DOCSLIB.ORG

In the Metastatic Dissemination of Medulloblastoma

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
In the Metastatic Dissemination of Medulloblastoma Published OnlineFirst October 5, 2010; DOI: 10.1158/0008-5472.CAN-10-0592 Published OnlineFirst on October 5, 2010 as 10.1158/0008-5472.CAN-10-0592 Therapeutics, Targets, and Chemical Biology Cancer Research Role of LIM and SH3 Protein 1 (LASP1) in the Metastatic Dissemination of Medulloblastoma Christopher Traenka1, Marc Remke2,5, Andrey Korshunov4,6, Sebastian Bender2,5, Thomas Hielscher3, Paul A. Northcott7, Hendrik Witt2,5, Marina Ryzhova8, Jörg Felsberg9, Axel Benner3, Stephanie Riester2, Wolfram Scheurlen10, Thomas G.P. Grunewald11, Andreas von Deimling6, Andreas E. Kulozik5, Guido Reifenberger9, Michael D. Taylor7, Peter Lichter2, Elke Butt1, and Stefan M. Pfister2,5 Abstract Medulloblastoma is the most common malignant pediatric brain tumor and is one of the leading causes of cancer-related mortality in children. Treatment failure mainly occurs in children harboring metastatic tumors, which typically carry an isochromosome 17 or gain of 17q, a common hallmark of intermediate and high-risk medulloblastoma. Through mRNA expression profiling, we identified LIM and SH3 protein 1 (LASP1) as one of the most upregulated genes on chromosome 17q in tumors with 17q gain. In an independent validation cohort of 101 medulloblastoma samples, the abundance of LASP1 mRNA was significantly associated with 17q gain, metastatic dissemination, and unfavorable outcome. LASP1 protein expression was analyzed by immuno- histochemistry in a large cohort of patients (n = 207), and high protein expression levels were found to be strongly correlated with 17q gain, metastatic dissemination, and inferior overall and progression-free survival. In vitro experiments in medulloblastoma cell lines showed a strong reduction of cell migration, increased adhesion, and decreased proliferation upon LASP1 knockdown by small interfering RNA–mediated silencing, further indicating a functional role for LASP1 in the progression and metastatic dissemination of medullo- blastoma. Cancer Res; 70(20); 8003–14. ©2010 AACR. Introduction fluid cytology, is a powerful prognostic marker in medullo- blastoma (2, 3). Brain tumors and leukemias comprise the most common Molecular signaling pathways involved in the patho- cause of cancer-related mortality in children with medullo- genesis of standard-risk medulloblastoma such as the blastoma being the most common malignant brain tumor WNT and sonic hedgehog (SHH) signaling cascades are in this age group (1). The presence of leptomeningeal dissem- well-established (4–6), whereas the molecular biology ination at diagnosis detected either macroscopically by underlying intermediate and high-risk medulloblastoma craniospinal imaging or microscopically by cerebrospinal remains elusive. Aberrant activation of WNT signaling, typically caused by activating CTNNB1 mutations (and rarely APC or AXIN), followed by nuclear accumulation of CTNNB1 Authors' Affiliations: 1Institute of Clinical Biochemistry and Pathobiochemistry, protein as first described by Ellison and colleagues (7), is University of Wuerzburg, Wuerzburg, Germany; Divisions of 2Molecular now commonly accepted as the hallmark genetic event for Genetics and 3Biostatistics, 4Clinical Cooperation Unit Neuropathology, – German Cancer Research Center (DKFZ); Departments of 5Pediatric standard (or low) risk medulloblastoma (8 10). The WNT Oncology, Hematology & Immunology and 6Neuropathology, University subgroup of tumors may be cytogenetically identified by of Heidelberg, Heidelberg, Germany; 7Division of Neurosurgery, and Program the presence of monosomy 6, which is exclusively found in in Developmental and Stem Cell Biology, Hospital for Sick Children, Toronto, Ontario, Canada; 8NN Burdenko Neurosurgical Institute, Moscow, Russia; tumors of this subset (4, 6, 8, 11). A second distinct sub- 