ZNF41 Antibody (N-Term) Blocking Peptide Synthetic Peptide Catalog # Bp17581a

Total Page：16

File Type：pdf, Size：1020Kb

ZNF41 Antibody (N-Term) Blocking Peptide Synthetic Peptide Catalog # Bp17581a

10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 ZNF41 Antibody (N-term) Blocking Peptide Synthetic peptide Catalog # BP17581a Specification ZNF41 Antibody (N-term) Blocking Peptide ZNF41 Antibody (N-term) Blocking Peptide - - Background Product Information This gene product is a likely zinc finger Primary Accession P51814 familytranscription factor. It contains KRAB-A and KRAB-B domains thatact as transcriptional repressors in related proteins, and multiplezinc ZNF41 Antibody (N-term) Blocking Peptide - Additional Information finger DNA binding motifs and finger linking regionscharacteristic of the Kruppel family. This gene is part of a genecluster on Gene ID 7592 chromosome Xp11.23. Several alternatively splicedtranscript variants have been described, Other Names however, the full-lengthnature of only some of Zinc finger protein 41, ZNF41 them is known. Format ZNF41 Antibody (N-term) Blocking Peptide Peptides are lyophilized in a solid powder format. Peptides can be reconstituted in - References solution using the appropriate buffer as needed. Ross, M.T., et al. Nature 434(7031):325-337(2005)Colland, F., et al. Storage Genome Res. 14(7):1324-1332(2004)Shoichet, Maintain refrigerated at 2-8°C for up to 6 S.A., et al. Am. J. Hum. Genet. months. For long term storage store at 73(6):1341-1354(2003)Rosati, M., et al. -20°C. Cytogenet. Cell Genet. 85 (3-4), 291-296 (1999) :Knight, J.C., et al. Genomics Precautions 21(1):180-187(1994) This product is for research use only. Not for use in diagnostic or therapeutic procedures. ZNF41 Antibody (N-term) Blocking Peptide - Protein Information Name ZNF41 Function May be involved in transcriptional regulation. Cellular Location Nucleus. Tissue Location Expressed in the heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas Page 1/2 10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 ZNF41 Antibody (N-term) Blocking Peptide - Protocols Provided below are standard protocols that you may find useful for product applications. • Blocking Peptides Page 2/2 Powered by TCPDF (www.tcpdf.org).

Copy Link

Recommended publications

A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
[Show full text]
Supplemental Materials ZNF281 Enhances Cardiac Reprogramming
Supplemental Materials ZNF281 enhances cardiac reprogramming by modulating cardiac and inflammatory gene expression Huanyu Zhou, Maria Gabriela Morales, Hisayuki Hashimoto, Matthew E. Dickson, Kunhua Song, Wenduo Ye, Min S. Kim, Hanspeter Niederstrasser, Zhaoning Wang, Beibei Chen, Bruce A. Posner, Rhonda Bassel-Duby and Eric N. Olson Supplemental Table 1; related to Figure 1. Supplemental Table 2; related to Figure 1. Supplemental Table 3; related to the “quantitative mRNA measurement” in Materials and Methods section. Supplemental Table 4; related to the “ChIP-seq, gene ontology and pathway analysis” and “RNA-seq” and gene ontology analysis” in Materials and Methods section. Supplemental Figure S1; related to Figure 1. Supplemental Figure S2; related to Figure 2. Supplemental Figure S3; related to Figure 3. Supplemental Figure S4; related to Figure 4. Supplemental Figure S5; related to Figure 6. Supplemental Table S1. Genes included in human retroviral ORF cDNA library. Gene Gene Gene Gene Gene Gene Gene Gene Symbol Symbol Symbol Symbol Symbol Symbol Symbol Symbol AATF BMP8A CEBPE CTNNB1 ESR2 GDF3 HOXA5 IL17D ADIPOQ BRPF1 CEBPG CUX1 ESRRA GDF6 HOXA6 IL17F ADNP BRPF3 CERS1 CX3CL1 ETS1 GIN1 HOXA7 IL18 AEBP1 BUD31 CERS2 CXCL10 ETS2 GLIS3 HOXB1 IL19 AFF4 C17ORF77 CERS4 CXCL11 ETV3 GMEB1 HOXB13 IL1A AHR C1QTNF4 CFL2 CXCL12 ETV7 GPBP1 HOXB5 IL1B AIMP1 C21ORF66 CHIA CXCL13 FAM3B GPER HOXB6 IL1F3 ALS2CR8 CBFA2T2 CIR1 CXCL14 FAM3D GPI HOXB7 IL1F5 ALX1 CBFA2T3 CITED1 CXCL16 FASLG GREM1 HOXB9 IL1F6 ARGFX CBFB CITED2 CXCL3 FBLN1 GREM2 HOXC4 IL1F7
