 587–597.
Giot, L. B. (2003). A Protein Interaction Map of Drosophila melanogaster. Science (80-. ). 1727–1736.
262
Girard, C., Will, C. L., Peng, J., Makarov, E. M., Kastner, B., Lemm, I., Urlaub, H., Hartmuth, K. and Lührmann, R. (2012). Post-transcriptional spliceosomes are retained in nuclear speckles until splicing completion. Nat. Commun. 3, 994.
Glaunsinger, B. A., Lee, Y. J. (2010). How tails define the ending: divergent roles for polyadenylation in RNA stability and gene expression. RNA Biol. 7, 13-17.
Gonzalez-Santos, J. M., Wang, A., Jones, J., Ushida, C., Liu, J. and Hu, J. (2002). Central region of the human splicing factor Hprp3p interacts with Hprp4p. J. Biol. Chem. 277, 23764–23772.
Gottschalk, A., Neubauer, G., Banroques, J., Mann, M., Lührmann, R. and Fabrizio, P. (1999). Identification by mass spectrometry and functional analysis of novel proteins of the yeast [U4/U6.U5] tri-snRNP. EMBO J. 18, 4535–4548.
Graveley, B. R. (2000). Sorting out the complexity of SR protein functions. RNA 6, 1197–1211.
Graveley, B. R. (2001). Alternative splicing: increasing diversity in the proteomic world. Trends Genet. 17, 100–107.
Graveley, B. R. and Maniatis, T. (1998). Arginine/serine-rich domains of SR proteins can function as activators of pre-mRNA splicing. Mol. Cell 1, 765–771.
Gui, J. F., Tronchère, H., Chandler, S. D. and Fu, X. D. (1994). Purification and characterization of a kinase specific for the serine- and arginine-rich pre-mRNA splicing factors. Proc. Natl. Acad. Sci. U. S. A. 91, 10824–10828.
Guinez, C., Morelle, W., Michalski, J. C. and Lefebvre, T. (2005). O-GlcNAc glycosylation: A signal for the nuclear transport of cytosolic proteins? Int. J. Biochem. Cell Biol. 37, 765–774.
263
Gunderson, S. I., Polycarpou-Schwarz, M. and Mattaj, I. W. (1998). U1 snRNP inhibits pre-mRNA polyadenylation through a direct interaction between U1 70K and poly(A) polymerase. Mol. Cell 1, 255–264.
Gupta, M., Mungai, P. T. and Goldwasser, E. (2000). A new transacting factor that modulates hypoxia-induced expression of the erythropoietin gene. Blood 96, 491– 497.
Hadjiolova, K. V, Hadjiolov, A. A. and Bachellerie, J. P. (1995). Actinomycin D stimulates the transcription of rRNA minigenes transfected into mouse cells. Implications for the in vivo hypersensitivity of rRNA gene transcription. Eur. J. Biochem. 228, 605–615.
Hall, T. M. (2005). Multiple modes of RNA recognition by zinc finger proteins. Curr Opin Struct Biol 15, 367–373.
Hall, L. L., Smith, K. P., Byron, M. and Lawrence, J. B. (2006). Molecular anatomy of a speckle. Anat. Rec. A. Discov. Mol. Cell. Evol. Biol. 288, 664–675.
Hart, G. W., Housley, M. P. and Slawson, C. (2007). Cycling of O-linked beta-N- acetylglucosamine on nucleocytoplasmic proteins. Nature 446, 1017–1022.
Hart, G. W., Slawson, C., Ramirez-Correa, G. and Lagerlof, O. (2011). Cross talk between O-GlcNAcylation and phosphorylation: roles in signaling, transcription, and chronic disease. Annu. Rev. Biochem. 80, 825–858.
Hasdemir, B., Bunnett, N. W. and Cottrell, G. S. (2007). Hepatocyte growth factor- regulated tyrosine kinase substrate (HRS) mediates post-endocytic trafficking of protease-activated receptor 2 and calcitonin receptor-like receptor. J. Biol. Chem. 282, 29646–29657.
Haub, O. and Goldfarb, M. (1991). Expression of the fibroblast growth factor-5 gene in the mouse embryo. Development 112, 397–406.
264
Hedley, M. L., Amrein, H. and Maniatis, T. (1995). An amino acid sequence motif sufficient for subnuclear localization of an arginine/serine-rich splicing factor. Proc. Natl. Acad. Sci. U. S. A. 92, 11524–11528.
Hillman, R. T., Green, R. E. and Brenner, S. E. (2004). An unappreciated role for RNA surveillance. Genome Biol. 5, R8.
Himmler, A., Drechsel, D., Kirschner, M. W. and Martin, D. W. (1989). Tau consists of a set of proteins with repeated C-terminal microtubule-binding domains and variable N-terminal domains. Mol. Cell. Biol. 9, 1381–1388.
Hosoda, N., Lejeune, F. and Maquat, L. E. (2006). Evidence that poly(A) binding protein C1 binds nuclear pre-mRNA poly(A) tails. Mol. Cell. Biol. 26, 3085– 3097.
Hu, P., Kinyamu, H. K., Wang, L., Martin, J., Archer, T. K. and Teng, C. (2008). Estrogen induces estrogen-related receptor alpha gene expression and chromatin structural changes in estrogen receptor (ER)-positive and ER-negative breast cancer cells. J. Biol. Chem. 283, 6752–6763.
Hu, Y., Kireev, I., Plutz, M., Ashourian, N. and Belmont, A. S. (2009). Large-scale chromatin structure of inducible genes: transcription on a condensed, linear template. J. Cell Biol. 185, 87–100.
Huang, S. and Spector, D. L. (1991). Nascent pre-mRNA transcripts are associated with nuclear regions enriched in splicing factors. Genes Dev. 5, 2288–2302.
Huang, Y. and Steitz, J. A. (2001). Splicing factors SRp20 and 9G8 promote the nucleocytoplasmic export of mRNA. Mol. Cell 7, 899–905.
Huang, Y. and Steitz, J. A. (2005). SRprises along a messenger’s journey. Mol. Cell 17, 613–615.
265
Huang, Y., Gattoni, R., Stévenin, J. and Steitz, J. A. (2003). SR splicing factors serve as adapter proteins for TAP-dependent mRNA export. Mol. Cell 11, 837– 843.
Huang, Y., Yario, T. A. and Steitz, J. A. (2004). A molecular link between SR protein dephosphorylation and mRNA export. Proc. Natl. Acad. Sci. U. S. A. 101, 9666–9670.
Hurt, J. A., Obar, R. A., Zhai, B., Farny, N. G., Gygi, S. P. and Silver, P. A. (2009). A conserved CCCH-type zinc finger protein regulates mRNA nuclear adenylation and export. J. Cell Biol. 185, 265–277.
Ibrahim, E. C., Schaal, T. D., Hertel, K. J., Reed, R. and Maniatis, T. (2005). Serine/arginine-rich protein-dependent suppression of exon skipping by exonic splicing enhancers. Proc. Natl. Acad. Sci. U. S. A. 102, 5002–5007.
Iida, K. and Go, M. (2006). Survey of conserved alternative splicing events of mRNAs encoding SR proteins in land plants. Mol. Biol. Evol. 23, 1085–1094.
Imaizumi, T., Kuramoto, T., Matsunaga, K., Shichijo, S., Yutani, S., Shigemori, M., Oizumi, K. and Itoh, K. (1999). Expression of the tumor-rejection antigen SART1 in brain tumors. Int. J. Cancer 83, 760–764.
