DOCSLIB.ORG

Clinical, Laboratory, and Genetic Studies of Families with Charcot- Marie-Tooth Type 2C Disease

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Clinical, Laboratory, and Genetic Studies of Families with Charcot- Marie-Tooth Type 2C Disease Clinical, laboratory, and genetic studies of families with Charcot- Marie-Tooth type 2C disease Guida Landouré A thesis submitted to the University College London for the degree of Doctor of Philosophy August 2011 Department of Medicine University College London 1 „I, Guida Landouré, confirm that the work presented in this thesis is my own. Where information has been derived from other sources, I confirm that this has been indicated in the thesis.‟ 2 Dedication and acknowledgements I dedicate this work to: GOD the Almighty, the clement and merciful who gave me the chance and courage to accomplish this work, and to his Prophet Muhammad, Peace upon Him. My parents: thanks for your unshakable love and support throughout my life. All my relatives and friends: thanks for being there whenever I needed you. My wife and son for their love and support. My friend Addis Taye and our patient Kelly Clever (in memoriam). First, my thanks to my supervisor Professor Robert Kleta. You have given me the chance to accomplish a dream that would be unlikely in other situations. It has sometimes been hard, but you have been patient and understanding to make this happen. Your sense of good and high standard work is remarkable. I am thankful to my supervisor Professor John Hardy. Your guidance and encouragement throughout this work were most helpful. To my scientific Godfather Dr. Kenneth Fischbeck: I met you when I did not know that a gene was made of exons and introns, but you have trusted me from the beginning and gave me an opportunity that not many would give to unskilled people like me. Thank you for your continued support. I will always be grateful to you. To my mentor Dr. Charlotte Sumner: I still remember the day you handed me this project, and I was wondering why to a layperson as me. Thank you for all the knowledge learned. Thank you for all your teaching, and above all for your friendship. A special thanks to Professor Moussa Traoré for his continued support. Many thanks to my co-workers at UCL and NIH, in particular Horia Stanescu and Barrington Burnett. Your presence and support helped me pass difficult moments. I thank all the other people who worked in this project from the beginning to the end: Dr. Michael Caterina, Shelly Choo, Dr. Rachelle Gaudet, Dr. Henry Houlden, Hitoshi Inada, Lingling Kong, Dr. Christy Ludlow, Tara Martinez, Clare Munns, Rima Paudel, Christopher Phelps, Yijun Shi, and Dr. Anselm Zdebik. 3 Abstract Charcot-Marie-Tooth disease type 2C (CMT2C) is an autosomal dominant neuropathy characterized by limb, diaphragm, and laryngeal muscle weakness. We studied five unrelated families with CMT2C, of which two showed significant linkage to chromosome 12q24.11. Linkage analysis excluded this locus in one of the remaining families, suggesting genetic heterogeneity within this CMT subtype. SNP genotyping of samples from affected individuals in the three linked families did not reveal any deletion or copy number variation. All genes in this region were sequenced and two heterozygous missense mutations were identified in the transient receptor potential, subfamily V, member 4 (TRPV4), at positions c.805C>T and c.806G>A in two families, predicting the amino acid substitutions R269C and R269H, respectively. Two other mutations (R186Q, R232C) and one change of uncertain significance (D584N) were subsequently identified. The R269C and R269H variants were not present in more than 200 controls. TRPV4 is a well known member of the TRP superfamily of cation channels. We confirmed that it is expressed in motor and sensory neurons. The R186, R232, and R269 residues are located in the intracellular N-terminal portion of the TRPV4 protein in the ankyrin repeat domain (ARD); functional domains known to mediate protein-protein interactions. When expressed in HEK293 cells and Xenopus oocytes, R269C and R269H TRPV4 trafficked normally to the cell surface, but caused increased cell toxicity and increased constitutive and activated channel currents compared to wild-type TRPV4. Other mutations in TRPV4 have been previously associated with inherited forms of skeletal dysplasia. When mapped onto the crystal structure of the TRPV4 ARD, the mutations found in bone diseases lie on the opposite face of the domain compared to those causing neuropathy. Our findings indicate that TRPV4 mutations cause a degenerative disorder of peripheral nerves. Thus, there is striking phenotypic variability with different mutations in this important channel protein. 4 Table of contents 1 Introduction ............................................................................................................... 10 1.1 The nervous system............................................................................................ 