[Show full text]
Supplementary Table S4. FGA Co-Expressed Gene List in LUAD
Supplementary Table S4. FGA co-expressed gene list in LUAD tumors Symbol R Locus Description FGG 0.919 4q28 fibrinogen gamma chain FGL1 0.635 8p22 fibrinogen-like 1 SLC7A2 0.536 8p22 solute carrier family 7 (cationic amino acid transporter, y+ system), member 2 DUSP4 0.521 8p12-p11 dual specificity phosphatase 4 HAL 0.51 12q22-q24.1histidine ammonia-lyase PDE4D 0.499 5q12 phosphodiesterase 4D, cAMP-specific FURIN 0.497 15q26.1 furin (paired basic amino acid cleaving enzyme) CPS1 0.49 2q35 carbamoyl-phosphate synthase 1, mitochondrial TESC 0.478 12q24.22 tescalcin INHA 0.465 2q35 inhibin, alpha S100P 0.461 4p16 S100 calcium binding protein P VPS37A 0.447 8p22 vacuolar protein sorting 37 homolog A (S. cerevisiae) SLC16A14 0.447 2q36.3 solute carrier family 16, member 14 PPARGC1A 0.443 4p15.1 peroxisome proliferator-activated receptor gamma, coactivator 1 alpha SIK1 0.435 21q22.3 salt-inducible kinase 1 IRS2 0.434 13q34 insulin receptor substrate 2 RND1 0.433 12q12 Rho family GTPase 1 HGD 0.433 3q13.33 homogentisate 1,2-dioxygenase PTP4A1 0.432 6q12 protein tyrosine phosphatase type IVA, member 1 C8orf4 0.428 8p11.2 chromosome 8 open reading frame 4 DDC 0.427 7p12.2 dopa decarboxylase (aromatic L-amino acid decarboxylase) TACC2 0.427 10q26 transforming, acidic coiled-coil containing protein 2 MUC13 0.422 3q21.2 mucin 13, cell surface associated C5 0.412 9q33-q34 complement component 5 NR4A2 0.412 2q22-q23 nuclear receptor subfamily 4, group A, member 2 EYS 0.411 6q12 eyes shut homolog (Drosophila) GPX2 0.406 14q24.1 glutathione peroxidase
[Show full text]
Mutations in the ZNF41 Gene Are Associated with Cognitive Deficits
Am. J. Hum. Genet. 73:1341–1354, 2003 Mutations in the ZNF41 Gene Are Associated with Cognitive Deficits: Identification of a New Candidate for X-Linked Mental Retardation Sarah A. Shoichet,1 Kirsten Hoffmann,1 Corinna Menzel,1 Udo Trautmann,2 Bettina Moser,1 Maria Hoeltzenbein,1 Bernard Echenne,3 Michael Partington,4 Hans van Bokhoven,5 Claude Moraine,6 Jean-Pierre Fryns,7 Jamel Chelly,8 Hans-Dieter Rott,2 Hans-Hilger Ropers,1 and Vera M. Kalscheuer1 1Max-Planck-Institute for Molecular Genetics, Berlin; 2Institute of Human Genetics, University of Erlangen-Nuremberg, Erlangen-Nuremberg; 3Centre Hospitalier Universitaire de Montpellier, Hoˆpital Saint-Eloi, Montpellier, France, 4Hunter Genetics and University of Newcastle, Waratah, Australia; 5Department of Human Genetics, University Medical Centre, Nijmegen, The Netherlands; 6Services de Geńe´tique–INSERM U316, CHU Bretonneau, Tours, France; 7Center for Human Genetics, Clinical Genetics Unit, Leuven, Belgium; and 8Institut Cochin de Geńe´tique Moleculaire, Centre National de la Recherche Scientifique/INSERM, CHU Cochin, Paris Nonsyndromic X-linked mental retardation (MRX) is defined by an X-linked inheritance pattern of low IQ, problems with adaptive behavior, and the absence of additional specific clinical features. The 13 MRX genes identified to date account for less than one-fifth of all MRX, suggesting that numerous gene defects cause the disorder in other families. In a female patient with severe nonsyndromic mental retardation and a de novo balanced translocation t(X;7)(p11.3;q11.21), we have cloned the DNA fragment that contains the X-chromosomal and the autosomal break- point. In silico sequence analysis provided no indication of a causative role for the chromosome 7 breakpoint in mental retardation (MR), whereas, on the X chromosome, a zinc-finger gene, ZNF41, was found to be disrupted.
