Identification of the RNA Recognition Element of the RBPMS Family of RNA-Binding Proteins and Their Transcriptome-Wide Mrna Targets

Total Page:16

File Type:pdf, Size:1020Kb

Load more

Downloaded from rnajournal.cshlp.org on October 1, 2021 - Published by Cold Spring Harbor Laboratory Press Identification of the RNA recognition element of the RBPMS family of RNA-binding proteins and their transcriptome-wide mRNA targets THALIA A. FARAZI,1,5 CARL S. LEONHARDT,1,5 NEELANJAN MUKHERJEE,2 ALEKSANDRA MIHAILOVIC,1 SONG LI,3 KLAAS E.A. MAX,1 CINDY MEYER,1 MASASHI YAMAJI,1 PAVOL CEKAN,1 NICHOLAS C. JACOBS,2 STEFANIE GERSTBERGER,1 CLAUDIA BOGNANNI,1 ERIK LARSSON,4 UWE OHLER,2 and THOMAS TUSCHL1,6 1Laboratory of RNA Molecular Biology, Howard Hughes Medical Institute, The Rockefeller University, New York, New York 10065, USA 2Berlin Institute for Medical Systems Biology, Max Delbrück Center for Molecular Medicine, 13125 Berlin, Germany 3Biology Department, Duke University, Durham, North Carolina 27708, USA 4Institute of Biomedicine, The Sahlgrenska Academy, University of Gothenburg, Gothenburg, SE-405 30, Sweden ABSTRACT Recent studies implicated the RNA-binding protein with multiple splicing (RBPMS) family of proteins in oocyte, retinal ganglion cell, heart, and gastrointestinal smooth muscle development. These RNA-binding proteins contain a single RNA recognition motif (RRM), and their targets and molecular function have not yet been identified. We defined transcriptome-wide RNA targets using photoactivatable-ribonucleoside-enhanced crosslinking and immunoprecipitation (PAR-CLIP) in HEK293 cells, revealing exonic mature and intronic pre-mRNA binding sites, in agreement with the nuclear and cytoplasmic localization of the proteins. Computational and biochemical approaches defined the RNA recognition element (RRE) as a tandem CAC trinucleotide motif separated by a variable spacer region. Similar to other mRNA-binding proteins, RBPMS family of proteins relocalized to cytoplasmic stress granules under oxidative stress conditions suggestive of a support function for mRNA localization in large and/or multinucleated cells where it is preferentially expressed. Keywords: RNA-binding protein; PAR-CLIP; RNA recognition element; RBPMS INTRODUCTION tured, characterized by a high density of prolines, without ho- mology to other proteins. The RBPMS RRM domain is most RNA-binding protein with multiple splicing (RBPMS) be- similar to those of ELAVL/Hu proteins involved in mRNA longs to a family of RNA-binding proteins (RBPs) containing stability and splicing (Lebedeva et al. 2011; Mukherjee et al. a single RNA recognition motif (RRM), corresponding to a ′′ 2011), and the snRNA-binding proteins SNRPB2/U2B protein domain of ∼80 amino acids (aa). In RBPMS this and SNRPA/U1A (Oubridge et al. 1994). domain is flanked by 23 aa N-terminal and 95 aa C-terminal The RRM domain is the most common RNA-binding regions. The RBPMS gene spans over 230 kb in the human domain, present in at least 224 RBPs (Ascano et al. 2012a). genome and is expressed as multiple mRNA isoforms (four RRM domains are structurally diverse and bind to a multitude RefSeq and at least 19 transcript variants according to of sequence and structural motifs, such as the base and AceView) resulting