10 1.1.1 Neuron......................................................................................................... 10 1.1.2 The central nervous system ......................................................................... 12 1.1.3 The peripheral nervous system ................................................................... 17 1.1.4 Histopathological responses of peripheral nerves to injury ....................... 21 1.1.5 Diseases of the peripheral nervous system ................................................. 22 1.1.6 Approach to evaluation of peripheral neuropathies ................................... 26 1.1.7 Treatment of peripheral neuropathies ........................................................ 29 1.2 Charcot-Marie-Tooth disease (CMT) ................................................................ 29 1.2.1 Historical notes ........................................................................................... 29 1.2.2 General findings.......................................................................................... 30 1.2.3 Classification .............................................................................................. 30 1.2.4 Therapeutic approaches.............................................................................. 47 1.3 Transient Receptor Potential (TRP) Channels ................................................... 48 1.3.1 The canonical transient receptor potential channels (TRPC) .................... 52 1.3.2 Transient receptor potential vanilloid channels (TRPV) ............................ 54 1.3.3 Transient receptor potential melastatin channels (TRPM) ........................ 58 1.3.4 Transient receptor potential ankyrin channel (TRPA) ............................... 61 1.3.5 Transient receptor potential polycystin channels (TRPP) .......................... 62 1.3.6 Transient receptor potential mucolipin channels (TRPML) ....................... 64 1.4 Objectives .......................................................................................................... 65 2 Materials and Methods .............................................................................................. 66 2.1 Patients ............................................................................................................... 66 2.2 Laboratory studies .............................................................................................. 72 2.2.1 Muscle and nerve biopsy ............................................................................. 72 2.2.2 Nerve conduction studies (NCS) and electromyography (EMG) ................ 72 2.2.3 Fiberoptic nasolaryngoscopy...................................................................... 74 2.2.4 Radiological evaluation .............................................................................. 75 2.2.5 DNA extraction ........................................................................................... 75 2.2.6 Skin biopsy .................................................................................................. 75 2.2.7 Immortal cell lines establishment ............................................................... 75 5 2.3 Genetic analysis ................................................................................................. 76 2.3.1 Linkage analysis/Fine mapping .................................................................. 76 2.3.2 Single Nucleotide Polymorphism (SNP) array analysis ............................. 77 2.3.3 Selection of candidate genes ....................................................................... 77 2.3.4 Mutation detection ...................................................................................... 78 2.3.5 Exome sequencing ....................................................................................... 79 2.4 Functional studies of mutants TRPV4 ............................................................... 80 2.4.1 TRPV4 expression in the nervous system .................................................... 80 2.4.2 Expression of WT and mutant TRPV4 in Xenopus oocytes and mammalian cells ...................................................................................................................... 81 2.4.3 TRPV4 blockers .......................................................................................... 82 2.4.4 Cell death quantification............................................................................. 82 2.4.5 Immunohistochemistry ................................................................................ 83 2.4.6 Cell surface biotinylation ............................................................................ 83 2.4.7 Endoplasmic Reticulum (ER) stress experiment ......................................... 84 2.4.8 Intracellular
Load more

Recommended publications
  • SRC Antibody - N-Terminal Region (ARP32476 P050) Data Sheet