[Show full text]
Supplementary Material Contents
Supplementary Material Contents Immune modulating proteins identified from exosomal samples.....................................................................2 Figure S1: Overlap between exosomal and soluble proteomes.................................................................................... 4 Bacterial strains:..............................................................................................................................................4 Figure S2: Variability between subjects of effects of exosomes on BL21-lux growth.................................................... 5 Figure S3: Early effects of exosomes on growth of BL21 E. coli .................................................................................... 5 Figure S4: Exosomal Lysis............................................................................................................................................ 6 Figure S5: Effect of pH on exosomal action.................................................................................................................. 7 Figure S6: Effect of exosomes on growth of UPEC (pH = 6.5) suspended in exosome-depleted urine supernatant ....... 8 Effective exosomal concentration....................................................................................................................8 Figure S7: Sample constitution for luminometry experiments..................................................................................... 8 Figure S8: Determining effective concentration .........................................................................................................
[Show full text]
Generic Injuries Are Sufficient to Induce Ectopic Wnt Organizers in Hydra Jack F Cazet, Adrienne Cho, Celina E Juliano*
RESEARCH ARTICLE Generic injuries are sufficient to induce ectopic Wnt organizers in Hydra Jack F Cazet, Adrienne Cho, Celina E Juliano* Department of Molecular and Cellular Biology, University of California, Davis, Davis, United States Abstract During whole-body regeneration, a bisection injury can trigger two different types of regeneration. To understand the transcriptional regulation underlying this adaptive response, we characterized transcript abundance and chromatin accessibility during oral and aboral regeneration in the cnidarian Hydra vulgaris. We found that the initial response to amputation at both wound sites is identical and includes widespread apoptosis and the activation of the oral-specifying Wnt signaling pathway. By 8 hr post amputation, Wnt signaling became restricted to oral regeneration. Wnt pathway genes were also upregulated in puncture wounds, and these wounds induced the formation of ectopic oral structures if pre-existing organizers were simultaneously amputated. Our work suggests that oral patterning is activated as part of a generic injury response in Hydra, and that alternative injury outcomes are dependent on signals from the surrounding tissue. Furthermore, Wnt signaling is likely part of a conserved wound response predating the split of cnidarians and bilaterians. Introduction Regeneration is an injury-induced morphogenetic process that enables the restoration of lost or damaged body parts. Although nearly all animals are capable of some form of regeneration, the greatest regenerative capacity is found in the invertebrate species capable of rebuilding their entire *For correspondence: body from small tissue fragments through a process called whole-body regeneration. In these highly [email protected] regenerative systems, amputation injuries trigger morphogenesis on both sides of the amputation plane, leading to the reconstruction of all missing body parts.