in multiple protein isoforms (Shimamoto loop residues in stem–loop structures (Maris et al. 2005). et al. 1996). All Refseq protein isoforms are identical in the RRMs are present in proteins that regulate a variety of RNA majority of their coding sequence (1–170 aa). RBPMS2 is processes, including pre-mRNA splicing, RNA transport, predominantly expressed as a single isoform (one Refseq localization, translation, and stability. The RBPMS family transcript and at least seven spliced variants according to is conserved in vertebrates (e.g., 72% identity of H. sapiens AceView). RBPMS paralogs share 67% amino acid identity RBPMS isoform A vs. D. rerio RBPMS2) (Fig. 1A), and other (RBPMS2 vs. RBPMS isoform A), varying mostly in their vertebrates also contain at least two RBPMS family members. N- and C-termini. The C terminus of RBPMS is unstruc- © 2014 Farazi et al. This article is distributed exclusively by the RNA Soci- 5These authors contributed equally to this work. ety for the first 12 months after the full-issue publication date (see http:// 6Corresponding author rnajournal.cshlp.org/site/misc/terms.xhtml). After 12 months, it is available E-mail [email protected] under a Creative Commons License (Attribution-NonCommercial 4.0 Article published online ahead of print. Article and publication date are at International), as described at http://creativecommons.org/licenses/by- http://www.rnajournal.org/cgi/doi/10.1261/rna.045005.114. nc/4.0/. 1090 RNA 20:1090–1102; Published by Cold Spring Harbor Laboratory Press for the RNA Society Downloaded from rnajournal.cshlp.org on October 1, 2021 - Published by Cold Spring Harbor Laboratory Press RBPMS RNA recognition and targets RNP 2 RNP 1 A RBPMS H. sapiens ---------------------MNNGGKAEKEN--------TPSEANLQEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFDPEIP QTLRLEFAKANTKMAKNKLVG 112 RBPMS M. musculus ---------------------MNGGGKAEKEN--------TPSEANLQEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFDPEIP QTLRLEFAKANTKMAKNKLVG 112 RBPMS 2a D. rerio ---------------------MS--VKSDSEP----------NNNVSLEEEVRTLFVSGLPTDIKPRELYLLFRPFKGYEGSLIKLTSKQPVGFVTFDSRSGAEAAKNALNGVRFDPENP QTLRLEFAKANTKMAKSKLMG 108 RBPMS 2b D. rerio PEPKNOWNPROTEINCODINGMS--LKSDSET----------NTSVSLEEEVRTLFVSGLPVDIKPRELYLLFRPFKGYEGSLIKLTSKQPVGFVTFDSRSGAEAAKNALNGIRFDPESP QTLRLEFAKANTKMAKSKLMA 129 RBPMS 2 H. sapiens ---------------------MSN-LKPDGEHGGSTGTGSGAGSGGALEEEVRTLFVSGLPVDIKPRELYLLFRPFKGYEGSLIKLTARQPVGFVIFDSRAGAEAAKNALNGIRFDPENP QTLRLEFAKANTKMAKSKLMA 119 RBPMS 2 M. musculus ---------------------MSN-LKPDVEH------CTGAGTGSPLEEEVRTLFVSGLPVDIKPRELYLLFRPFKGYEGSLIKLTSRQPVGFVIFDSRAGAEAAKNALNGIRFDPENP QTLRLEFAKANTKMAKSKLIA 113 RBPMS D. rerio ---------------------MNN--TSEEEP---------KTPEEEEEEQVRTLFVSGLPMDIKPRELYLLFRPFQGYEGSLIKFTSKQPVGFVSFSSRSEAEAAKNRLNGVRFDPDVP QTLRLEFAKANTKMSR----R 99 *. ..: * **:********** **************:********:*::****** *.