Ishigaki, Y., Li, X., Serin, G. and Maquat, L. E. (2001). Evidence for a pioneer round of mRNA translation: mRNAs subject to nonsense-mediated decay in mammalian cells are bound by CBP80 and CBP20. Cell 106, 607–617.
Ishikawa, H., Kubo, A., Tsukita, S. and Tsukita, S. (2005). Odf2-deficient mother centrioles lack distal/subdistal appendages and the ability to generate primary cilia. Nat. Cell Biol. 7, 517–524.
Isken, O. and Maquat, L. E. (2007). Quality control of eukaryotic mRNA: safeguarding cells from abnormal mRNA function. Genes Dev. 21, 1833–1856.
266
Isken, O. and Maquat, L. E. (2008). The multiple lives of NMD factors: balancing roles in gene and genome regulation. Nat. Rev. Genet. 9, 699–712.
Issad, T., Masson, E. and Pagesy, P. (2010). O-GlcNAc modification, insulin signaling and diabetic complications. Diabetes Metab. 36, 423–435.
Jamison, S. F., Pasman, Z., Wang, J., Will, C., Lührmann, R., Manley, J. L. and Garcia-Blanco, M. A. (1995). U1 snRNP-ASF/SF2 interaction and 5’ splice site recognition: characterization of required elements. Nucleic Acids Res. 23, 3260– 3267.
Jan, C. H., Friedman, R. C., Ruby, J. G. and Bartel, D. P. (2011). Formation, regulation and evolution of Caenorhabditis elegans 3’UTRs. Nature 469, 97–101.
Jenal, M., Elkon, R., Loayza-Puch, F., Van Haaften, G., Kühn, U., Menzies, F. M., Vrielink, J. A. F. O., Bos, A. J., Drost, J., Rooijers, K., et al. (2012). The poly(A)-binding protein nuclear 1 suppresses alternative cleavage and polyadenylation sites. Cell 149, 538–553.
Ji, Z. and Tian, B. (2009). Reprogramming of 3’ untranslated regions of mRNAs by alternative polyadenylation in generation of pluripotent stem cells from different cell types. PLoS One 4, e8419.
Jin, X.-H., Uyama, T., Wang, J., Okamoto, Y., Tonai, T. and Ueda, N. (2009). cDNA cloning and characterization of human and mouse Ca(2+)-independent phosphatidylethanolamine N-acyltransferases. Biochim. Biophys. Acta 1791, 32– 38.
Juang, Y.-T., Solomou, E. E., Rellahan, B. and Tsokos, G. C. (2002). Phosphorylation and O-linked glycosylation of Elf-1 leads to its translocation to the nucleus and binding to the promoter of the TCR zeta-chain. J. Immunol. 168, 2865–2871.
267
Jumaa, H. and Nielsen, P. J. (1997). The splicing factor SRp20 modifies splicing of its own mRNA and ASF/SF2 antagonizes this regulation. EMBO J. 16, 5077– 5085.
Kamemura, K., Hayes, B. K., Comer, F. I. and Hart, G. W. (2002). Dynamic interplay between O-glycosylation and O-phosphorylation of nucleocytoplasmic proteins: alternative glycosylation/phosphorylation of THR-58, a known mutational hot spot of c-Myc in lymphomas, is regulated by mitogens. J. Biol. Chem. 277, 19229–19235.
Kaspar, R. L., Kakegawa, T., Cranston, H., Morris, D. R. and White, M. W. (1992). A regulatory cis element and a specific binding factor involved in the mitogenic control of murine ribosomal protein L32 translation. J. Biol. Chem. 267, 508–514.
Kato, J. Y., Matsuoka, M., Polyak, K., Massagué, J. and Sherr, C. J. (1994). Cyclic AMP-induced G1 phase arrest mediated by an inhibitor (p27Kip1) of cyclin- dependent kinase 4 activation. Cell 79, 487–496.
Kavanagh, S. J., Schulz, T. C., Davey, P., Claudianos, C., Russell, C. and Rathjen, P. D. (2005). A family of RS domain proteins with novel subcellular localization and trafficking. Nucleic Acids Res. 33, 1309–1322.
Kawai, J., Shinagawa, A., Shibata, K., Yoshino, M., Itoh, M., Ishii, Y., Arakawa, T., Hara, A., Fukunishi, Y., Konno, H., et al. (2001). Functional annotation of a full-length mouse cDNA collection. Nature 409, 685–690.
Kedde, M. and Agami, R. (2008). Interplay between microRNAs and RNA-binding proteins determines developmental processes. Cell Cycle 7, 899–903.
Keene, J. D. (2010). Minireview: global regulation and dynamics of ribonucleic Acid. Endocrinology 151, 1391–1397.
268
Kervestin, S. and Jacobson, A. (2012). NMD: a multifaceted response to premature translational termination. Nat. Rev. Mol. Cell Biol. 13, 700–712.
Kerwitz, Y., Kühn, U., Lilie, H., Knoth, A., Scheuermann, T., Friedrich, H., Schwarz, E. and Wahle, E. (2003). Stimulation of poly(A) polymerase through a direct interaction with the nuclear poly(A) binding protein allosterically regulated by RNA. EMBO J. 22, 3705–3714.
Kiledjian, M. and Dreyfuss, G. (1992). Primary structure and binding activity of the hnRNP U protein: binding RNA through RGG box. EMBO J. 11, 2655–2664.
Kim, H. S., Park, S. Y., Choi, Y. R., Kang, J. G., Joo, H. J., Moon, W. K. and Cho, J. W. (2009). Excessive O-GlcNAcylation of proteins suppresses spontaneous cardiogenesis in ES cells. FEBS Lett. 583, 2474–2478.
Ko, B. and Gunderson, S. I. (2002). Identification of new poly(A) polymerase- inhibitory proteins capable of regulating pre-mRNA polyadenylation. J. Mol. Biol. 318, 1189–1206.
Ko, M. S., Kitchen, J. R., Wang, X., Threat, T. A., Hasegawa, A., Sun, T., Grahovac, M. J., Kargul, G. J., Lim, M. K., Cui, Y., et al. (2000). Large-scale cDNA analysis reveals phased gene expression patterns during preimplantation mouse development. Development 127, 1737–1749.
Kojima, S., Sher-Chen, E. L. and Green, C. B. (2012). Circadian control of mRNA polyadenylation dynamics regulates rhythmic protein expression. Genes Dev. 26, 2724–36.
Komada, M. and Kitamura, N. (1995). Growth factor-induced tyrosine phosphorylation of Hrs, a novel 115-kilodalton protein with a structurally conserved putative zinc finger domain. Mol. Cell. Biol. 15, 6213–6221.
Komada, M. and Kitamura, N. (2001). Hrs and hbp: possible regulators of endocytosis and exocytosis. Biochem. Biophys. Res. Commun. 281, 1065–1069.
269
Komada, M. and Soriano, P. (1999). Hrs, a FYVE finger protein localized to early endosomes, is implicated in vesicular traffic and required for ventral folding morphogenesis. Genes Dev. 13, 1475–1485.
Kühn, U. and Wahle, E. (2004). Structure and function of poly(A) binding proteins. Biochim. Biophys. Acta - Gene Struct. Expr. 1678, 67–84.
Kühn, U., Nemeth, A., Meyer, S. and Wahle, E. (2003). The RNA binding domains of the nuclear poly(A)-binding protein. J. Biol. Chem. 278, 16916–16925.
Kwong, J., Roundabush, F. L., Hutton Moore, P., Montague, M., Oldham, W., Li, Y., Chin, L. S. and Li, L. (2000). Hrs interacts with SNAP-25 and regulates Ca(2+)-dependent exocytosis. J. Cell Sci. 113 ( Pt 1, 2273–2284.