9Department of Neuropathology, Heinrich-Heine-University, Dusseldorf, group of standard-risk patients identified by transcriptome Germany; 10Cnopf'sche Kinderklinik, Nürnberg Children's Hospital, – Nuremberg, Germany; and 11Department of Pediatrics and Childrens' studies (4 6) is molecularly characterized by aberrant SHH Cancer Research Center, Klinikum rechts der Isar, Technische Universität activation, and is typically driven by underlying mutations München, Munich, Germany in key regulators of the pathway such as PTCH1 or SUFU Note: Supplementary data for this article are available at Cancer Research (12–14). Collectively, these two subgroups account for ap- Online (http://cancerres.aacrjournals.org/). proximately 35% to 40% of medulloblastomas. Significantly, C. Traenka and M. Remke contributed equally to this work. these subgroups typically lack chromosome 17 aberrations Corresponding Authors: Elke Butt, Grombuehlstr. 12, D-97080 Wuerzburg, (4, 5), which however is the most frequent cytogenetic event Germany. Phone: 49-9313-293630; Fax: 49-9318-8883174; E-mail: butt@ – klin-biochem.uni-wuerzburg.de or Stefan M. Pfister, Im Neuenheimer Feld in medulloblastoma (11, 15 17). 280, D-69120 Heidelberg, Germany. Phone: 49-6221-424593; Fax: 49- DNA copy number aberrations of chromosome 17, includ- 6221-424639; E-mail: [email protected]. ing deletion of 17p and gain of 17q, are typically found in the doi: 10.1158/0008-5472.CAN-10-0592 presence of isochromosome 17q (i17q), the hallmark cyto- ©2010 American Association for Cancer Research. genetic abnormality of high-risk medulloblastoma (4, 5, 11). www.aacrjournals.org 8003 Downloaded from cancerres.aacrjournals.org on September 30, 2021. © 2010 American Association for Cancer Research. Published OnlineFirst October 5, 2010; DOI: 10.1158/0008-5472.CAN-10-0592 Traenka et al. However, the driver gene(s) targeted by this cytogenetic Transcriptome analysis and microarray data analysis aberration remain unidentified. Expression profiling and microarray image analysis were We previously showed in a large cohort of patients carried out as outlined in Supplementary Materials and (n = 340) that isolated gain of chromosome 17q (without con- Methods. comitant loss of 17p as observed in i17q cases) is associated with a poor prognosis, whereas isolated 17p deletion is not cDNA synthesis and quantitative real-time PCR (11). We therefore decided to pursue the biological role of Oligo-d(t) primed cDNA synthesis of 1 μg total RNA was 17q gain in medulloblastoma. When investigating 28 pairs performed by using Superscript II Reverse Transcriptase of primary and recurrent tumors, we found that 5 out of 13 (Invitrogen) as described in the protocols of the manufacturer. tumors (38%), the primaries of which were characterized by a Each cDNA sample was analyzed in triplicate by quantitative balanced chromosome 17, showed acquired gain of 17q in real-time PCR on an ABI PRISM 7700 PCR System (Applied the relapsed tumors (18). These findings suggest that gain Biosystems) using ABsolute SYBR Green ROX Mix (ABgene) of chromosome 17q is a critically important aberration for according to the instructions of the manufacturer. Gene ex- medulloblastoma progression including metastatic dissemi- pression was normalized to three endogenous housekeeping nation in a large subset of these relapsed tumors. genes (SDHA, HPRT1,andLMNB1), which were constantly Prior attempts to identify medulloblastoma oncogenes in expressed in several expression experiments comparing sub- 17q have suggested ERBB2 (19), BIRC5 (20), and PPM1D (16). sets of primary medulloblastoma samples, medulloblastoma As none of these genes were highly ranked in our screening cell lines, and control tissues. Amplification of genomic DNA approach comparing medulloblastomas with 17q gain was excluded by intron-spanning primers and adequate test against 17q balanced tumors, we hypothesized that additional PCRs. Relative gene expression levels