**: ****** ***:****: * **************:: RNA recognition motif RBPMS H. sapiens TPNPSTPLPNTVPQFIAREPYELTVPALYPSSPEVWAPY PLYPAELAPALPPP-AFTYP-------AS--LHAQMRWLPP-SEATSQGWKSRQFC 196 RBPMS M. musculus TPNPSTPLPNTVPQFIAREPYELTVPALYPSSPEVWAPY PLYPAELAPALPPPAAFTYP-------AS--LHAQMRWIPP-SEATSQGWKSRQFC 197 RBPMS 2a D. rerio TPNPTNIHPALGAHFIARDPYDLTGAALIPASPEAWSPY PLYTPELSPGLPHT-AFTYPAAAAAAAAA--LHAQMRWYPSTSDSSQPGWKSRQFC 200 RBPMS 2b D. rerio TPNPSNLHPALGAHFIARDPYDLTGAALIPASPEAWAPY PLYTTELTPGLPHA-AFTYP-AAAAAAAA--LHAQMRWYPSPSESSQPGWKSRQFC 220 RBPMS 2 H. sapiens TPNPSNVHPALGAHFIARDPYDLMGAALIPASPEAWAPY PLYTTELTPAISHA-AFTYPTATAAAAA---LHAQVRWYPS-SDTTQQGWKYRQFC 209 RBPMS 2 M. musculus TPNPTSVHPALGAHLIARDPYDLMGTALIPASPEAWAPY PLYTTELTPAISHT-TFTYPAATAAAAAAATLHAQVRWYPS-SDTTQQGWKYRQFC 206 RBPMS D. rerio NSNP-AARLSAGAACVSREPYELSVPALYPSSPDVWPAF PLYPADLTP------AYAYS-------SA--LHTQIRWLPT-ADTNHQSWKSRQFC 183 ..** . ::*:**:* .** *:**:.*..: ***..:*:* :::*. : **:*:** *. :::. .** **** B FH-RBPMS Hoechst Alexa 488 anti-HA Phalloidin 546 Nuc Cyt Tot (DNA) (HA) (Actin) LMNB1 TUBB RBPMS ELAVL1 HA RBPMS2 FH-RBPMS2 Nuc Cyt Tot LMNB1 TUBB HEK293 ELAVL1 HA 100% Library A CD16,198 E 90% 630 80% 857 9,901 70% all other 1065 repeat 60% 6,207 coding RBPMS binding 50 kDa 50% no annotation sites 1291 intron 40% 3' UTR 37 kDa 6,365 30% 20% 25 kDa 2170 Library B % Sequence reads included in clusters 12,572 10% IB: HA Number of clusters with >0.5 0% conversion specificity RBPMS binding sites FIGURE 1. RBPMS overview. (A) RBPMS is conserved in vertebrates. Alignments were generated using ClustalW (NP_956553.1, NP_001002409.1, NP_082306.2, NP_919248.1, NP_001008710.1, NP_001036139, XP_003199078.1). (B) RBPMS and RBPMS2 localize to the nucleus and cytoplasm. Western Blotting analysis of nucleo-cytoplasmic fractions prepared from FLAG-HA RBPMS and RBPMS2 cell lines, as indicated. Nuclear (Nuc), cy- toplasmic (Cyt), and total cell lysate (Tot) fractions were resolved on a 4%–12% SDS–polyacrylamide gel and then probed using an anti-HA antibody targeting FLAG-HA RBPMS and RBPMS2, and antibodies targeting ELAVL1 (HuR), TUBB (β-tubulin), and LMNB1 (lamin B) as controls for the purity of the cytoplasmic and nuclear fractions. (Right) Immunofluorescence staining of HA epitope in HEK293 cells stably expressing FLAG-HA RBPMS and FLAG-HA RBPMS2, using Hoechst and Phalloidin 546 as controls. (C) Phosphorimages of SDS-PAGE fractionating PAR-CLIP immu- noprecipitate from constitutive and inducible overexpressing FLAG-HA-tagged RBPMS HEK293 cells. The cross-linked RNA–RBPMS complexes are indicated for two biological replicate experiments. Anti-HA Western-blotting control for expression and loading is shown at the bottom. Two protein bands were recognized by anti-HA antibody, one at the expected size based on recombinant full-length RBPMS and the other shorter, suggesting proteolytic cleavage (bands confirmed as RBPMS by mass spectrometry). (D) Overlap of PAR-CLIP clusters with ≥0.5 T-to-C conversion specificity between libraries A and B defines 6207 RBPMS-binding sites. (E) Genomic distribution of RBPMS-binding sites. www.rnajournal.org 1091 Downloaded from rnajournal.cshlp.org on October 1, 2021 - Published by Cold Spring Harbor Laboratory Press Farazi et al. Dysregulation of RBPMS family proteins has been re- we generated an atlas of RBPMS family expression using ported in cancer (Skawran et al. 2008; Miller and Stama- microarray data from 156 mouse samples from six reports toyannopoulos 2010; Drozdov et al. 2012; Hapkova et al. submitted to the Gene Expression Omnibus
Recommended publications
  • Ubiquitin-Conjugating Enzyme UBE2J1 Negatively Modulates