[Show full text]
Epigenetic Mechanisms Are Involved in the Oncogenic Properties of ZNF518B in Colorectal Cancer
Epigenetic mechanisms are involved in the oncogenic properties of ZNF518B in colorectal cancer Francisco Gimeno-Valiente, Ángela L. Riffo-Campos, Luis Torres, Noelia Tarazona, Valentina Gambardella, Andrés Cervantes, Gerardo López-Rodas, Luis Franco and Josefa Castillo SUPPLEMENTARY METHODS 1. Selection of genomic sequences for ChIP analysis To select the sequences for ChIP analysis in the five putative target genes, namely, PADI3, ZDHHC2, RGS4, EFNA5 and KAT2B, the genomic region corresponding to the gene was downloaded from Ensembl. Then, zoom was applied to see in detail the promoter, enhancers and regulatory sequences. The details for HCT116 cells were then recovered and the target sequences for factor binding examined. Obviously, there are not data for ZNF518B, but special attention was paid to the target sequences of other zinc-finger containing factors. Finally, the regions that may putatively bind ZNF518B were selected and primers defining amplicons spanning such sequences were searched out. Supplementary Figure S3 gives the location of the amplicons used in each gene. 2. Obtaining the raw data and generating the BAM files for in silico analysis of the effects of EHMT2 and EZH2 silencing The data of siEZH2 (SRR6384524), siG9a (SRR6384526) and siNon-target (SRR6384521) in HCT116 cell line, were downloaded from SRA (Bioproject PRJNA422822, https://www.ncbi. nlm.nih.gov/bioproject/), using SRA-tolkit (https://ncbi.github.io/sra-tools/). All data correspond to RNAseq single end. doBasics = TRUE doAll = FALSE $ fastq-dump -I --split-files SRR6384524 Data quality was checked using the software fastqc (https://www.bioinformatics.babraham. ac.uk /projects/fastqc/). The first low quality removing nucleotides were removed using FASTX- Toolkit (http://hannonlab.cshl.edu/fastxtoolkit/).
[Show full text]
Supp Data.Pdf
Supplementary Methods Verhaak sub-classification The Verhaak called tumor subtype was assigned as determined in the Verhaak et al. manuscript, for those TCGA tumors that were included at the time. TCGA data for expression (Affymetrix platform, level 1) and methylation (Infinium platform level 3) were downloaded from the TCGA portal on 09/29/2011. Affymetrix data were processed using R and Biocondutor with a RMA algorithm using quantile normalization and custom CDF. Level 3 methylation data has already been processed and converted to a beta-value. The genes that make up the signature for each of the 4 Verhaak groups (i.e. Proneural, Neural, Mesenchymal, and Classical) were downloaded. For each tumor, the averaged expression of the 4 genes signatures was calculated generating 4 ‘metagene’ scores, one for each subtype, (Colman et al.2010) for every tumor. Then each subtype metagene score was z-score corrected to allow comparison among the 4 metagenes. Finally, for each tumor the subtype with the highest metagene z-score among the four was used to assign subtype. Thus by this method, a tumor is assigned to the group to which it has the strongest expression signature. The shortcoming is that if a tumor has a ‘dual personality’ – for instance has strong expression of both classical and mesenchymal signature genes, there is some arbitrariness to the tumor’s assignment. Western Blot Analysis and cell fractionation Western blot analysis was performed using standard protocols. To determine protein expression we used the following antibodies: TAZ (Sigma and BD Biosciences), YAP (Santa Cruz Biotechnology), CD44 (Cell Signaling), FN1 (BD Biosciences), TEAD1, TEAD2, TEAD3, TEAD4 (Santa Cruz Biotechnology), MST1, p-MST1, MOB1, LATS1, LATS2, 14-3-3-, 1 ACTG2, (Cell Signaling), p-LATS1/2 (Abcam), Flag (Sigma Aldrich), Actin (Calbiochem), CAV2 (BD Biosciences), CTGF (Santa Cruz), RUNX2 (Sigma Aldrich), Cylin A, Cyclin E, Cyclin B1, p-cdk1, p-cdk4 (Cell Signaling Technologies).