were calculated as candidate oncogenes in 17q should be considered. described by Pfaffl (27) with the adaptation of three used In the present study, we identified LASP1 as one of the most housekeeping genes. Primer sequences are available in differentially expressed and functionally relevant genes on 17q Supplementary Table S1. when comparing tumors with and without 17q copy number gains. The LIM and SH3 domain protein LASP1 (previously Fluorescence in situ hybridization named MLN50) was initially identified from a cDNA library Interphase fluorescence in situ hybridization analysis for of breast cancer metastases (21). LASP1 mRNA is detected chromosome 17 was performed on a medulloblastoma tissue ubiquitously at low basal levels in all normal human tissues microarray containing 207 tumor samples and 10 samples of (22), but the protein is highly overexpressed in more than nontumoral cerebellar tissues as controls (11). A commercial 55% of metastatic human breast cancer (23) and ovarian can- probe set delineating the loci of interest was used: 17p13.3/ cer (24). In a recent case control study, LASP1 expression in LIS1 (spectrum orange) and 17q21/RARA (spectrum green; mammary carcinomas correlated significantly with tumor size Vysis). Evaluation criteria and cutoffs were applied as and nodal positivity (25). The genomic locus of LASP1 at 17q12 described (11). is targeted by copy number gain or amplification in 20% to 30% of human breast cancers (26). Silencing of LASP1 by Immunohistochemistry RNA interference in various cell lines resulted in a strong A primary antibody to LASP1 (28) was applied at a concen- inhibition of cell migration and proliferation, with cell cycle tration of 10 μg/mL. Evaluation of immunostaining was per- arrest in G2-M phase (23, 24). These observations imply
Load more

Recommended publications
  • Mutations in CDK5RAP2 Cause Seckel Syndrome Go¨ Khan Yigit1,2,3,A, Karen E
    ORIGINAL ARTICLE Mutations in CDK5RAP2 cause Seckel syndrome Go¨ khan Yigit1,2,3,a, Karen E. Brown4,a,Hu¨ lya Kayserili5, Esther Pohl1,2,3, Almuth Caliebe6, Diana Zahnleiter7, Elisabeth Rosser8, Nina Bo¨ gershausen1,2,3, Zehra Oya Uyguner5, Umut Altunoglu5, Gudrun Nu¨ rnberg2,3,9, Peter Nu¨ rnberg2,3,9, Anita Rauch10, Yun Li1,2,3, Christian Thomas Thiel7 & Bernd Wollnik1,2,3 1Institute of Human Genetics, University of Cologne, Cologne, Germany 2Center for Molecular Medicine Cologne (CMMC), University of Cologne, Cologne, Germany 3Cologne Excellence Cluster on Cellular Stress Responses in Aging-Associated Diseases (CECAD), University of Cologne, Cologne, Germany 4Chromosome Biology Group, MRC Clinical Sciences Centre, Imperial College School of Medicine, Hammersmith Hospital, London, W12 0NN, UK 5Department of Medical Genetics, Istanbul Medical Faculty, Istanbul University, Istanbul, Turkey 6Institute of Human Genetics, Christian-Albrechts-University of Kiel, Kiel, Germany 7Institute of Human Genetics, Friedrich-Alexander University Erlangen-Nuremberg, Erlangen, Germany 8Department of Clinical Genetics, Great Ormond Street Hospital for Children, London, WC1N 3EH, UK 9Cologne Center for Genomics, University of Cologne, Cologne, Germany 10Institute of Medical Genetics, University of Zurich, Schwerzenbach-Zurich, Switzerland Keywords Abstract CDK5RAP2, CEP215, microcephaly, primordial dwarfism, Seckel syndrome Seckel syndrome is a heterogeneous, autosomal recessive disorder marked by pre- natal proportionate short stature, severe microcephaly, intellectual disability, and Correspondence characteristic facial features. Here, we describe the novel homozygous splice-site Bernd Wollnik, Center for Molecular mutations c.383+1G>C and c.4005-9A>GinCDK5RAP2 in two consanguineous Medicine Cologne (CMMC) and Institute of families with Seckel syndrome. CDK5RAP2 (CEP215) encodes a centrosomal pro- Human Genetics, University of Cologne, tein which is known to be essential for centrosomal cohesion and proper spindle Kerpener Str.