    Ubiquitin-Conjugating Enzyme UBE2J1 Negatively Modulates

    Feng et al. Virology Journal (2018) 15:132 https://doi.org/10.1186/s12985-018-1040-5 RESEARCH Open Access Ubiquitin-conjugating enzyme UBE2J1 negatively modulates interferon pathway and promotes RNA virus infection Tingting Feng1, Lei Deng1, Xiaochuan Lu1, Wen Pan1, Qihan Wu2* and Jianfeng Dai1,2* Abstract Background: Viral infection activates innate immune pathways and interferons (IFNs) play a pivotal role in the outcome of a viral infection. Ubiquitin modifications of host and viral proteins significantly influence the progress of virus infection. Ubiquitin-conjugating enzyme E2s (UBE2) have the capacity to determine ubiquitin chain topology and emerge as key mediators of chain assembly. Methods: In this study, we screened the functions of 34 E2 genes using an RNAi library during Dengue virus (DENV) infection. RNAi and gene overexpression approaches were used to study the gene function in viral infection and interferon signaling. Results: We found that silencing UBE2J1 significantly impaired DENV infection, while overexpression of UBE2J1 enhanced DENV infection. Further studies suggested that type I IFN expression was significantly increased in UBE2J1 silenced cells and decreased in UBE2J1 overexpressed cells. Reporter assay suggested that overexpression of UBE2J1 dramatically suppressed RIG-I directed IFNβ promoter activation. Finally, we have confirmed that UBE2J1 can facilitate the ubiquitination and degradation of transcription factor IFN regulatory factor 3 (IRF3). Conclusion: These results suggest that UBE2 family member UBE2J1 can negatively regulate type I IFN expression, thereby promote RNA virus infection. Keywords: UBE2J1, Dengue virus, Interferons, IRF3, K48 ubiquitination Background antiviral responses [3]. IFN-α/β regulates the synthesis Dengue virus (DENV), transmitted by Aedes aegypti and of antiviral proteins and immunoregulatory factors Aedes albopicuts, causes an emerging tropical disease through the JAK/STAT signaling pathway [4, 5].
  • Downloaded from NCBI Website [31]

    Downloaded from NCBI Website [31]

    Int. J. Mol. Sci. 2014, 15, 21788-21802; doi:10.3390/ijms151221788 OPEN ACCESS International Journal of Molecular Sciences ISSN 1422-0067 www.mdpi.com/journal/ijms Article Interactome Mapping Reveals Important Pathways in Skeletal Muscle Development of Pigs Jianhua Cao, Tinghua Huang, Xinyun Li and Shuhong Zhao * Key Laboratory of Agricultural Animal Genetics, Breeding and Reproduction of Ministry of Education of China, College of Animal Science and Technology, Huazhong Agricultural University, 1 Shizishan St., Wuhan 430070, China; E-Mails: [email protected] (J.C.); [email protected] (T.H.); [email protected] (X.L.) * Author to whom correspondence should be addressed; E-Mail: [email protected]; Tel.: +86-27-8738-7480; Fax: +86-27-8728-0408. External Editor: Mark L. Richter Received: 15 July 2014; in revised form: 19 October 2014 / Accepted: 6 November 2014 / Published: 26 November 2014 Abstract: The regulatory relationship and connectivity among genes involved in myogenesis and hypertrophy of skeletal muscle in pigs still remain large challenges. Presentation of gene interactions is a potential way to understand the mechanisms of developmental events in skeletal muscle. In this study, genome-wide transcripts and miRNA profiling was determined for Landrace pigs at four time points using microarray chips. A comprehensive method integrating gene ontology annotation and interactome network mapping was conducted to analyze the biological patterns and interaction modules of muscle development events based on differentially expressed genes and miRNAs. Our results showed that in total 484 genes and 34 miRNAs were detected for the duration from embryonic stage to adult in pigs, which composed two linear expression patterns with consensus changes.
  • Protein Interaction Network of Alternatively Spliced Isoforms from Brain Links Genetic Risk Factors for Autism

    Protein Interaction Network of Alternatively Spliced Isoforms from Brain Links Genetic Risk Factors for Autism