Kyburz, A., Friedlein, A., Langen, H. and Keller, W. (2006). Direct interactions between subunits of CPSF and the U2 snRNP contribute to the coupling of pre- mRNA 3’ end processing and splicing. Mol. Cell 23, 195–205.
Labourier, E., Bourbon, H. M., Gallouzi, I. E., Fostier, M., Allemand, E. and Tazi, J. (1999). Antagonism between RSF1 and SR proteins for both splice-site recognition in vitro and Drosophila development. Genes Dev. 13, 740–753.
Lai, M.-C. and Tarn, W.-Y. (2004). Hypophosphorylated ASF/SF2 binds TAP and is present in messenger ribonucleoproteins. J. Biol. Chem. 279, 31745–31749.
Lai, E. C., Burks, C. and Posakony, J. W. (1998). The K box, a conserved 3’ UTR sequence motif, negatively regulates accumulation of enhancer of split complex transcripts. Development 125, 4077–4088.
Lai, M. C., Lin, R. I., Huang, S. Y., Tsai, C. W. and Tarn, W. Y. (2000). A human importin-beta family protein, transportin-SR2, interacts with the phosphorylated RS domain of SR proteins. J. Biol. Chem. 275, 7950–7957.
270
Lai, M. C., Lin, R. I. and Tarn, W. Y. (2001). Transportin-SR2 mediates nuclear import of phosphorylated SR proteins. Proc. Natl. Acad. Sci. U. S. A. 98, 10154– 10159.
Lai, E. C., Tam, B. and Rubin, G. M. (2005). Pervasive regulation of Drosophila Notch target genes by GY-box-, Brd-box-, and K-box-class microRNAs. Genes Dev. 19, 1067–1080.
Lake, J., Rathjen, J., Remiszewski, J. and Rathjen, P. D. (2000). Reversible programming of pluripotent cell differentiation. J. Cell Sci. 113 ( Pt 3, 555–566.
Lamond, A. I. and Spector, D. L. (2003). Nuclear speckles: a model for nuclear organelles. Nat. Rev. Mol. Cell Biol. 4, 605–612.
Lange, T. S. and Gerbi, S. A. (2000). Transient nucleolar localization Of U6 small nuclear RNA in Xenopus Laevis oocytes. Mol. Biol. Cell 11, 2419–2428.
Lareau, L., Brooks, A. and Soergel, D. (2007a). The coupling of alternative splicing and nonsense-mediated mRNA decay. In Alternative Splicing in the Postgenomic Era, pp. 190–211.
Lareau, L. F., Brooks, A. N., Soergel, D. A. W., Meng, Q. and Brenner, S. E. (2007b). The coupling of alternative splicing and nonsense-mediated mRNA decay. Adv. Exp. Med. Biol. 623, 190–211.
Lareau, L. F., Inada, M., Green, R. E., Wengrod, J. C. and Brenner, S. E. (2007c). Unproductive splicing of SR genes associated with highly conserved and ultraconserved DNA elements. Nature 446, 926–929.
Le, S. Y. and Maizel, J. V (1997). A common RNA structural motif involved in the internal initiation of translation of cellular mRNAs. Nucleic Acids Res. 25, 362– 369.
271
Le Hir, H. and Andersen, G. R. (2008). Structural insights into the exon junction complex. Curr. Opin. Struct. Biol. 18, 112–119.
Le Hir, H. and Séraphin, B. (2008). EJCs at the heart of translational control. Cell 133, 213–216.
Le Hir, H., Izaurralde, E., Maquat, L. E. and Moore, M. J. (2000). The spliceosome deposits multiple proteins 20-24 nucleotides upstream of mRNA exon-exon junctions. EMBO J. 19, 6860–6869.
Le Hir, H., Gatfield, D., Izaurralde, E. and Moore, M. J. (2001). The exon-exon junction complex provides a binding platform for factors involved in mRNA export and nonsense-mediated mRNA decay. EMBO J. 20, 4987–4997.
Le Hir, H., Nott, A. and Moore, M. J. (2003). How introns influence and enhance eukaryotic gene expression. Trends Biochem. Sci. 28, 215–220.
Lefebvre, T., Ferreira, S., Dupont-Wallois, L., Bussière, T., Dupire, M. J., Delacourte, A., Michalski, J. C. and Caillet-Boudin, M. L. (2003). Evidence of a balance between phosphorylation and O-GlcNAc glycosylation of Tau proteins - A role in nuclear localization. Biochim. Biophys. Acta - Gen. Subj. 1619, 167–176.
Lejeune, F., Ishigaki, Y., Li, X. and Maquat, L. E. (2002). The exon junction complex is detected on CBP80-bound but not eIF4E-bound mRNA in mammalian cells: dynamics of mRNP remodeling. EMBO J. 21, 3536–3545.
Lemaire, R., Prasad, J., Kashima, T., Gustafson, J., Manley, J. L. and Lafyatis, R. (2002). Stability of a PKCI-1-related mRNA is controlled by the splicing factor ASF/SF2: a novel function for SR proteins. Genes Dev. 16, 594–607.
Lemay, J. F., D’Amours, A., Lemieux, C., Lackner, D. H., St-Sauveur, V. G., Bähler, J. and Bachand, F. (2010). The Nuclear Poly(A)-Binding Protein Interacts with the Exosome to Promote Synthesis of Noncoding Small Nucleolar RNAs. Mol. Cell 37, 34–45.
272
Lemieux, C. and Bachand, F. (2009). Cotranscriptional recruitment of the nuclear poly(A)-binding protein Pab2 to nascent transcripts and association with translating mRNPs. Nucleic Acids Res. 37, 3418–3430.
Leu, S. and Ouyang, P. (2006). Spatial and temporal expression profile of pinin during mouse development. Gene Expr. Patterns 6, 620–631.
Leung, A. K. L., Trinkle-Mulcahy, L., Lam, Y. W., Andersen, J. S., Mann, M. and Lamond, A. I. (2006). NOPdb: Nucleolar Proteome Database. Nucleic Acids Res. 34, D218–D220.
Lewis, B. P., Green, R. E. and Brenner, S. E. (2003). Evidence for the widespread coupling of alternative splicing and nonsense-mediated mRNA decay in humans. Proc. Natl. Acad. Sci. U. S. A. 100, 189–192.
Li, H. and Bingham, P. M. (1991). Arginine/serine-rich domains of the su(wa) and tra RNA processing regulators target proteins to a subnuclear compartment implicated in splicing. Cell 67, 335–342.
Li, X. and Manley, J. L. (2005). Inactivation of the SR protein splicing factor ASF/SF2 results in genomic instability. Cell 122, 365–378.
Li, C., Lin, R.-I., Lai, M.-C., Ouyang, P. and Tarn, W.-Y. (2003). Nuclear Pnn/DRS protein binds to spliced mRNPs and participates in mRNA processing and export via interaction with RNPS1. Mol. Cell. Biol. 23, 7363–7376.
Li, X., Niu, T. and Manley, J. L. (2007). The RNA binding protein RNPS1 alleviates ASF/SF2 depletion-induced genomic instability. RNA 13, 2108–2115.
Lin, S. and Fu, X.-D. (2007). SR proteins and related factors in alternative splicing. Adv. Exp. Med. Biol. 623, 107–122.
273
Lin, S., Coutinho-Mansfield, G., Wang, D., Pandit, S. and Fu, X.-D. (2008). The splicing factor SC35 has an active role in transcriptional elongation. Nat. Struct. Mol. Biol. 15, 819–826.