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • G Protein-Coupled Receptors
    G PROTEIN-COUPLED RECEPTORS Overview:- The completion of the Human Genome Project allowed the identification of a large family of proteins with a common motif of seven groups of 20-24 hydrophobic amino acids arranged as α-helices. Approximately 800 of these seven transmembrane (7TM) receptors have been identified of which over 300 are non-olfactory receptors (see Frederikson et al., 2003; Lagerstrom and Schioth, 2008). Subdivision on the basis of sequence homology allows the definition of rhodopsin, secretin, adhesion, glutamate and Frizzled receptor families. NC-IUPHAR recognizes Classes A, B, and C, which equate to the rhodopsin, secretin, and glutamate receptor families. The nomenclature of 7TM receptors is commonly used interchangeably with G protein-coupled receptors (GPCR), although the former nomenclature recognises signalling of 7TM receptors through pathways not involving G proteins. For example, adiponectin and membrane progestin receptors have some sequence homology to 7TM receptors but signal independently of G-proteins and appear to reside in membranes in an inverted fashion compared to conventional GPCR. Additionally, the NPR-C natriuretic peptide receptor has a single transmembrane domain structure, but appears to couple to G proteins to generate cellular responses. The 300+ non-olfactory GPCR are the targets for the majority of drugs in clinical usage (Overington et al., 2006), although only a minority of these receptors are exploited therapeutically. Signalling through GPCR is enacted by the activation of heterotrimeric GTP-binding proteins (G proteins), made up of α, β and γ subunits, where the α and βγ subunits are responsible for signalling. The α subunit (tabulated below) allows definition of one series of signalling cascades and allows grouping of GPCRs to suggest common cellular, tissue and behavioural responses.
    [Show full text]
  • (LASP1) in the Metastatic Dissemination of Medulloblastoma
    Published OnlineFirst October 5, 2010; DOI: 10.1158/0008-5472.CAN-10-0592 Published OnlineFirst on October 5, 2010 as 10.1158/0008-5472.CAN-10-0592 Therapeutics, Targets, and Chemical Biology Cancer Research Role of LIM and SH3 Protein 1 (LASP1) in the Metastatic Dissemination of Medulloblastoma Christopher Traenka1, Marc Remke2,5, Andrey Korshunov4,6, Sebastian Bender2,5, Thomas Hielscher3, Paul A. Northcott7, Hendrik Witt2,5, Marina Ryzhova8, Jörg Felsberg9, Axel Benner3, Stephanie Riester2, Wolfram Scheurlen10, Thomas G.P. Grunewald11, Andreas von Deimling6, Andreas E. Kulozik5, Guido Reifenberger9, Michael D. Taylor7, Peter Lichter2, Elke Butt1, and Stefan M. Pfister2,5 Abstract Medulloblastoma is the most common malignant pediatric brain tumor and is one of the leading causes of cancer-related mortality in children. Treatment failure mainly occurs in children harboring metastatic tumors, which typically carry an isochromosome 17 or gain of 17q, a common hallmark of intermediate and high-risk medulloblastoma. Through mRNA expression profiling, we identified LIM and SH3 protein 1 (LASP1) as one of the most upregulated genes on chromosome 17q in tumors with 17q gain. In an independent validation cohort of 101 medulloblastoma samples, the abundance of LASP1 mRNA was significantly associated with 17q gain, metastatic dissemination, and unfavorable outcome. LASP1 protein expression was analyzed by immuno- histochemistry in a large cohort of patients (n = 207), and high protein expression levels were found to be strongly correlated with 17q gain, metastatic dissemination, and inferior overall and progression-free survival. In vitro experiments in medulloblastoma cell lines showed a strong reduction of cell migration, increased adhesion, and decreased proliferation upon LASP1 knockdown by small interfering RNA–mediated silencing, further indicating a functional role for LASP1 in the progression and metastatic dissemination of medullo- blastoma.