    ARTICLE Received 24 Aug 2013 | Accepted 14 Mar 2014 | Published 11 Apr 2014 DOI: 10.1038/ncomms4650 OPEN Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism Roser Corominas1,*, Xinping Yang2,3,*, Guan Ning Lin1,*, Shuli Kang1,*, Yun Shen2,3, Lila Ghamsari2,3,w, Martin Broly2,3, Maria Rodriguez2,3, Stanley Tam2,3, Shelly A. Trigg2,3,w, Changyu Fan2,3, Song Yi2,3, Murat Tasan4, Irma Lemmens5, Xingyan Kuang6, Nan Zhao6, Dheeraj Malhotra7, Jacob J. Michaelson7,w, Vladimir Vacic8, Michael A. Calderwood2,3, Frederick P. Roth2,3,4, Jan Tavernier5, Steve Horvath9, Kourosh Salehi-Ashtiani2,3,w, Dmitry Korkin6, Jonathan Sebat7, David E. Hill2,3, Tong Hao2,3, Marc Vidal2,3 & Lilia M. Iakoucheva1 Increased risk for autism spectrum disorders (ASD) is attributed to hundreds of genetic loci. The convergence of ASD variants have been investigated using various approaches, including protein interactions extracted from the published literature. However, these datasets are frequently incomplete, carry biases and are limited to interactions of a single splicing isoform, which may not be expressed in the disease-relevant tissue. Here we introduce a new interactome mapping approach by experimentally identifying interactions between brain-expressed alternatively spliced variants of ASD risk factors. The Autism Spliceform Interaction Network reveals that almost half of the detected interactions and about 30% of the newly identified interacting partners represent contribution from splicing variants, emphasizing the importance of isoform networks. Isoform interactions greatly contribute to establishing direct physical connections between proteins from the de novo autism CNVs. Our findings demonstrate the critical role of spliceform networks for translating genetic knowledge into a better understanding of human diseases.
  • A Drosophila Ortholog of the Human Cylindromatosis Tumor Suppressor

    A Drosophila Ortholog of the Human Cylindromatosis Tumor Suppressor

    RESEARCH ARTICLE 2605 Development 134, 2605-2614 (2007) doi:10.1242/dev.02859 A Drosophila ortholog of the human cylindromatosis tumor suppressor gene regulates triglyceride content and antibacterial defense Theodore Tsichritzis1, Peer C. Gaentzsch3, Stylianos Kosmidis2, Anthony E. Brown3, Efthimios M. Skoulakis2, Petros Ligoxygakis3,* and George Mosialos1,4,* The cylindromatosis (CYLD) gene is mutated in human tumors of skin appendages. It encodes a deubiquitylating enzyme (CYLD) that is a negative regulator of the NF-␬B and JNK signaling pathways, in vitro. However, the tissue-specific function and regulation of CYLD in vivo are poorly understood. We established a genetically tractable animal model to initiate a systematic investigation of these issues by characterizing an ortholog of CYLD in Drosophila. Drosophila CYLD is broadly expressed during development and, in adult animals, is localized in the fat body, ovaries, testes, digestive tract and specific areas of the nervous system. We demonstrate that the protein product of Drosophila CYLD (CYLD), like its mammalian counterpart, is a deubiquitylating enzyme. Impairment of CYLD expression is associated with altered fat body morphology in adult flies, increased triglyceride levels and increased survival under starvation conditions. Furthermore, flies with compromised CYLD expression exhibited reduced resistance to bacterial infections. All mutant phenotypes described were reversible upon conditional expression of CYLD transgenes. Our results implicate CYLD in a broad range of functions associated with fat homeostasis and host defence in Drosophila. KEY WORDS: Cylindromatosis, Drosophila, Fat body, Host defense, NF-kappaB INTRODUCTION disease and it is required for the proper development of T Familial cylindromatosis is an autosomal-dominant predisposition lymphocytes in mice (Costello et al., 2005; Reiley et al., 2006).
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus

    A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus

    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
  • Inhibition of Β-Catenin Signaling Respecifies Anterior-Like Endothelium Into Beating Human Cardiomyocytes Nathan J

    Inhibition of Β-Catenin Signaling Respecifies Anterior-Like Endothelium Into Beating Human Cardiomyocytes Nathan J