Liu, H. X., Zhang, M. and Krainer, A. R. (1998). Identification of functional exonic splicing enhancer motifs recognized by individual SR proteins. Genes Dev. 12, 1998–2012.
Liu, H. X., Chew, S. L., Cartegni, L., Zhang, M. Q. and Krainer, A. R. (2000). Exonic splicing enhancer motif recognized by human SC35 under splicing conditions. Mol. Cell. Biol. 20, 1063–1071.
Long, J. C. and Caceres, J. F. (2009). The SR protein family of splicing factors: master regulators of gene expression. Biochem. J. 417, 15–27.
Longerich, S., Basu, U., Alt, F. and Storb, U. (2006). AID in somatic hypermutation and class switch recombination. Curr. Opin. Immunol. 18, 164–174.
Lühn, K. and Wild, M. K. (2012). Human deficiencies of fucosylation and sialylation affecting selectin ligands. Semin. Immunopathol. 34, 383–399.
Lutz, C. S. (2008). Alternative polyadenylation: a twist on mRNA 3’ end formation. ACS Chem. Biol. 3, 609–617.
Ma, H., Lou, Y., Lin, W. H. and Xue, H. W. (2006). MORN motifs in plant PIPKs are involved in the regulation of subcellular localization and phospholipid binding. Cell Res. 16, 466–478.
Ma, X. M., Yoon, S.-O., Richardson, C. J., Jülich, K. and Blenis, J. (2008). SKAR links pre-mRNA splicing to mTOR/S6K1-mediated enhanced translation efficiency of spliced mRNAs. Cell 133, 303–313.
Machyna, M., Heyn, P. and Neugebauer, K. M. (2013). Cajal bodies: where form meets function. Wiley Interdiscip. Rev. RNA 4, 17–34.
274
Maita, H., Kitaura, H., Ariga, H. and Iguchi-Ariga, S. M. M. (2005). Association of PAP-1 and Prp3p, the products of causative genes of dominant retinitis pigmentosa, in the tri-snRNP complex. Exp. Cell Res. 302, 61–68.
Makarova, O. V, Makarov, E. M. and Lührmann, R. (2001). The 65 and 110 kDa SR-related proteins of the U4/U6.U5 tri-snRNP are essential for the assembly of mature spliceosomes. EMBO J. 20, 2553–2563.
Mandel, C. R., Bai, Y. and Tong, L. (2008). Protein factors in pre-mRNA 3’-end processing. Cell. Mol. Life Sci. 65, 1099–1122.
Mangus, D. A., Evans, M. C. and Jacobson, A. (2003). Poly(A)-binding proteins: multifunctional scaffolds for the post-transcriptional control of gene expression. Genome Biol. 4, 223.
Manley, J. L. and Tacke, R. (1996). SR proteins and splicing control. Genes Dev. 10, 1569-1579.
Manley, J. L. and Krainer, A. R. (2010). A rational nomenclature for serine/arginine- rich protein splicing factors (SR proteins). Genes Dev. 24, 1073-1074.
Mao, Y. S., Zhang, B. and Spector, D. L. (2011). Biogenesis and function of nuclear bodies. Trends Genet. 27, 295–306.
Marchler-Bauer, A. and Bryant, S. H. (2004). CD-Search: protein domain annotations on the fly. Nucleic Acids Res. 32, W327–W331.
Maris, C., Dominguez, C. and Allain, F. H.-T. (2005). The RNA recognition motif, a plastic RNA-binding platform to regulate post-transcriptional gene expression. FEBS J. 272, 2118–2131.
Martin, G. R. (1981). Isolation of a pluripotent cell line from early mouse embryos cultured in medium conditioned by teratocarcinoma stem cells. Proc. Natl. Acad. Sci. U. S. A. 78, 7634–7638.
275
Martin, K. C. and Ephrussi, A. (2009). mRNA localization: gene expression in the spatial dimension. Cell 136, 719–730.
Masuda, S., Das, R., Cheng, H., Hurt, E., Dorman, N. and Reed, R. (2005). Recruitment of the human TREX complex to mRNA during splicing. Genes Dev. 19, 1512–1517.
Matsumoto, H., Shichijo, S., Kawano, K., Nishida, T., Sakamoto, M. and Itoh, K. (1998). Expression of the SART-1 antigens in uterine cancers. Jpn. J. Cancer Res. 89, 1292–1295.
Mayr, C. and Bartel, D. P. (2009). Widespread Shortening of 3′UTRs by Alternative Cleavage and Polyadenylation Activates Oncogenes in Cancer Cells. Cell 138, 673–684.
McCracken, S., Lambermon, M. and Blencowe, B. J. (2002). SRm160 splicing coactivator promotes transcript 3’-end cleavage. Mol. Cell. Biol. 22, 148–160.
McCracken, S., Longman, D., Johnstone, I. L., Cáceres, J. F. and Blencowe, B. J. (2003). An evolutionarily conserved role for SRm160 in 3’-end processing that functions independently of exon junction complex formation. J. Biol. Chem. 278, 44153–44160.
McGlincy, N. J. and Smith, C. W. J. (2008). Alternative splicing resulting in nonsense-mediated mRNA decay: what is the meaning of nonsense? Trends Biochem. Sci. 33, 385–393.
Meijer, H. A. and Thomas, A. A. M. (2002). Control of eukaryotic protein synthesis by upstream open reading frames in the 5’-untranslated region of an mRNA. Biochem. J. 367, 1–11.
Meister, G., Hannus, S., Plöttner, O., Baars, T., Hartmann, E., Fakan, S., Laggerbauer, B. and Fischer, U. (2001). SMNrp is an essential pre-mRNA
276
splicing factor required for the formation of the mature spliceosome. EMBO J. 20, 2304–2314.
Melo, E. O., Dhalia, R., Martins de Sa, C., Standart, N. and de Melo Neto, O. P. (2003). Identification of a C-terminal poly(A)-binding protein (PABP)-PABP interaction domain: role in cooperative binding to poly (A) and efficient cap distal translational repression. J. Biol. Chem. 278, 46357–46368.
Mermoud, J. E., Cohen, P. T. and Lamond, A. I. (1994). Regulation of mammalian spliceosome assembly by a protein phosphorylation mechanism. EMBO J. 13, 5679–5688.
Merz, C., Urlaub, H., Will, C. L. and Lührmann, R. (2007). Protein composition of human mRNPs spliced in vitro and differential requirements for mRNP protein recruitment. RNA 13, 116–128.
Meyuhas, O. and Dreazen, A. (2009). Ribosomal protein S6 kinase from TOP mRNAs to cell size. Prog. Mol. Biol. Transl. Sci. 90, 109–153.
Michlewski, G., Sanford, J. R. and Cáceres, J. F. (2008). The splicing factor SF2/ASF regulates translation initiation by enhancing phosphorylation of 4E-BP1. Mol. Cell 30, 179–189.
Mignone, F., Gissi, C., Liuni, S. and Pesole, G. (2002). Untranslated regions of mRNAs. Genome Biol. 3, REVIEWS0004.
Millevoi, S. and Vagner, S. (2010). Molecular mechanisms of eukaryotic pre-mRNA 3’ end processing regulation. Nucleic Acids Res. 38, 2757–2774.
Millevoi, S., Loulergue, C., Dettwiler, S., Karaa, S. Z., Keller, W., Antoniou, M. and Vagner, S. (2006). An interaction between U2AF 65 and CF I(m) links the splicing and 3’ end processing machineries. EMBO J. 25, 4854–4864.
277
Mintz, P. J., Patterson, S. D., Neuwald, A. F., Spahr, C. S. and Spector, D. L. (1999). Purification and biochemical characterization of interchromatin granule clusters. EMBO J. 18, 4308–4320.