    [Show full text]
  • A Dissertation Entitled Characterization of the CXCR4
    A Dissertation entitled Characterization of the CXCR4-LASP1-eIF4F Axis in Triple-Negative Breast Cancer by Cory M Howard Submitted to the Graduate Faculty as partial fulfillment of the requirements for the Doctor of Philosophy Degree in Biomedical Sciences ___________________________________________ Dayanidhi Raman, B.V.Sc., Ph.D., Committee Chair ___________________________________________ Amit Tiwari, Ph.D., Committee Member ___________________________________________ Ritu Chakravarti, Ph.D., Committee Member ___________________________________________ Nagalakshmi Nadiminty, Ph.D., Committee Member ___________________________________________ Saori Furuta, Ph.D., Committee Member ___________________________________________ Shi-He Liu, M.D., Committee Member ___________________________________________ Amanda C. Bryant-Friedrich, Ph.D., Dean College of Graduate Studies The University of Toledo August 2020 © 2020 Cory M. Howard This document is copyrighted material. Under copyright law, no parts of this document may be reproduced without the expressed permission of the author. An Abstract of Characterization of the CXCR4-LASP1-eIF4F Axis in Triple-Negative Breast Cancer by Cory M. Howard Submitted to the Graduate Faculty as partial fulfillment of the requirements for the Doctor of Philosophy Degree in Biomedical Sciences The University of Toledo August 2020 Triple-negative breast cancer (TNBC) remains clinically challenging as effective targeted therapies are still lacking. In addition, patient mortality mainly results from the metastasized
    [Show full text]
  • GNGT2 (NM 031498) Human Mass Spec Standard Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for PH303892 GNGT2 (NM_031498) Human Mass Spec Standard Product data: Product Type: Mass Spec Standards Description: GNGT2 MS Standard C13 and N15-labeled recombinant protein (NP_113686) Species: Human Expression Host: HEK293 Expression cDNA Clone RC203892 or AA Sequence: Predicted MW: 7.7 kDa Protein Sequence: >RC203892 protein sequence Red=Cloning site Green=Tags(s) MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS myc-FLAG tag Tag: C-Myc/DDK Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining Concentration: 50 ug/ml as determined by BCA Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. RefSeq: NP_113686 RefSeq Size: 1057 RefSeq ORF: 207 Synonyms: G-GAMMA-8; G-GAMMA-C; GNG9; GNGT8 Locus ID: 2793 UniProt ID: O14610 Cytogenetics: 17q21.32 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 GNGT2 (NM_031498) Human Mass Spec Standard – PH303892 Summary: Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. The encoded protein is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones.
