MDC1 antibody - C-terminal region (ARP36798_P050) Data Sheet
Product Number ARP36798_P050 Product Name MDC1 antibody - C-terminal region (ARP36798_P050) Size 50ug Gene Symbol MDC1 Alias Symbols DKFZp781A0122; KIAA0170; MGC166888; NFBD1 Nucleotide Accession# NM_014641 Protein Size (# AA) 2089 amino acids Molecular Weight 227kDa Product Format Lyophilized powder NCBI Gene Id 9656 Host Rabbit Clonality Polyclonal Official Gene Full Name Mediator of DNA-damage checkpoint 1 This is a rabbit polyclonal antibody against MDC1. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 Description products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: GKEEDVVTPKPGKRKRDQAEEEPNRIPSRSLRRTKLNQESTAPKVLFTGV The protein encoded by this gene contains an N-terminal forkhead domain, two BRCA1 C-terminal (BRCT) motifs and a central domain with 13 repetitions of an approximately 41-amino acid sequence. The encoded Description of Target protein is required to activate the intra-S phase and G2/M phase cell cycle checkpoints in response to DNA damage. This nuclear protein interacts with phosphorylated histone H2AX near sites of DNA double-strand breaks through its BRCT motifs, and facilitates recruitment of the ATM kinase and meiotic recombination 11 protein complex to DNA damage foci. ATM, BARD1, BRCA1, CHEK2, CREBBP, EP300, H2AFX, MDC1, NBN, SMC1A, TP53, TP53BP1, USP28, Partner Proteins ATM, BANF1, BRCA1, CENPC1, CHEK2, GATA4, H2AFX, HDAC10, HDAC8, MCPH1, MDM2, MRE11A, NBN, POLR2A, RAD50, RAD51, SUMO2, TP53, TP53BP1, UBC, USP28, WRN Reconstitution and Add 50 ul of distilled water. Final anti-MDC1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. Storage For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Lead Time Domestic: within 24 hours delivery International: 3-5 business days Blocking Peptide For anti-MDC1 antibody is Catalog # AAP36798 (Previous Catalog # AAPP08672) Immunogen The immunogen for anti-MDC1 antibody: synthetic peptide directed towards the C terminal of human MDC1 Swissprot Id Q14676 Protein Name Mediator of DNA damage checkpoint protein 1 Sample Type Confirmation MDC1 is strongly supported by BioGPS gene expression data to be expressed in HepG2 Protein Accession # NP_055456 Purification Affinity Purified Species Reactivity Human, Guinea pig, Dog Application WB Predicted Homology Based on Immunogen Human: 100%; Pig: 92%; Guinea pig: 92%; Dog: 86% Sequence
Human HepG2
WB Suggested Anti-MDC1 Antibody Titration: 0.2- 1 ug/ml ELISA Titer: 1:12500 ELISA Titer: 1:12500 Positive Control: HepG2 cell lysate MDC1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 Image 1 cells
______
This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users.