[Show full text]
Molecular Basis for Intellectual Disability and Epilepsy: Role of the Human Homeobox Gene ARX
I , I l¡ \-lN I ìo Molecular Basis for Intellectual Disability and Epilepsy: Role of the Human Homeobox Gene ARX A thesis submitted for the degree of Doctor of Philosophy to the University of Adelaide by Desiree Cloosterman BSc (Hons) school of Medicine, Department of Paediatrics, university of Adelaide November 2005 ll ,rlf the human brain were so simple that we coultl understønd it, we woukl be so simple thøt we couldn't" Emerson M. Pugh lll CONTENTS Summary IV Statement and Declaration v vl Acknowledgements..--- ------ --- List of Abbreviations vlll CHAPTER I Introduction-----------.-- 1 CHAPTER 2 Materials and Methods- 43 CHAPTER 3 Conservation of ARX. _.__-_._.1 10 CHAPTER 4 Yeast Two-Hybrid Screening __-_--_ I 33 CHAPTER 5 Confirmation of Y2H Interactions 176 CHAPTER 6 ZebrafishKnockdown Model------.- 203 CHAPTER 7 Conclusions 237 References lv SUMMARY Mental retardation (MR) is estimated to affect 2-3Yo of the population and is caused by both environmental and genetic factors. Mutations in Ihe Aristaless-related homeobox gene (AR$ have been found in numerous families with X-linked MR with and without other clinical features including infantile spasms, dystonia, lissencephaly, autism and dysarthria. The aim of this study was to investigate the normal function of the ARX protein within a cellular environment and in development. Discernment of ARX function will improve our understanding about the molecular pathology of intellectual disability and epilepsy, as well as improve our knowledge of the genes and mechanisms required for normal brain development. The first part of the thesis addressed the conservation of ARX domains and polyalanine regions by the identification and analysis of characterized and novel ARX orthologs.
[Show full text]
Molecular Genetics of Epilepsy and Mental Retardation Limited to Females (EFMR)
Molecular Genetics of Epilepsy and Mental Retardation Limited to Females (EFMR) A thesis submitted for the degree of Doctor of Philosophy to the University of Adelaide By Kim Hynes School of Molecular and Biomedical Science, Division of Genetics, University of Adelaide December 2009 References Abrahams, B. S. & Geschwind, D. H. (2008) Advances in autism genetics: on the threshold of a new neurobiology. Nat Rev Genet, 9, 341-55. Abranches, E., Silva, M., Pradier, L., Schulz, H., Hummel, O., Henrique, D. & Bekman, E. (2009) Neural differentiation of embryonic stem cells in vitro: a road map to neurogenesis in the embryo. PLoS One, 4, e6286. Ahmed, Z. M., Riazuddin, S., Aye, S., Ali, R. A., Venselaar, H., Anwar, S., Belyantseva, P. P., Qasim, M. & Friedman, T. B. (2008) Gene structure and mutant alleles of PCDH15: nonsyndromic deafness DFNB23 and type 1 Usher syndrome. Hum Genet, 124, 215-23. Ahmed, Z. M., Riazuddin, S., Bernstein, S. L., Ahmed, Z., Khan, S., Griffith, A. J., Morell, R. J., Friedman, T. B. & Wilcox, E. R. (2001) Mutations of the protocadherin gene PCDH15 cause Usher syndrome type 1F. Am J Hum Genet, 69, 25-34. Alagramam, K. N., Yuan, H., Kuehn, M. H., Murcia, C. L., Wayne, S., Srisailpathy, C. R., Lowry, R. B., Knaus, R., Van Laer, L., Bernier, F. P., Schwartz, S., Lee, C., Morton, C. C., Mullins, R. F., Ramesh, A., Van Camp, G., Hageman, G. S., Woychik, R. P. & Smith, R. J. (2001) Mutations in the novel protocadherin PCDH15 cause Usher syndrome type 1F. Hum Mol Genet, 10, 1709-18. Amir, R.