    SRC antibody - N-terminal region (ARP32476_P050) Data Sheet Product Number ARP32476_P050 Product Name SRC antibody - N-terminal region (ARP32476_P050) Size 50ug Gene Symbol SRC Alias Symbols ASV; SRC1; c-SRC; p60-Src Nucleotide Accession# NM_005417 Protein Size (# AA) 536 amino acids Molecular Weight 60kDa Product Format Lyophilized powder NCBI Gene Id 6714 Host Rabbit Clonality Polyclonal Official Gene Full Name V-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) Gene Family SH2D This is a rabbit polyclonal antibody against SRC. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 Description products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: QTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGG This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the Description of Target regulation of embryonic development and cell growth. SRC protein is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the
    [Show full text]
  • NBD-17-173R1 Title
    Elsevier Editorial System(tm) for Neurobiology of Disease Manuscript Draft Manuscript Number: NBD-17-173R1 Title: KCC3 loss-of-function contributes to Andermann syndrome by inducing activity-dependent neuromuscular junction defects Article Type: Research paper Keywords: Motoneuron; Andermann syndrome; chloride homeostasis; electrical activity; neuromuscular junction; Na+/K+ ATPase Corresponding Author: Dr frederique scamps, Corresponding Author's Institution: Inserm First Author: Mélissa Bowerman Order of Authors: Mélissa Bowerman; Céline Salsac; Véronique Bernard; Claire Soulard; Annie Dionne; Emmanuelle Coque; Salim Benlefki; Pascale Hince; Patrick Dion; Gillian Butler-Browne; William Camu; Jean-Pierre Bouchard; Eric Delpire; Guy Rouleau; Cédric Raoul; frederique scamps Abstract: Loss-of-function mutations in the potassium-chloride cotransporter KCC3 lead to Andermann syndrome, a severe sensorimotor neuropathy characterized by areflexia, amyotrophy and locomotor abnormalities. The molecular events responsible for axonal loss remain poorly understood. Here, we establish that global or neuron-specific KCC3 loss-of-function in mice leads to early neuromuscular junction (NMJ) abnormalities and muscular atrophy that are consistent with the pre- synaptic neurotransmission defects observed in patients. KCC3 depletion does not modify chloride handling, but promotes an abnormal electrical activity among primary motoneurons and mislocalization of Na+/K+-ATPase α1 in spinal cord motoneurons. Moreover, the activity-targeting drug carbamazepine restores Na+/K+-ATPase α1 localization and reduces NMJ denervation in Slc12a6-/- mice. We here propose that abnormal motoneuron electrical activity contributes to the peripheral neuropathy observed in Andermann syndrome. Cover Letter Dear Editor Thank you for your interest in this study. We have answered to all the points addressed by the Referees. We now provide discussion and references concerning the pertinence of using motoneuron primary culture relative to recordings from post-natal or adult spinal cord slices.
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • The Intracellular Ca2+ Release Channel TRPML1 Regulates Lower Urinary Tract Smooth Muscle Contractility
    The intracellular Ca2+ release channel TRPML1 regulates lower urinary tract smooth muscle contractility Caoimhin S. Griffina, Michael G. Alvaradoa, Evan Yamasakia, Bernard T. Drummb,c, Vivek Krishnana, Sher Alia, Eleanor M. Naglea, Kenton M. Sandersb, and Scott Earleya,1 aDepartment of Pharmacology, Center for Molecular and Cellular Signaling in the Cardiovascular System, Reno School of Medicine, University of Nevada, Reno, NV 89557-0318; bDepartment of Physiology and Cell Biology, Reno School of Medicine, University of Nevada, Reno, NV 89557-0318; and cDepartment of Life & Health Sciences, Dundalk Institute of Technology, Louth, Ireland A91 K584 Edited by Mark T. Nelson, University of Vermont, Burlington, VT, and approved October 13, 2020 (received for review August 12, 2020) TRPML1 (transient receptor potential mucolipin 1) is a Ca2+-perme- including dense granulomembranous storage bodies in neurons, able, nonselective cation channel that is predominantly localized to elevated plasma gastrin, vacuolization in the gastric mucosa, and the membranes of late endosomes and lysosomes (LELs). Intracellular retinal degeneration (14). Interestingly, however, an anatomical release of Ca2+ through TRPML1 is thought to be pivotal for mainte- examination of these mice reveals dramatically distended bladders nance of intravesicular acidic pH as well as the maturation, fusion, and (14), leading us to question how TRPML1, an intracellular Ca2+- trafficking of LELs. Interestingly, genetic ablation of TRPML1 in mice release channel important in LEL function, affects bladder −/− (Mcoln1 ) induces a hyperdistended/hypertrophic bladder phenotype. physiology. Here, we investigated this phenomenon further by exploring an un- The lower urinary tract (LUT) is composed of the urinary conventional role for TRPML1 channels in the regulation of Ca2+-signal- bladder and urethra—structures that serve the simple, reciprocal ing activity and contractility in bladder and urethral smooth muscle cells functions of storing and voiding urine (15).