    [Show full text]
  • Multi-Functionality of Proteins Involved in GPCR and G Protein Signaling: Making Sense of Structure–Function Continuum with In
    Cellular and Molecular Life Sciences (2019) 76:4461–4492 https://doi.org/10.1007/s00018-019-03276-1 Cellular andMolecular Life Sciences REVIEW Multi‑functionality of proteins involved in GPCR and G protein signaling: making sense of structure–function continuum with intrinsic disorder‑based proteoforms Alexander V. Fonin1 · April L. Darling2 · Irina M. Kuznetsova1 · Konstantin K. Turoverov1,3 · Vladimir N. Uversky2,4 Received: 5 August 2019 / Revised: 5 August 2019 / Accepted: 12 August 2019 / Published online: 19 August 2019 © Springer Nature Switzerland AG 2019 Abstract GPCR–G protein signaling system recognizes a multitude of extracellular ligands and triggers a variety of intracellular signal- ing cascades in response. In humans, this system includes more than 800 various GPCRs and a large set of heterotrimeric G proteins. Complexity of this system goes far beyond a multitude of pair-wise ligand–GPCR and GPCR–G protein interactions. In fact, one GPCR can recognize more than one extracellular signal and interact with more than one G protein. Furthermore, one ligand can activate more than one GPCR, and multiple GPCRs can couple to the same G protein. This defnes an intricate multifunctionality of this important signaling system. Here, we show that the multifunctionality of GPCR–G protein system represents an illustrative example of the protein structure–function continuum, where structures of the involved proteins represent a complex mosaic of diferently folded regions (foldons, non-foldons, unfoldons, semi-foldons, and inducible foldons). The functionality of resulting highly dynamic conformational ensembles is fne-tuned by various post-translational modifcations and alternative splicing, and such ensembles can undergo dramatic changes at interaction with their specifc partners.
    [Show full text]
  • The Role of Non-Coding Rnas in Uveal Melanoma
    cancers Review The Role of Non-Coding RNAs in Uveal Melanoma Manuel Bande 1,2,*, Daniel Fernandez-Diaz 1,2, Beatriz Fernandez-Marta 1, Cristina Rodriguez-Vidal 3, Nerea Lago-Baameiro 4, Paula Silva-Rodríguez 2,5, Laura Paniagua 6, María José Blanco-Teijeiro 1,2, María Pardo 2,4 and Antonio Piñeiro 1,2 1 Department of Ophthalmology, University Hospital of Santiago de Compostela, Ramon Baltar S/N, 15706 Santiago de Compostela, Spain; [email protected] (D.F.-D.); [email protected] (B.F.-M.); [email protected] (M.J.B.-T.); [email protected] (A.P.) 2 Tumores Intraoculares en el Adulto, Instituto de Investigación Sanitaria de Santiago (IDIS), 15706 Santiago de Compostela, Spain; [email protected] (P.S.-R.); [email protected] (M.P.) 3 Department of Ophthalmology, University Hospital of Cruces, Cruces Plaza, S/N, 48903 Barakaldo, Vizcaya, Spain; [email protected] 4 Grupo Obesidómica, Instituto de Investigación Sanitaria de Santiago (IDIS), 15706 Santiago de Compostela, Spain; [email protected] 5 Fundación Pública Galega de Medicina Xenómica, Clinical University Hospital, SERGAS, 15706 Santiago de Compostela, Spain 6 Department of Ophthalmology, University Hospital of Coruña, Praza Parrote, S/N, 15006 La Coruña, Spain; [email protected] * Correspondence: [email protected]; Tel.: +34-981951756; Fax: +34-981956189 Received: 13 September 2020; Accepted: 9 October 2020; Published: 12 October 2020 Simple Summary: The development of uveal melanoma is a multifactorial and multi-step process, in which abnormal gene expression plays a key role.