[Show full text]
ZNF41 Monoclonal Antibody (M02), Clone 4D6
ZNF41 monoclonal antibody (M02), clone 4D6 Catalog # : H00007592-M02 規格 : [ 100 ug ] List All Specification Application Image Product Mouse monoclonal antibody raised against a partial recombinant Western Blot (Transfected lysate) Description: ZNF41. Immunogen: ZNF41 (NP_009061, 221 a.a. ~ 321 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: GNNFPHSPSSTKNENAKTGANSCEHDHYEKHLSHKQAPTHHQKIHPEEKL YVCTECVMGFTQKSHLFEHQRIHAGEKSRECDKSNKVFPQKPQVDVHP SV* enlarge Western Blot (Recombinant Host: Mouse protein) Reactivity: Human ELISA Isotype: IgG1 Kappa Quality Control Antibody Reactive Against Recombinant Protein. Testing: Western Blot detection against Immunogen (37.11 KDa) . Storage Buffer: In 1x PBS, pH 7.4 Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction: MSDS: Download Datasheet: Download Applications Western Blot (Transfected lysate) Page 1 of 2 2016/5/22 Western Blot analysis of ZNF41 expression in transfected 293T cell line by ZNF41 monoclonal antibody (M02), clone 4D6. Lane 1: ZNF41 transfected lysate (Predicted MW: 89.1 KDa). Lane 2: Non-transfected lysate. Protocol Download Western Blot (Recombinant protein) Protocol Download ELISA Gene Information Entrez GeneID: 7592 GeneBank NM_007130 Accession#: Protein NP_009061 Accession#: Gene Name: ZNF41 Gene Alias: MGC8941,MRX89 Gene zinc finger protein 41 Description: Omim ID: 314995 Gene Ontology: Hyperlink Gene Summary: This gene product is a likely zinc finger family transcription factor. It contains KRAB-A and KRAB-B domains that act as transcriptional repressors in related proteins, and multiple zinc finger DNA binding motifs and finger linking regions characteristic of the Kruppel family. This gene is part of a gene cluster on chromosome Xp11.23. Several alternatively spliced transcript variants have been described, however, the full-length nature of only some of them is known.
[Show full text]
Preview of “Supplement Table S4.Xls”
Annotations for all recurrently lost regions cytoband 1p36.12 3p14.2 3q13.13 q value 0,01352 0,1513 0,085307 residual q value 0,01352 0,1513 0,085307 wide peak boundaries chr1:23457835-23714048 chr3:60396160-60637030 chr3:110456383-110657226 genes in wide peak E2F2 FHIT DPPA4 ID3 DPPA2 TCEA3 DDEFL1 TBC1D19 PI4K2B STIM2 GBA3 KCNIP4 DKFZp761B107 C4orf28 GPR125 FLJ45721 hsa-mir-218-1 CXCL3 GRSF1 HNRPD HTN1 HTN3 IBSP IGFBP7 IGJ IL8 CXCL10 KDR CXCL9 AFF1 MUC7 NKX6-1 PF4 PF4V1 PKD2 POLR2B PPEF2 PPAT PPBP PRKG2 MAPK10 PTPN13 REST CXCL6 CXCL11 CXCL5 SPINK2 SPP1 SRP72 STATH SULT1E1 UGT2B4 UGT2B7 UGT2B10 UGT2B15 UGT2B17 SPARCL1 VDP SLC4A4 HERC3 GENX-3414 CDKL2 TMPRSS11D ABCG2 ADAMTS3 CLOCK CEP135 G3BP2 HNRPDL ENAM FAM13A1 CXCL13 PAICS UGT2B11 HPSE NMU SMR3B NPFFR2 UGT2A1 CCNI hsa-mir-491 hsa-mir-31 4p15.32 4q13.1 4q13.1 (continued) 6q14.1 0,14888 0,17878 0,093693 0,14888 0,17878 0,093693 chr4:17969802-29966659 chr4:55756035-90966136 chr6:76830186-107898353 CCKAR AFM SEC31A AIM1 DHX15 AFP RUFY3 BCKDHB RBPSUH ALB WDFY3 PRDM1 SOD3 AMBN LPHN3 CCNC SLIT2 ANXA3 DKFZP564O0823 CGA SLC34A2 AREG RCHY1 CNR1 PPARGC1A ART3 ANKRD17 EPHA7 KIAA0746 BMP3 BRDG1 GABRR1 ANAPC4 BTC SMR3A GABRR2 SLA/LP CCNG2 ASAHL GRIK2 LGI2 SCARB2 COQ2 HTR1B TBC1D19 CDS1 SULT1B1 HTR1E PI4K2B CENPC1 TMPRSS11E IMPG1 STIM2 CSN1S1 MRPS18C ME1 GBA3 CSN2 COPS4 NT5E KCNIP4 CSN3 HSD17B11 PGM3 DKFZp761B107 DCK HERC5 POU3F2 C4orf28 DMP1 PLAC8 PREP GPR125 DSPP NUDT9 SIM1 FLJ45721 EPHA5 NUP54 ELOVL4 hsa-mir-218-1 EREG UGT2B28 MAP3K7 FGF5 ODAM TPBG GC HERC6 TTK GK2 SDAD1 RNGTT GNRHR UBE1L2 TBX18
[Show full text]