    [Show full text]
  • Peripheral Neuropathy in Complex Inherited Diseases: an Approach To
    PERIPHERAL NEUROPATHY IN COMPLEX INHERITED DISEASES: AN APPROACH TO DIAGNOSIS Rossor AM1*, Carr AS1*, Devine H1, Chandrashekar H2, Pelayo-Negro AL1, Pareyson D3, Shy ME4, Scherer SS5, Reilly MM1. 1. MRC Centre for Neuromuscular Diseases, UCL Institute of Neurology and National Hospital for Neurology and Neurosurgery, London, WC1N 3BG, UK. 2. Lysholm Department of Neuroradiology, National Hospital for Neurology and Neurosurgery, London, WC1N 3BG, UK. 3. Unit of Neurological Rare Diseases of Adulthood, Carlo Besta Neurological Institute IRCCS Foundation, Milan, Italy. 4. Department of Neurology, University of Iowa, 200 Hawkins Drive, Iowa City, IA 52242, USA 5. Department of Neurology, University of Pennsylvania, Philadelphia, PA 19014, USA. * These authors contributed equally to this work Corresponding author: Mary M Reilly Address: MRC Centre for Neuromuscular Diseases, 8-11 Queen Square, London, WC1N 3BG, UK. Email: [email protected] Telephone: 0044 (0) 203 456 7890 Word count: 4825 ABSTRACT Peripheral neuropathy is a common finding in patients with complex inherited neurological diseases and may be subclinical or a major component of the phenotype. This review aims to provide a clinical approach to the diagnosis of this complex group of patients by addressing key questions including the predominant neurological syndrome associated with the neuropathy e.g. spasticity, the type of neuropathy, and the other neurological and non- neurological features of the syndrome. Priority is given to the diagnosis of treatable conditions. Using this approach, we associated neuropathy with one of three major syndromic categories - 1) ataxia, 2) spasticity, and 3) global neurodevelopmental impairment. Syndromes that do not fall easily into one of these three categories can be grouped according to the predominant system involved in addition to the neuropathy e.g.
    [Show full text]
  • New Developments in Charcot–Marie–Tooth Neuropathy and Related Diseases
    CE: Alpana; WCO 300505; Total nos of Pages: 10; WCO 300505 REVIEW CURRENT OPINION New developments in Charcot–Marie–Tooth neuropathy and related diseases Davide Pareyson, Paola Saveri, and Chiara Pisciotta Purpose of review Charcot–Marie–Tooth disease (CMT) and related neuropathies represent a heterogeneous group of hereditary disorders. The present review will discuss the most recent advances in the field. Recent findings Knowledge of CMT epidemiology and frequency of the main associated genes is increasing, with an overall prevalence estimated at 10–28/100 000. In the last years, the huge number of newly uncovered genes, thanks to next-generation sequencing techniques, is challenging the current classification of CMT. During the last 18 months other genes have been associated with CMT, such as PMP2, MORC2, NEFH, MME, and DGAT2. For the most common forms of CMT, numerous promising compounds are under study in cellular and animal models, mainly targeting either the protein degradation pathway or the protein overexpression. Consequently, efforts are devoted to develop responsive outcome measures and biomarkers for this overall slowly progressive disorder, with quantitative muscle MRI resulting the most sensitive-to-change measure. Summary This is a rapidly evolving field where better understanding of pathophysiology is paving the way to develop potentially effective treatments, part of which will soon be tested in patients. Intense research is currently devoted to prepare clinical trials and develop responsive outcome measures. Keywords
    [Show full text]
  • Neuropathophysiology, Genetic Profile, and Clinical Manifestation of Mucolipidosis IV—A Review and Case Series
    International Journal of Molecular Sciences Review Neuropathophysiology, Genetic Profile, and Clinical Manifestation of Mucolipidosis IV—A Review and Case Series 1, 2, 3, , Aleksandra Jezela-Stanek y , El˙zbietaCiara y and Karolina M. Stepien * y 1 Department of Genetics and Clinical Immunology, National Institute of Tuberculosis and Lung Diseases, 01-138 Warsaw, Poland; [email protected] 2 Department of Medical Genetics, The Children’s Memorial Heath Institute, 04-730 Warsaw, Poland; [email protected] 3 Adult Inherited Metabolic Diseases, Salford Royal NHS Foundation Trust, Salford M6 8HD, UK * Correspondence: [email protected] These authors contributed equally to this work. y Received: 31 May 2020; Accepted: 23 June 2020; Published: 26 June 2020 Abstract: Mucolipidosis type IV (MLIV) is an ultra-rare lysosomal storage disorder caused by biallelic mutations in MCOLN1 gene encoding the transient receptor potential channel mucolipin-1. So far, 35 pathogenic or likely pathogenic MLIV-related variants have been described. Clinical manifestations include severe intellectual disability, speech deficit, progressive visual impairment leading to blindness, and myopathy. The severity of the condition may vary, including less severe psychomotor delay and/or ocular findings. As no striking recognizable facial dysmorphism, skeletal anomalies, organomegaly, or lysosomal enzyme abnormalities in serum are common features of MLIV, the clinical diagnosis may be significantly improved because of characteristic ophthalmological anomalies. This review aims to outline the pathophysiology and genetic defects of this condition with a focus on the genotype–phenotype correlation amongst cases published in the literature. The authors will present their own clinical observations and long-term outcomes in adult MLIV cases.