    © 2015. Published by The Company of Biologists Ltd | Development (2015) 142, 3198-3209 doi:10.1242/dev.117010 RESEARCH ARTICLE STEM CELLS AND REGENERATION Inhibition of β-catenin signaling respecifies anterior-like endothelium into beating human cardiomyocytes Nathan J. Palpant1,2,3,*, Lil Pabon1,2,3,*, Meredith Roberts2,3,4, Brandon Hadland5,6, Daniel Jones7, Christina Jones3,8,9, Randall T. Moon3,8,9, Walter L. Ruzzo7, Irwin Bernstein5,6, Ying Zheng2,3,4 and Charles E. Murry1,2,3,4,10,‡ ABSTRACT lineages. Anterior mesoderm (mid-streak) gives rise to cardiac and endocardial endothelium, whereas posterior mesoderm (posterior During vertebrate development, mesodermal fate choices are regulated streak) gives rise to the blood-forming endothelium and vasculature by interactions between morphogens such as activin/nodal, BMPs and (Murry and Keller, 2008). Wnt/β-catenin that define anterior-posterior patterning and specify Well-described anterior-posterior morphogen gradients, downstream derivatives including cardiomyocyte, endothelial and including those of activin A/nodal and BMP4, are thought to hematopoietic cells. We used human embryonic stem cells to explore pattern mesoderm subtypes (Nostro et al., 2008; Sumi et al., 2008; how these pathways control mesodermal fate choices in vitro. Varying Kattman et al., 2011). Such gradients are proposed to specify doses of activin A and BMP4 to mimic cytokine gradient polarization anterior mesodermal fates like cardiomyocytes versus posterior in the anterior-posterior axis of the embryo led to differential activity mesodermal fates like blood. Remarkably, a recent study showed of Wnt/β-catenin signaling and specified distinct anterior-like (high activin/ that ectopic induction of a nodal/BMP gradient in zebrafish embryos low BMP) and posterior-like (low activin/high BMP) mesodermal was sufficient to create an entirely new embryonic axis that could populations.
  • Transparent Transgenic in Vivo Zebrafish Model To

    Transparent Transgenic in Vivo Zebrafish Model To

    cells Protocol Development of Tg(UAS:SEC-Hsa.ANXA5-YFP,myl7:RFP); Casper(roy−/−,nacre−/−) Transparent Transgenic In Vivo Zebrafish Model to Study the Cardiomyocyte Function Surendra K. Rajpurohit 1,* , Aaron Gopal 2, May Ye Mon 1 , Nikhil G. Patel 3 and Vishal Arora 2,* 1 Georgia Cancer Center, Medical College of Georgia, Augusta University, Augusta, GA 30912, USA; [email protected] 2 Department of Medicine, Division of Cardiology, Medical College of Georgia, Augusta University, Augusta, GA 30912, USA; [email protected] 3 Department of Pathology, Medical College of Georgia, Augusta University, Augusta, GA 30912, USA; [email protected] * Correspondence: [email protected] (S.K.R.); [email protected] (V.A.) Abstract: The zebrafish provided an excellent platform to study the genetic and molecular approach of cellular phenotype-based cardiac research. We designed a novel protocol to develop the transparent transgenic zebrafish model to study annexin-5 activity in the cardiovascular function by generating homozygous transparent skin Casper(roy−/−,nacre−/−); myl7:RFP; annexin-5:YFP transgenic ze- brafish. The skin pigmentation background of any vertebrate model organism is a major obstruction for in vivo confocal imaging to study the transgenic cellular phenotype-based study. By developing Citation: Rajpurohit, S.K.; Gopal, A.; Casper(roy−/−,nacre−/−); myl7; annexin-5 transparent transgenic zebrafish strain, we established Mon, M.Y.; Patel, N.G.; Arora, V. time-lapse in vivo confocal microscopy to study cellular phenotype/pathologies of cardiomyocytes Development of Tg(UAS:SEC- over time to quantify changes in cardiomyocyte morphology and function over time, comparing Hsa.ANXA5-YFP,myl7:RFP); control and cardiac injury and cardio-oncology.
  • RBPMS Is Differentially Expressed in High-Grade Serous Ovarian Cancers