Misteli, T., Cáceres, J. F., Clement, J. Q., Krainer, A. R., Wilkinson, M. F. and Spector, D. L. (1998). Serine phosphorylation of SR proteins is required for their recruitment to sites of transcription in vivo. J. Cell Biol. 143, 297–307.
Mitsui, K., Tokuzawa, Y., Itoh, H., Segawa, K., Murakami, M., Takahashi, K., Maruyama, M., Maeda, M. and Yamanaka, S. (2003). The homeoprotein Nanog is required for maintenance of pluripotency in mouse epiblast and ES cells. Cell 113, 631–642.
Moore, M. J. and Proudfoot, N. J. (2009). Pre-mRNA processing reaches back to transcription and ahead to translation. Cell 136, 688–700.
Mudge, J. M., Frankish, A., Fernandez-Banet, J., Alioto, T., Derrien, T., Howald, C., Reymond, A., Guigó, R., Hubbard, T. and Harrow, J. (2011). The origins, evolution, and functional potential of alternative splicing in vertebrates. Mol. Biol. Evol. 28, 2949–59.
Myers, S. a, Daou, S., Affar, E. B. and Burlingame, A. (2013). Electron transfer dissociation (ETD): the mass spectrometric breakthrough essential for O-GlcNAc protein site assignments-a study of the O-GlcNAcylated protein host cell factor C1. Proteomics 13, 982–91.
Nakagawa, Y., Yamane, Y., Okanoue, T. and Tsukita, S. (2001). Outer dense fiber 2 is a widespread centrosome scaffold component preferentially associated with mother centrioles: its identification from isolated centrosomes. Mol. Biol. Cell 12, 1687–1697.
Nesic, D. and Maquat, L. E. (1994). Upstream introns influence the efficiency of final intron removal and RNA 3’-end formation. Genes Dev. 8, 363–375.
278
Ni, J. Z., Grate, L., Donohue, J. P., Preston, C., Nobida, N., O’Brien, G., Shiue, L., Clark, T. A., Blume, J. E. and Ares, M. (2007). Ultraconserved elements are associated with homeostatic control of splicing regulators by alternative splicing and nonsense-mediated decay. Genes Dev. 21, 708–718.
Nichols, J., Zevnik, B., Anastassiadis, K., Niwa, H., Klewe-Nebenius, D., Chambers, I., Schöler, H. and Smith, A. (1998). Formation of pluripotent stem cells in the mammalian embryo depends on the POU transcription factor Oct4. Cell 95, 379–391.
Nilsen, T. W. and Graveley, B. R. (2010). Expansion of the eukaryotic proteome by alternative splicing. Nature 463, 457–463.
Nissim-Rafinia, M. and Kerem, B. (2005). The splicing machinery is a genetic modifier of disease severity. Trends Genet. 21, 480–483.
Niwa, M. and Berget, S. M. (1991). Mutation of the AAUAAA polyadenylation signal depresses in vitro splicing of proximal but not distal introns. Genes Dev. 5, 2086–2095.
Nott, A., Le Hir, H. and Moore, M. J. (2004). Splicing enhances translation in mammalian cells: an additional function of the exon junction complex. Genes Dev. 18, 210–222.
Nunes, N. M., Li, W., Tian, B. and Furger, A. (2010). A functional human Poly(A) site requires only a potent DSE and an A-rich upstream sequence. EMBO J. 29, 1523–1536.
Olson, M. O. J. and Dundr, M. (2005). The moving parts of the nucleolus. Histochem. Cell Biol. 123, 203–216.
Osborne, L. R., Martindale, D., Scherer, S. W., Shi, X. M., Huizenga, J., Heng, H. H., Costa, T., Pober, B., Lew, L., Brinkman, J., et al. (1996a). Identification of
279
genes from a 500-kb region at 7q11.23 that is commonly deleted in Williams syndrome patients. Genomics 36, 328–336.
Osborne, M. A., Zenner, G., Lubinus, M., Zhang, X., Songyang, Z., Cantley, L. C., Majerus, P., Burn, P. and Kochan, J. P. (1996b). The inositol 5’-phosphatase SHIP binds to immunoreceptor signaling motifs and responds to high affinity IgE receptor aggregation. J. Biol. Chem. 271, 29271–29278.
Ostrowski, A. and van Aalten, D. M. F. (2013). Chemical tools to probe cellular O- GlcNAc signalling. Biochem. J. 456, 1–12.
Ouyang, P. and Sugrue, S. P. (1996). Characterization of pinin, a novel protein associated with the desmosome-intermediate filament complex. J. Cell Biol. 135, 1027–1042.
Ozsolak, F. and Milos, P. M. (2010). RNA sequencing: advances, challenges and opportunities. Nat. Rev. Genet. 12, 87–98.
Pelton, T. A., Sharma, S., Schulz, T. C., Rathjen, J. and Rathjen, P. D. (2002). Transient pluripotent cell populations during primitive ectoderm formation: correlation of in vivo and in vitro pluripotent cell development. J. Cell Sci. 115, 329–339.
Perreault, A., Lemieux, C. and Bachand, F. (2007). Regulation of the nuclear poly(A)-binding protein by arginine methylation in fission yeast. J. Biol. Chem. 282, 7552–7562.
Petersen, C., Füzesi, L. and Hoyer-Fender, S. (1999). Outer dense fibre proteins from human sperm tail: molecular cloning and expression analyses of two cDNA transcripts encoding proteins of approximately 70 kDa. Mol. Hum. Reprod. 5, 627–635.
Phair, R. D. and Misteli, T. (2000). High mobility of proteins in the mammalian cell nucleus. Nature 404, 604–609.
280
Philipps, D., Celotto, A. M., Wang, Q.-Q., Tarng, R. S. and Graveley, B. R. (2003). Arginine/serine repeats are sufficient to constitute a splicing activation domain. Nucleic Acids Res. 31, 6502–6508.
Pozzoli, U. and Sironi, M. (2005). Silencers regulate both constitutive and alternative splicing events in mammals. Cell. Mol. Life Sci. 62, 1579–1604.
Prasanth, K. V, Rajendra, T. K., Lal, A. K. and Lakhotia, S. C. (2000). Omega speckles - a novel class of nuclear speckles containing hnRNPs associated with noncoding hsr-omega RNA in Drosophila. J. Cell Sci. 113 Pt 19, 3485–3497.
Puvion, E. and Puvion-Dutilleul, F. (1996). Ultrastructure of the nucleus in relation to transcription and splicing: roles of perichromatin fibrils and interchromatin granules. Exp. Cell Res. 229, 217–225.
Ramakrishnan, V. (2002). Ribosome structure and the mechanism of translation. Cell 108, 557–572.
Rappsilber, J., Ajuh, P., Lamond, A. I. and Mann, M. (2001). SPF30 is an essential human splicing factor required for assembly of the U4/U5/U6 tri-small nuclear ribonucleoprotein into the spliceosome. J. Biol. Chem. 276, 31142–31150.
Raska, I., Andrade, L. E., Ochs, R. L., Chan, E. K., Chang, C. M., Roos, G. and Tan, E. M. (1991). Immunological and ultrastructural studies of the nuclear coiled body with autoimmune antibodies. Exp. Cell Res. 195, 27–37.
Rathjen, P. D., Toth, S., Willis, A., Heath, J. K. and Smith, A. G. (1990). Differentiation inhibiting activity is produced in matrix-associated and diffusible forms that are generated by alternate promoter usage. Cell 62, 1105–1114.