    [Show full text]
  • X-Linked Diseases: Susceptible Females
    REVIEW ARTICLE X-linked diseases: susceptible females Barbara R. Migeon, MD 1 The role of X-inactivation is often ignored as a prime cause of sex data include reasons why women are often protected from the differences in disease. Yet, the way males and females express their deleterious variants carried on their X chromosome, and the factors X-linked genes has a major role in the dissimilar phenotypes that that render women susceptible in some instances. underlie many rare and common disorders, such as intellectual deficiency, epilepsy, congenital abnormalities, and diseases of the Genetics in Medicine (2020) 22:1156–1174; https://doi.org/10.1038/s41436- heart, blood, skin, muscle, and bones. Summarized here are many 020-0779-4 examples of the different presentations in males and females. Other INTRODUCTION SEX DIFFERENCES ARE DUE TO X-INACTIVATION Sex differences in human disease are usually attributed to The sex differences in the effect of X-linked pathologic variants sex specific life experiences, and sex hormones that is due to our method of X chromosome dosage compensation, influence the function of susceptible genes throughout the called X-inactivation;9 humans and most placental mammals – genome.1 5 Such factors do account for some dissimilarities. compensate for the sex difference in number of X chromosomes However, a major cause of sex-determined expression of (that is, XX females versus XY males) by transcribing only one disease has to do with differences in how males and females of the two female X chromosomes. X-inactivation silences all X transcribe their gene-rich human X chromosomes, which is chromosomes but one; therefore, both males and females have a often underappreciated as a cause of sex differences in single active X.10,11 disease.6 Males are the usual ones affected by X-linked For 46 XY males, that X is the only one they have; it always pathogenic variants.6 Females are biologically superior; a comes from their mother, as fathers contribute their Y female usually has no disease, or much less severe disease chromosome.
    [Show full text]
  • SUPPLEMENTARY MATERIAL Effect of Next
    SUPPLEMENTARY MATERIAL Effect of Next-Generation Exome Sequencing Depth for Discovery of Diagnostic Variants KKyung Kim1,2,3†, Moon-Woo Seong4†, Won-Hyong Chung3, Sung Sup Park4, Sangseob Leem1, Won Park5,6, Jihyun Kim1,2, KiYoung Lee1,2*‡, Rae Woong Park1,2* and Namshin Kim5,6** 1Department of Biomedical Informatics, Ajou University School of Medicine, Suwon 443-749, Korea 2Department of Biomedical Science, Graduate School, Ajou University, Suwon 443-749, Korea, 3Korean Bioinformation Center, Korea Research Institute of Bioscience and Biotechnology, Daejeon 305-806, Korea, 4Department of Laboratory Medicine, Seoul National University Hospital College of Medicine, Seoul 110-799, Korea, 5Department of Functional Genomics, Korea University of Science and Technology, Daejeon 305-806, Korea, 6Epigenomics Research Center, Genome Institute, Korea Research Institute of Bioscience and Biotechnology, Daejeon 305-806, Korea http//www. genominfo.org/src/sm/gni-13-31-s001.pdf Supplementary Table 1. List of diagnostic genes Gene Symbol Description Associated diseases ABCB11 ATP-binding cassette, sub-family B (MDR/TAP), member 11 Intrahepatic cholestasis ABCD1 ATP-binding cassette, sub-family D (ALD), member 1 Adrenoleukodystrophy ACVR1 Activin A receptor, type I Fibrodysplasia ossificans progressiva AGL Amylo-alpha-1, 6-glucosidase, 4-alpha-glucanotransferase Glycogen storage disease ALB Albumin Analbuminaemia APC Adenomatous polyposis coli Adenomatous polyposis coli APOE Apolipoprotein E Apolipoprotein E deficiency AR Androgen receptor Androgen insensitivity
    [Show full text]
  • The CNS Phenotype of X-Linked Charcot-Marie-Tooth Disease More Than a Peripheral Problem
    Views & Reviews CME The CNS phenotype of X-linked Charcot-Marie-Tooth disease More than a peripheral problem Robert A. Taylor, MD; Erin M. Simon, MD; Harold G. Marks, MD; and Steven S. Scherer, MD, PhD X-linked Charcot-Marie-Tooth disease (CMTX) is the lasting 4 hours. The following day, he developed the second most common form of inherited demyelinat- same symptoms, and mild right leg weakness, last- ing neuropathy, next to CMT type 1A, which is ing 10 hours. On day 3, he developed a complete caused by duplication of the PMP22 gene.1 CMTX is motor aphasia, right arm weakness, dysphagia, and caused by mutations in GJB1, the gene encoding loss of gag reflex, lasting 4 hours. MRI (on day 3) connexin32 (Cx32), which belongs to a highly con- showed abnormally increased T2 signal and reduced served family of proteins that form gap junctions in diffusion in the posterior portion of the centrum vertebrates. Myelinating Schwann cells express semiovale bilaterally (figure 1, A and B), as well as Cx32, which likely forms gap junctions between the in the splenium of the corpus callosum (figure 1, C layers of the myelin sheath, thereby providing a and D). These lesions spared the subcortical U fibers shorter pathway for the diffusion of small molecules and did not enhance (not shown). Three-dimensional and ions directly across the myelin sheath.2 Oligo- time-of-flight MR angiography of the intracranial dendrocytes also express Cx32, which participates in vessels, electroencephalography, and CSF were nor- the gap junction coupling of oligodendrocytes and mal, including a normal lactate level (1.1 mmol/L) astrocytes.3 and no oligoclonal bands.