    RBPMS Is Differentially Expressed in High-Grade Serous Ovarian Cancers

    1 RBPMS is differentially expressed in high-grade serous ovarian cancers. 2 3 Shahan Mamoor1 1 4 [email protected] East Islip, NY 11730 5 6 Ovarian cancer is the most lethal gynecologic cancer1. We sought to identify genes associated 7 with high-grade serous ovarian cancer (HGSC) by comparing global gene expression profiles of 8 normal ovary with that of primary tumors from women diagnosed with HGSC using published microarray data2,3. We found significant differential expression of RBPMS in high-grade serous 9 ovarian tumors. 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 Keywords: ovarian cancer, high-grade serous ovarian cancer, HGSC, targeted therapeutics in 26 ovarian cancer, systems biology of ovarian cancer, RBPMS. 27 28 PAGE 1 OF 13 1 The five-year survival rate for women diagnosed with high-grade serous ovarian cancer is 2 between 30-40% and has not changed significantly in decades4,5. The development of novel, 3 4 targeted therapeutics to treat HGSC can be facilitated by an enhanced understanding of the 5 transcriptional behavior of ovarian tumors relative to that of the normal ovary. We mined 6 2,3 7 published microarray data to compare global gene expression profiles between HGSC ovarian 8 tumors and that of normal ovarian tissue. We identified the gene encoding RBPMS as among the 9 most differentially expressed genes in HGSC tumors of the ovary. RBPMS may be a gene of 10 11 interest when prioritizing the study of target genes and pathways for the development of novel 12 therapeutic interventions in high-grade serous ovarian cancers.
  • Cardiomyopathy

    Cardiomyopathy

    JACC: BASIC TO TRANSLATIONAL SCIENCE VOL.1,NO.5,2016 ª 2016 THE AUTHORS. PUBLISHED BY ELSEVIER ON BEHALF OF THE AMERICAN ISSN 2452-302X COLLEGE OF CARDIOLOGY FOUNDATION. THIS IS AN OPEN ACCESS ARTICLE UNDER http://dx.doi.org/10.1016/j.jacbts.2016.05.004 THE CC BY-NC-ND LICENSE (http://creativecommons.org/licenses/by-nc-nd/4.0/). PRE-CLINICAL RESEARCH FLNC Gene Splice Mutations Cause Dilated Cardiomyopathy a a b,c a d Rene L. Begay, BS, Charles A. Tharp, MD, August Martin, Sharon L. Graw, PHD, Gianfranco Sinagra, MD, e a a b,c,f b,c Daniela Miani, MD, Mary E. Sweet, BA, Dobromir B. Slavov, PHD, Neil Stafford, MD, Molly J. Zeller, b,c a d g g Rasha Alnefaie, Teisha J. Rowland, PHD, Francesca Brun, MD, Kenneth L. Jones, PHD, Katherine Gowan, a b,c a Luisa Mestroni, MD, Deborah M. Garrity, PHD, Matthew R.G. Taylor, MD, PHD VISUAL ABSTRACT HIGHLIGHTS Deoxyribonucleic acid obtained from 2 large DCM families was studied using whole-exome sequencing and cose- gregation analysis resulting in the iden- tification of a novel disease gene, FLNC. The2families,fromthesameItalian region, harbored the same FLNC splice- site mutation (FLNC c.7251D1G>A). A third U.S. family was then identified with a novel FLNC splice-site mutation (FLNC c.5669-1delG) that leads to haploinsufficiency as shown by the FLNC Western blot analysis of the heart muscle. The FLNC ortholog flncb morpholino was injected into zebrafish embryos, and when flncb was knocked down caused a cardiac dysfunction phenotype.
  • The Solution Structure of Dead End Bound to AU-Rich RNA Reveals an Unprecedented Mode of Tandem RRM-RNA Recognition Required for Mrna Repression

    The Solution Structure of Dead End Bound to AU-Rich RNA Reveals an Unprecedented Mode of Tandem RRM-RNA Recognition Required for Mrna Repression