Rathjen, J., Lake, J. A., Bettess, M. D., Washington, J. M., Chapman, G. and Rathjen, P. D. (1999). Formation of a primitive ectoderm like cell population, EPL cells, from ES cells in response to biologically derived factors. J. Cell Sci. 112 ( Pt 5, 601–612.
281
Rathjen, J., Haines, B. P., Hudson, K. M., Nesci, A., Dunn, S. and Rathjen, P. D. (2002). Directed differentiation of pluripotent cells to neural lineages: homogeneous formation and differentiation of a neurectoderm population. Development 129, 2649–2661.
Rebbapragada, I. and Lykke-Andersen, J. (2009). Execution of nonsense-mediated mRNA decay: what defines a substrate? Curr. Opin. Cell Biol. 21, 394–402.
Reed, R. and Cheng, H. (2005). TREX, SR proteins and export of mRNA. Curr. Opin. Cell Biol. 17, 269–273.
Richter, N. J., Rogers Jr., G. W., Hensold, J. O. and Merrick, W. C. (1999). Further biochemical and kinetic characterization of human eukaryotic initiation factor 4H. J Biol Chem 274, 35415–35424.
Risso, G., Pelisch, F., Quaglino, A., Pozzi, B. and Srebrow, A. (2012). Regulating the regulators: serine/arginine-rich proteins under scrutiny. IUBMB Life 64, 809– 16.
Rogers, M. B., Hosler, B. A. and Gudas, L. J. (1991). Specific expression of a retinoic acid-regulated, zinc-finger gene, Rex-1, in preimplantation embryos, trophoblast and spermatocytes. Development 113, 815–824.
Rogers, G. W., Richter, N. J., Lima, W. F. and Merrick, W. C. (2001). Modulation of the helicase activity of eIF4A by eIF4B, eIF4H, and eIF4F. J. Biol. Chem. 276, 30914–30922.
Roignant, J.-Y. and Treisman, J. E. (2010). Exon junction complex subunits are required to splice Drosophila MAP kinase, a large heterochromatic gene. Cell 143, 238–250.
Roscigno, R. F. and Garcia-Blanco, M. A. (1995). SR proteins escort the U4/U6.U5 tri-snRNP to the spliceosome. RNA 1, 692–706.
282
Rossi, F., Labourier, E., Forné, T., Divita, G., Derancourt, J., Riou, J. F., Antoine, E., Cathala, G., Brunel, C. and Tazi, J. (1996). Specific phosphorylation of SR proteins by mammalian DNA topoisomerase I. Nature 381, 80–82.
Saitoh, N., Spahr, C. S., Patterson, S. D., Bubulya, P., Neuwald, A. F. and Spector, D. L. (2004). Proteomic analysis of interchromatin granule clusters. Mol. Biol. Cell 15, 3876–3890.
Sakashita, E., Tatsumi, S., Werner, D., Endo, H. and Mayeda, A. (2004). Human RNPS1 and its associated factors: a versatile alternative pre-mRNA splicing regulator in vivo. Mol. Cell. Biol. 24, 1174–1187.
Sakashita, E. and Endo, H. (2010). SR and SR-related proteins redistribute to segregated fibrillar components of nucleoli in a response to DNA damage. Nucleus 4, 367-389.
Salmon, N. A., Reijo Pera, R. A. and Xu, E. Y. (2006). A gene trap knockout of the abundant sperm tail protein, outer dense fiber 2, results in preimplantation lethality. Genesis 44, 515–522.
Saltzman, A. L., Kim, Y. K., Pan, Q., Fagnani, M. M., Maquat, L. E. and Blencowe, B. J. (2008). Regulation of multiple core spliceosomal proteins by alternative splicing-coupled nonsense-mediated mRNA decay. Mol. Cell. Biol. 28, 4320–4330.
Saltzman, A. L., Pan, Q. and Blencowe, B. J. (2011). Regulation of alternative splicing by the core spliceosomal machinery. Genes Dev. 25, 373–384.
Sampson, N. D. and Hewitt, J. E. (2003). SF4 and SFRS14, two related putative splicing factors on human chromosome 19p13.11. Gene 305, 91–100.
Sanford, J. R. and Bruzik, J. P. (1999). Developmental regulation of SR protein phosphorylation and activity. Genes Dev. 13, 1513–1518.
283
Sanford, J. R. and Bruzik, J. P. (2001). Regulation of SR protein localization during development. Proc. Natl. Acad. Sci. U. S. A. 98, 10184–10189.
Sanford, J. R., Gray, N. K., Beckmann, K. and Cáceres, J. F. (2004). A novel role for shuttling SR proteins in mRNA translation. Genes Dev. 18, 755–768.
Sanford, J. R., Ellis, J. D., Cazalla, D. and Cáceres, J. F. (2005). Reversible phosphorylation differentially affects nuclear and cytoplasmic functions of splicing factor 2/alternative splicing factor. Proc. Natl. Acad. Sci. U. S. A. 102, 15042–15047.
Sartini, B. L., Wang, H., Wang, W., Millette, C. F. and Kilpatrick, D. L. (2008). Pre-messenger RNA cleavage factor I (CFIm): potential role in alternative polyadenylation during spermatogenesis. Biol. Reprod. 78, 472–482.
Sato, H., Hosoda, N. and Maquat, L. E. (2008). Efficiency of the pioneer round of translation affects the cellular site of nonsense-mediated mRNA decay. Mol. Cell 29, 255–262.
Savino, T. M., Gébrane-Younès, J., De Mey, J., Sibarita, J. B. and Hernandez- Verdun, D. (2001). Nucleolar assembly of the rRNA processing machinery in living cells. J. Cell Biol. 153, 1097–1110.
Schmidt-Kastner, R., Yamamoto, H., Hamasaki, D., Yamamoto, H., Parel, J.-M., Schmitz, C., Dorey, C. K., Blanks, J. C. and Preising, M. N. (2008). Hypoxia- regulated components of the U4/U6.U5 tri-small nuclear riboprotein complex: possible role in autosomal dominant retinitis pigmentosa. Mol. Vis. 14, 125–135.
Schultz, M. J., Swindall, A. F. and Bellis, S. L. (2012). Regulation of the metastatic cell phenotype by sialylated glycans. Cancer Metastasis Rev. 31, 501–518.
Schulz, T. C. (1996). A system for the isolation of markers for subpopulations of murine pluripotent cells. PhD Thesis: The University of Adelaide.
284
Shav-Tal, Y., Blechman, J., Darzacq, X., Montagna, C., Dye, B. T., Patton, J. G., Singer, R. H. and Zipori, D. (2005). Dynamic sorting of nuclear components into distinct nucleolar caps during transcriptional inhibition. Mol. Biol. Cell 16, 2395–2413.
Shaw, P. and Brown, J. (2012). Nucleoli: Composition, Function, and Dynamics. PLANT Physiol. 158, 44–51.
Shen, H. and Green, M. R. (2004). A pathway of sequential arginine-serine-rich domain-splicing signal interactions during mammalian spliceosome assembly. Mol. Cell 16, 363–373.
Shepard, P. J. and Hertel, K. J. (2009). The SR protein family. Genome Biol. 10, 242.
Shepard, P. J., Choi, E.-A., Lu, J., Flanagan, L. A., Hertel, K. J. and Shi, Y. (2011). Complex and dynamic landscape of RNA polyadenylation revealed by PAS-Seq. RNA 17, 761–772.
Shi, Y., Di Giammartino, D. C., Taylor, D., Sarkeshik, A., Rice, W. J., Yates, J. R., Frank, J. and Manley, J. L. (2009). Molecular Architecture of the Human Pre- mRNA 3′ Processing Complex. Mol. Cell 33, 365–376.