    [Show full text]
  • Full Disclosure Forms
    Expanding genotype/phenotype of neuromuscular diseases by comprehensive target capture/NGS Xia Tian, PhD* ABSTRACT * Wen-Chen Liang, MD Objective: To establish and evaluate the effectiveness of a comprehensive next-generation * Yanming Feng, PhD sequencing (NGS) approach to simultaneously analyze all genes known to be responsible for Jing Wang, MD the most clinically and genetically heterogeneous neuromuscular diseases (NMDs) involving spi- Victor Wei Zhang, PhD nal motoneurons, neuromuscular junctions, nerves, and muscles. Chih-Hung Chou, MS Methods: All coding exons and at least 20 bp of flanking intronic sequences of 236 genes causing Hsien-Da Huang, PhD NMDs were enriched by using SeqCap EZ solution-based capture and enrichment method fol- Ching Wan Lam, PhD lowed by massively parallel sequencing on Illumina HiSeq2000. Ya-Yun Hsu, PhD ; 3 Thy-Sheng Lin, MD Results: The target gene capture/deep sequencing provides an average coverage of 1,000 per Wan-Tzu Chen, MS nucleotide. Thirty-five unrelated NMD families (38 patients) with clinical and/or muscle pathologic Lee-Jun Wong, PhD diagnoses but without identified causative genetic defects were analyzed. Deleterious mutations Yuh-Jyh Jong, MD were found in 29 families (83%). Definitive causative mutations were identified in 21 families (60%) and likely diagnoses were established in 8 families (23%). Six families were left without diagnosis due to uncertainty in phenotype/genotype correlation and/or unidentified causative Correspondence to genes. Using this comprehensive panel, we not only identified mutations in expected genes but Dr. Wong: also expanded phenotype/genotype among different subcategories of NMDs. [email protected] or Dr. Jong: Conclusions: Target gene capture/deep sequencing approach can greatly improve the genetic [email protected] diagnosis of NMDs.
    [Show full text]
  • Carrier Screening
    Who should be screened? Why is screening using the Ashkenazi Carrier testing is recommended for individuals of Jewish panels often ineffective in Ashkenazi Jewish descent who are pregnant, planning individuals of other ethnicities? pregnancy, or serving as gamete donors. This testing The variants on the Ashkenazi Jewish panel are helps determine the risk of having a child with one of unique to this population. Pathogenic variants carried Carrier the autosomal recessive genetic diseases occurring by non-Ashkenazi Jewish individuals would often with increased frequency in the Ashkenazi Jewish go undetected using such a panel. Therefore, if a population. If only one member of a couple is of Screening single member of a couple is Ashkenazi Jewish, that Ashkenazi Jewish descent, carrier testing should be individual should be screened first. The non-Jewish offered first to the Jewish individual. member should only be tested for the disorder(s) For Individuals of of which his/her partner is a carrier. Testing of the Ashkenazi Jewish Descent Which genetic disorders should be non-Jewish individual may require gene sequencing, included in preconception/prenatal carrier depending on the panel’s detection rate for the specific screening for individuals of Ashkenazi disorder in that ethnic group. Jewish descent? ARUP Test Information The American College of Obstetricians and Gynecologists (ACOG) 2017 guidelines recommend Genetic screening offered by ARUP includes testing for offering carrier screening for the following four 17 disorders, including
    [Show full text]