    [Show full text]
  • A System-Level, Molecular Evolutionary Analysis of Mam- Malian Phototransduction (Supplementary Material)
    A system-level, molecular evolutionary analysis of mam- malian phototransduction (supplementary material) Brandon M Invergo1 , Ludovica Montanucci∗1 , Hafid Laayouni1 and Jaume Bertranpetit1 1IBE-Institute of Evolutionary Biology (UPF-CSIC), CEXS-UPF-PRBB, Barcelona, Catalonia, Spain Email: Brandon Invergo - [email protected]; Ludovica Montanucci∗- [email protected]; Hafid Laayouni - hafi[email protected]; Jaume Bertranpetit - [email protected]; ∗Corresponding author Table S1 - Classifications of the genes Genes were assigned classifications according to their photoreceptor cell-type specificity, the process in which the encoded protein is primarily active, and the general function of the encoded protein. (Note: here "enzyme" specifically refers to enzymes involved in retinoid recycling.) 1 gene cell type process function ABCA4 shared retinoid cycle enzyme AIPL1 shared phototransduction other ARR3 cone phototransduction signal regulator ASCL1 rod development transcription regulation CNGA1 rod phototransduction ion channel CNGA3 cone phototransduction ion channel CNGB1 rod phototransduction ion channel CNGB3 cone phototransduction ion channel CRX shared development transcription regulation GNAT1 rod phototransduction G protein GNAT2 cone phototransduction G protein GNB1 rod phototransduction G protein GNB3 cone phototransduction G protein GNB5 shared phototransduction G protein GNGT1 rod phototransduction G protein GNGT2 cone phototransduction G protein GPSM2 shared phototransduction other GRK1 shared phototransduction
    [Show full text]
  • Neuroprotective Role of Intermittent Fasting in Senescence-Accelerated Mice P8 (SAMP8) M
    Neuroprotective role of intermittent fasting in senescence-accelerated mice P8 (SAMP8) M. Tajes, J. Gutierrez-Cuesta, J. Folch, D. Ortuño-Sahagun, E. Verdaguer, A. Jiménez, F. Junyent, A. Lau, A. Camins, M. Pallàs To cite this version: M. Tajes, J. Gutierrez-Cuesta, J. Folch, D. Ortuño-Sahagun, E. Verdaguer, et al.. Neuroprotective role of intermittent fasting in senescence-accelerated mice P8 (SAMP8). Experimental Gerontology, Elsevier, 2010, 45 (9), pp.702. 10.1016/j.exger.2010.04.010. hal-00615111 HAL Id: hal-00615111 https://hal.archives-ouvertes.fr/hal-00615111 Submitted on 18 Aug 2011 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. ÔØ ÅÒÙ×Ö ÔØ Neuroprotective role of intermittent fasting in senescence-accelerated mice P8 (SAMP8) M. Tajes, J. Gutierrez-Cuesta, J. Folch, D. Ortu˜no-Sahagun, E. Verda- guer, A. Jim´enez,F. Junyent, A. Lau, A. Camins, M. Pall`as PII: S0531-5565(10)00188-9 DOI: doi: 10.1016/j.exger.2010.04.010 Reference: EXG 8747 To appear in: Experimental Gerontology Received date: 25 December 2009 Revised date: 23 April 2010 Accepted date: 29 April 2010 Please cite this article as: Tajes, M., Gutierrez-Cuesta, J., Folch, J., Ortu˜no-Sahagun, D., Verdaguer, E., Jim´enez, A., Junyent, F., Lau, A., Camins, A., Pall`as, M., Neuroprotec- tive role of intermittent fasting in senescence-accelerated mice P8 (SAMP8), Experimental Gerontology (2010), doi: 10.1016/j.exger.2010.04.010 This is a PDF file of an unedited manuscript that has been accepted for publication.