Shichijo, S., Nakao, M., Imai, Y., Takasu, H., Kawamoto, M., Niiya, F., Yang, D., Toh, Y., Yamana, H. and Itoh, K. (1998). A gene encoding antigenic peptides of human squamous cell carcinoma recognized by cytotoxic T lymphocytes. J. Exp. Med. 187, 277–288.
Shopland, L. S., Johnson, C. V, Byron, M., McNeil, J. and Lawrence, J. B. (2003). Clustering of multiple specific genes and gene-rich R-bands around SC-35 domains: evidence for local euchromatic neighborhoods. J. Cell Biol. 162, 981– 990.
285
Slawson, C. and Hart, G. W. (2003). Dynamic interplay between O-GlcNAc and O- phosphate: The sweet side of protein regulation. Curr. Opin. Struct. Biol. 13, 631– 636.
Slawson, C., Housley, M. P. and Hart, G. W. (2006). O-GlcNAc cycling: how a single sugar post-translational modification is changing the way we think about signaling networks. J. Cell. Biochem. 97, 71–83.
Smibert, P., Miura, P., Westholm, J. O., Shenker, S., May, G., Duff, M. O., Zhang, D., Eads, B. D., Carlson, J., Brown, J. B., et al. (2012). Global Patterns of Tissue-Specific Alternative Polyadenylation in Drosophila. Cell Rep. 1, 277–289.
Smith, A. G. (1991). Culture and Differentiation of Embryoinic Stem Cells. J. tissue Cult. methods 13, 89–94.
Soulard, M., Della Valle, V., Siomi, M. C., Piñol-Roma, S., Codogno, P., Bauvy, C., Bellini, M., Lacroix, J. C., Monod, G. and Dreyfuss, G. (1993). hnRNP G: sequence and characterization of a glycosylated RNA-binding protein. Nucleic Acids Res. 21, 4210–4217.
Sparbier, K., Koch, S., Kessler, I., Wenzel, T. and Kostrzewa, M. (2005). Selective isolation of glycoproteins and glycopeptides for MALDI-TOF MS detection supported by magnetic particles. J. Biomol. Tech. 16, 407–413.
Spector, D. L. and Lamond, A. I. (2011). Nuclear speckles. Cold Spring Harb. Perspect. Biol. 3,.
Stanek, D. and Neugebauer, K. M. (2006). The Cajal body: a meeting place for spliceosomal snRNPs in the nuclear maze. Chromosoma 115, 343–354.
Strausberg, R. L., Feingold, E. A., Klausner, R. D. and Collins, F. S. (1999). The mammalian gene collection. Science 286, 455–457.
286
Sureau, A., Gattoni, R., Dooghe, Y., Stévenin, J. and Soret, J. (2001). SC35 autoregulates its expression by promoting splicing events that destabilize its mRNAs. EMBO J. 20, 1785–1796.
Swartz, J. E., Bor, Y.-C., Misawa, Y., Rekosh, D. and Hammarskjold, M.-L. (2007). The shuttling SR protein 9G8 plays a role in translation of unspliced mRNA containing a constitutive transport element. J. Biol. Chem. 282, 19844– 19853.
Szymczyna, B. R., Bowman, J., McCracken, S., Pineda-Lucena, A., Lu, Y., Cox, B., Lambermon, M., Graveley, B. R., Arrowsmith, C. H. and Blencowe, B. J. (2003). Structure and function of the PWI motif: a novel nucleic acid-binding domain that facilitates pre-mRNA processing. Genes Dev. 17, 461–475.
Takagaki, Y. and Manley, J. L. (1998). Levels of polyadenylation factor CstF-64 control IgM heavy chain mRNA accumulation and other events associated with B cell differentiation. Mol. Cell 2, 761–771.
Takagaki, Y., Seipelt, R. L., Peterson, M. L. and Manley, J. L. (1996). The polyadenylation factor CstF-64 regulates alternative processing of IgM heavy chain pre-mRNA during B cell differentiation. Cell 87, 941–952.
Takizawa, T., Gudla, P. R., Guo, L., Lockett, S. and Misteli, T. (2008). Allele- specific nuclear positioning of the monoallelically expressed astrocyte marker GFAP. Genes Dev. 22, 489–498.
Tange, T. Ø., Nott, A. and Moore, M. J. (2004). The ever-increasing complexities of the exon junction complex. Curr. Opin. Cell Biol. 16, 279–284.
Tange, T. Ø., Shibuya, T., Jurica, M. S. and Moore, M. J. (2005). Biochemical analysis of the EJC reveals two new factors and a stable tetrameric protein core. RNA 11, 1869–1883.
287
Tavner, F. J., Simpson, R., Tashiro, S., Favier, D., Jenkins, N. A., Gilbert, D. J., Copeland, N. G., Macmillan, E. M., Lutwyche, J., Keough, R. A., et al. (1998). Molecular cloning reveals that the p160 Myb-binding protein is a novel, predominantly nucleolar protein which may play a role in transactivation by Myb. Mol. Cell. Biol. 18, 989–1002.
Teo, C. F., Ingale, S., Wolfert, M. A., Elsayed, G. A., Nöt, L. G., Chatham, J. C., Wells, L. and Boons, G.-J. (2010). Glycopeptide-specific monoclonal antibodies suggest new roles for O-GlcNAc. Nat. Chem. Biol. 6, 338–343.
Thiry, M. (1993). Differential location of nucleic acids within interchromatin granule clusters. Eur. J. Cell Biol. 62, 259–269.
Thiry, M. (1995). The interchromatin granules. Histol. Histopathol. 10, 1035–1045.
Tian, B., Hu, J., Zhang, H. and Lutz, C. S. (2005). A large-scale analysis of mRNA polyadenylation of human and mouse genes. Nucleic Acids Res. 33, 201–212.
Tkacz, I. D., Gupta, S. K., Volkov, V., Romano, M., Haham, T., Tulinski, P., Lebenthal, I. and Michaeli, S. (2010). Analysis of spliceosomal proteins in Trypanosomatids reveals novel functions in mRNA processing. J. Biol. Chem. 285, 27982–27999.
Tripathi, V., Song, D. Y., Zong, X., Shevtsov, S. P., Hearn, S., Fu, X.-D., Dundr, M. and Prasanth, K. V (2012). SRSF1 modulates the organization of splicing factors in nuclear speckles and regulates transcription. Mol. Biol. Cell.
Tsujimoto, S., Pelto-Huikko, M., Aitola, M., Meister, B., Vik-Mo, E. O., Davanger, S., Scheller, R. H. and Bean, A. J. (1999). The cellular and developmental expression of hrs-2 in rat. Eur. J. Neurosci. 11, 3047–3063.
Tycowski, K. T., You, Z. H., Graham, P. J. and Steitz, J. A. (1998). Modification of U6 spliceosomal RNA is guided by other small RNAs. Mol. Cell 2, 629–638.
288
Vagner, S., Vagner, C. and Mattaj, I. W. (2000). The carboxyl terminus of vertebrate poly(A) polymerase interacts with U2AF 65 to couple 3’-end processing and splicing. Genes Dev. 14, 403–413.
Valenta, R., Natter, S., Seiberler, S., Wichlas, S., Maurer, D., Hess, M., Pavelka, M., Grote, M., Ferreira, F., Szepfalusi, Z., et al. (1998). Molecular characterization of an autoallergen, Hom s 1, identified by serum IgE from atopic dermatitis patients. J. Invest. Dermatol. 111, 1178–1183.