    bioRxiv preprint doi: https://doi.org/10.1101/572156; this version posted March 9, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. The solution structure of Dead End bound to AU-rich RNA reveals an unprecedented mode of tandem RRM-RNA recognition required for mRNA repression Authors Malgorzata M. Duszczyk1*, Harry Wischnewski2, Tamara Kazeeva1, Fionna E. Loughlin1,4, Christine von Schroetter1, Ugo Pradère3, Jonathan Hall3, Constance Ciaudo2*, Frédéric H.-T. Allain1,5* Affiliations 1Institute of Molecular Biology and Biophysics and 2Institute of Molecular Health Sciences, Department of Biology, 3Institute of Pharmaceutical Sciences, Department of Chemistry and Applied Biosciences, ETH Zürich, 8093, Zürich, Switzerland 4Present Address: Monash Biomedicine Discovery Institute, Department of Biochemistry and Molecular Biology, Monash University, Clayton, 3800 VIC, Australia 5Lead Contact Contact Information *To whom correspondence should be addressed. E-mail: [email protected] (M.M.D.), [email protected] (C.C.), [email protected] (F.H.- T.A.) Abstract Dead End (DND1) is an RNA-binding protein essential for germline development through its role in the clearance of AU-rich mRNAs. Here, we present the solution structure of its tandem RNA Recognition Motifs (RRMs) bound to AU-rich RNA. The structure reveals how an NYAYUNN element is recognized in agreement with recent genome-wide studies. RRM1 acts as a main binding platform, including unusual helical and -hairpin extensions to the canonical RRM fold.
  • Supplemental Information

    Supplemental Information

    Supplemental information Dissection of the genomic structure of the miR-183/96/182 gene. Previously, we showed that the miR-183/96/182 cluster is an intergenic miRNA cluster, located in a ~60-kb interval between the genes encoding nuclear respiratory factor-1 (Nrf1) and ubiquitin-conjugating enzyme E2H (Ube2h) on mouse chr6qA3.3 (1). To start to uncover the genomic structure of the miR- 183/96/182 gene, we first studied genomic features around miR-183/96/182 in the UCSC genome browser (http://genome.UCSC.edu/), and identified two CpG islands 3.4-6.5 kb 5’ of pre-miR-183, the most 5’ miRNA of the cluster (Fig. 1A; Fig. S1 and Seq. S1). A cDNA clone, AK044220, located at 3.2-4.6 kb 5’ to pre-miR-183, encompasses the second CpG island (Fig. 1A; Fig. S1). We hypothesized that this cDNA clone was derived from 5’ exon(s) of the primary transcript of the miR-183/96/182 gene, as CpG islands are often associated with promoters (2). Supporting this hypothesis, multiple expressed sequences detected by gene-trap clones, including clone D016D06 (3, 4), were co-localized with the cDNA clone AK044220 (Fig. 1A; Fig. S1). Clone D016D06, deposited by the German GeneTrap Consortium (GGTC) (http://tikus.gsf.de) (3, 4), was derived from insertion of a retroviral construct, rFlpROSAβgeo in 129S2 ES cells (Fig. 1A and C). The rFlpROSAβgeo construct carries a promoterless reporter gene, the β−geo cassette - an in-frame fusion of the β-galactosidase and neomycin resistance (Neor) gene (5), with a splicing acceptor (SA) immediately upstream, and a polyA signal downstream of the β−geo cassette (Fig.
  • CLIP-Seq and Massively Parallel Functional Analysis of the CELF6

    CLIP-Seq and Massively Parallel Functional Analysis of the CELF6

    bioRxiv preprint doi: https://doi.org/10.1101/401604; this version posted August 27, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. CLIP-Seq and massively parallel functional analysis of the CELF6 RNA binding protein reveals a role in destabilizing synaptic gene mRNAs through interaction with 3’UTR elements in vivo Michael A. Rieger1,2, Dana M. King1, Barak A. Cohen1, Joseph D. Dougherty1,2 1Department of Genetics, Washington University School of Medicine, St. Louis, MO 63110, USA 2Department of Psychiatry, Washington University School of Medicine, St. Louis, MO 63110, USA Contact: Dr. Joseph D. Dougherty Washington University School of Medicine Department of Genetics Campus Box 8232 4566 Scott Ave. St. Louis, Mo. 63110-1093 (314) 286-0752 [email protected] bioRxiv preprint doi: https://doi.org/10.1101/401604; this version posted August 27, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Abstract CELF6 is an RNA-binding protein in a family of proteins with roles in human health and disease, however little is known about the mRNA targets or in vivo function of this protein. We utilized HITS-CLIP/CLIP-Seq to identify, for the first time, in vivo targets of CELF6 and identify hundreds of transcripts bound by CELF6 in the brain. We found these are disproportionately mRNAs coding for synaptic proteins. We then conducted extensive functional validation of these targets, testing greater than 400 CELF6 bound sequence elements for their activity, applying a massively parallel reporter assay framework to evaluation of the CLIP data.