    [Show full text]
  • Phosphorylation-Dependent Differences in CXCR4-LASP1
    cells Article Phosphorylation-Dependent Differences in CXCR4-LASP1-AKT1 Interaction between Breast Cancer and Chronic Myeloid Leukemia Elke Butt 1,*, Katrin Stempfle 1, Lorenz Lister 1, Felix Wolf 1,2, Marcella Kraft 1, Andreas B. Herrmann 1 , Cristina Perpina Viciano 2,3, Christian Weber 4,5,6 , Andreas Hochhaus 7, Thomas Ernst 7, Carsten Hoffmann 2,3, Alma Zernecke 1 and Jochen J. Frietsch 7 1 Institute of Experimental Biomedicine, University Hospital Wuerzburg, Josef-Schneider-Straße 2, 97080 Wuerzburg, Germany; katrin.stempfl[email protected] (K.S.); [email protected] (L.L.); [email protected] (F.W.); [email protected] (M.K.); [email protected] (A.B.H.); [email protected] (A.Z.) 2 Institute of Molecular Cell Biology, CMB-Center for Molecular Biomedicine, University Hospital Jena, Hans-Knöll-Straße 2, 07745 Jena, Germany; [email protected] (C.P.V.); Carsten.Hoff[email protected] (C.H.) 3 Rudolf Virchow Center for Experimental Biomedicine, University of Wuerzburg, Josef-Schneider-Str. 5, 97080 Wuerzburg, Germany 4 Institute for Cardiovascular Prevention, LMU Munich, 80336 Munich, Germany; ipek.offi[email protected] 5 Cardiovascular Research Institute Maastricht, Department of Biochemistry, Maastricht University, 6229 ER Maastricht, The Netherlands 6 DZHK (German Centre for Cardiovascular Research), partner site Munich Heart Alliance, 80802 Munich, Germany 7 Klinik für Innere Medizin II, Abteilung für Hämatologie und internistische Onkologie, Universitätsklinikum Jena, Am Klinikum 1, 07747 Jena, Germany; [email protected] (A.H.); [email protected] (T.E.); [email protected] (J.J.F.) * Correspondence: [email protected] Received: 3 December 2019; Accepted: 11 February 2020; Published: 14 February 2020 Abstract: The serine/threonine protein kinase AKT1 is a downstream target of the chemokine receptor 4 (CXCR4), and both proteins play a central role in the modulation of diverse cellular processes, including proliferation and cell survival.
    [Show full text]
  • Network Pharmacology of JAK Inhibitors
    Network pharmacology of JAK inhibitors Devapregasan Moodleya, Hideyuki Yoshidaa, Sara Mostafavib,c, Natasha Asinovskia, Adriana Ortiz-Lopeza, Peter Symanowiczd, Jean-Baptiste Telliezd, Martin Hegend, James D. Clarkd, Diane Mathisa,1, and Christophe Benoista,1 aDivision of Immunology, Department of Microbiology and Immunobiology, Harvard Medical School, Boston, MA 02115; bDepartment of Statistics, University of British Columbia, Vancouver, BC, Canada V6T 1Z4; cDepartment of Medical Genetics, University of British Columbia, Vancouver, BC, Canada V6T 1Z4; and dInflammation and Immunology, Pfizer, Cambridge, MA 02139 Contributed by Christophe Benoist, June 24, 2016 (sent for review April 27, 2016; reviewed by Tadatsugu Taniguchi and Arthur Weiss) Small-molecule inhibitors of the Janus kinase family (JAKis) are side effects that likely reflect cytokine blockade, such as bacterial clinically efficacious in multiple autoimmune diseases, albeit with and fungal infections, in particular, (re)activation of the varicella increased risk of certain infections. Their precise mechanism of action zoster virus, and at high doses, anemia and thrombocytopenia (2, 3). is unclear, with JAKs being signaling hubs for several cytokines. We A new JAKi generation targets single JAK isoforms, which might assessed the in vivo impact of pan- and isoform-specific JAKi in mice improve adverse events by restricting the range of activity. Efficacy by immunologic and genomic profiling. Effects were broad across has been observed with JAK1-selective compounds (7) and com- the immunogenomic network, with overlap between inhibitors. Nat- pounds of reported specificity for JAK3 (ref. 8, but see ref. 2). ural killer (NK) cell and macrophage homeostasis were most imme- However, the premise of substantially improved in vivo specificity diately perturbed, with network-level analysis revealing a rewiring remains unproven, because the impact of JAKi compounds on the of coregulated modules of NK cell transcripts.
    [Show full text]