Valente, S. T., Gilmartin, G. M., Venkatarama, K., Arriagada, G. and Goff, S. P. (2009). HIV-1 mRNA 3’ end processing is distinctively regulated by eIF3f, CDK11, and splice factor 9G8. Mol. Cell 36, 279–289.
Van Kouwenhove, M., Kedde, M. and Agami, R. (2011). MicroRNA regulation by RNA-binding proteins and its implications for cancer. Nat. Rev. Cancer 11, 644– 656.
Vocadlo, D. J. (2012). O-GlcNAc processing enzymes: Catalytic mechanisms, substrate specificity, and enzyme regulation. Curr. Opin. Chem. Biol. 16, 488– 497.
Voronina, E., Seydoux, G., Sassone-Corsi, P. and Nagamori, I. (2011). RNA Granules in Germ Cells. Cold Spring Harb. Perspect. Biol. 3, a002774–a002774.
Wahl, M. C., Will, C. L. and Lührmann, R. (2009). The spliceosome: design principles of a dynamic RNP machine. Cell 136, 701–718.
Wang, G.-S. and Cooper, T. A. (2007). Splicing in disease: disruption of the splicing code and the decoding machinery. Nat. Rev. Genet. 8, 749–761.
Wang, Z. and Hart, G. W. (2008). Glycomic Approaches to Study GlcNAcylation: Protein Identification, Site-mapping, and Site-specific O-GlcNAc Quantitation. Clin. Proteomics 4, 5–13.
289
Wang, A., Forman-Kay, J., Luo, Y., Luo, M., Chow, Y. H., Plumb, J., Friesen, J. D., Tsui, L. C., Heng, H. H., Woolford, J. L., et al. (1997). Identification and characterization of human genes encoding Hprp3p and Hprp4p, interacting components of the spliceosome. Hum. Mol. Genet. 6, 2117–2126.
Wang, H. Y., Lin, W., Dyck, J. A., Yeakley, J. M., Songyang, Z., Cantley, L. C. and Fu, X. D. (1998). SRPK2: a differentially expressed SR protein-specific kinase involved in mediating the interaction and localization of pre-mRNA splicing factors in mammalian cells. J. Cell Biol. 140, 737–750.
Wang, H., Sartini, B. L., Millette, C. F. and Kilpatrick, D. L. (2006). A developmental switch in transcription factor isoforms during spermatogenesis controlled by alternative messenger RNA 3’-end formation. Biol. Reprod. 75, 318–323.
Wang, Z., Gucek, M. and Hart, G. W. (2008). Cross-talk between GlcNAcylation and phosphorylation: site-specific phosphorylation dynamics in response to globally elevated O-GlcNAc. Proc. Natl. Acad. Sci. U. S. A. 105, 13793–13798.
Wells, L., Vosseller, K. and Hart, G. W. (2001). Glycosylation of nucleocytoplasmic proteins: signal transduction and O-GlcNAc. Science 291, 2376–2378.
Wells, L., Whalen, S. A. and Hart, G. W. (2003). O-GlcNAc: A regulatory post- translational modification. Biochem. Biophys. Res. Commun. 302, 435–441.
Wheatley, A. P., Bolland, D. J., Hewitt, J. E., Dewar, J. C. and Hall, I. P. (2002). Identification of the autoantigen SART-1 as a candidate gene for the development of atopy. Hum. Mol. Genet. 11, 2143–2146.
Whelan, S. A., Lane, M. D. and Hart, G. W. (2008). Regulation of the O-linked beta- N-acetylglucosamine transferase by insulin signaling. J. Biol. Chem. 283, 21411– 21417.
290
Wildt, S. and Gerngross, T. U. (2005). The humanization of N-glycosylation pathways in yeast. Nat. Rev. Microbiol. 3, 119–128.
Wu, H., Sun, S., Tu, K., Gao, Y., Xie, B., Krainer, A. R. and Zhu, J. (2010). A Splicing-Independent Function of SF2/ASF in MicroRNA Processing. Mol. Cell 38, 67–77.
Xiao, R., Sun, Y., Ding, J.-H., Lin, S., Rose, D. W., Rosenfeld, M. G., Fu, X.-D. and Li, X. (2007). Splicing regulator SC35 is essential for genomic stability and cell proliferation during mammalian organogenesis. Mol. Cell. Biol. 27, 5393– 5402.
Yamamoto-Hino, M., Kanie, Y., Awano, W., Aoki-Kinoshita, K. F., Yano, H., Nishihara, S., Okano, H., Ueda, R., Kanie, O. and Goto, S. (2010). Identification of genes required for neural-specific glycosylation using functional genomics. PLoS Genet. 6, 1–11.
Yates, J. R., Ruse, C. I. and Nakorchevsky, A. (2009). Proteomics by mass spectrometry: approaches, advances, and applications. Annu. Rev. Biomed. Eng. 11, 49–79.
Yun, C. Y., Velazquez-Dones, A. L., Lyman, S. K. and Fu, X.-D. (2003). Phosphorylation-dependent and -independent nuclear import of RS domain- containing splicing factors and regulators. J. Biol. Chem. 278, 18050–18055.
Yuryev, A., Patturajan, M., Litingtung, Y., Joshi, R. V, Gentile, C., Gebara, M. and Corden, J. L. (1996). The C-terminal domain of the largest subunit of RNA polymerase II interacts with a novel set of serine/arginine-rich proteins. Proc. Natl. Acad. Sci. U. S. A. 93, 6975–6980.
Zahler, A. M., Neugebauer, K. M., Stolk, J. A. and Roth, M. B. (1993). Human SR proteins and isolation of a cDNA encoding SRp75. Mol. Cell. Biol. 13, 4023– 4028.
291
Zeidan, Q. and Hart, G. W. (2010). The intersections between O-GlcNAcylation and phosphorylation: implications for multiple signaling pathways. J. Cell Sci. 123, 13–22.
Zekri, L., Huntzinger, E., Heimstädt, S. and Izaurralde, E. (2009). The silencing domain of GW182 interacts with PABPC1 to promote translational repression and degradation of microRNA targets and is required for target release. Mol. Cell. Biol. 29, 6220–6231.
Zhang, Z. and Krainer, A. R. (2004). Involvement of SR proteins in mRNA surveillance. Mol. Cell 16, 597–607.
Zhang, W. J. and Wu, J. Y. (1996). Functional properties of p54, a novel SR protein active in constitutive and alternative splicing. Mol. Cell. Biol. 16, 5400–5408.
Zhang, Z., Xin, D., Wang, P., Zhou, L., Hu, L., Kong, X. and Hurst, L. D. (2009). Noisy splicing, more than expression regulation, explains why some exons are subject to nonsense-mediated mRNA decay. BMC Biol. 7, 23.
Zhao, R., Bodnar, M. S. and Spector, D. L. (2009). Nuclear neighborhoods and gene expression. Curr. Opin. Genet. Dev. 19, 172–179.
Zhong, X.-Y., Wang, P., Han, J., Rosenfeld, M. G. and Fu, X.-D. (2009). SR proteins in vertical integration of gene expression from transcription to RNA processing to translation. Mol. Cell 35, 1–10.
Zimowska, G., Shi, J., Munguba, G., Jackson, M. R., Alpatov, R., Simmons, M. N., Shi, Y. and Sugrue, S. P. (2003). Pinin/DRS/memA interacts with SRp75, SRm300 and SRrp130 in corneal epithelial cells. Invest. Ophthalmol. Vis. Sci. 44, 4715–4723.
Zuo, P. and Maniatis, T. (1996). The splicing factor U2AF35 mediates critical protein-protein interactions in constitutive and enhancer-dependent splicing. Genes Dev. 10, 1356–1368.
292
293