DOCSLIB.ORG

The Role of Nanos3 in Tumor Progression

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
The Role of Nanos3 in Tumor Progression The role of Nanos3 in tumor progression Evi De Keuckelaere Thesis submitted in partial fulfillment of the requirements for the degree of Doctor of Science: Biochemistry and Biotechnology 2017-2018 Promoters: Prof. Dr. em. Frans Van Roy and Prof. Dr. Geert Berx The research described in this doctoral thesis was performed at the Department of Biomedical Molecular Biology, Faculty of Sciences, Ghent University, and at the Inflammation Research Center (IRC), Flanders Institute for Biotechnology (VIB). Evi De Keuckelaere was supported by a personal fellowship of the Research Foundation Flanders (FWO-Vlaanderen). No part of this thesis may be reproduced or used in any way without prior written permission of the author. © Evi De Keuckelaere 2018 The role of Nanos3 in tumor progression By Evi De Keuckelaere Molecular and Cellular Oncology Lab Department of Biomedical Molecular Biology, Ghent University Cancer Research Institute Ghent (CRIG) Inflammation Research Center, Flanders Institute for Biotechnology (VIB) Technologiepark 927 B-9052 Gent-Zwijnaarde, Belgium Academic year: 2017-2018 Promoters: Prof. Dr. em. Frans Van Roy1, 2 Prof. Dr. Geert Berx1, 3 Examination committee: Chair: Prof. Dr. Peter Brouckaert1 Secretary: Prof. Dr. Wim Declercq1, 2 Examination board Prof. Dr. Kris Vleminckx1, 3, 4 Prof. Dr. Philippe Birembaut5, 6 Prof. Dr. Pieter Mestdagh7 Prof. Dr. Nadine Van Roy7 1 Department of Biomedical Molecular Biology, Ghent University, Ghent, Belgium 2 VIB Inflammation Research Center, Ghent University, Ghent, Belgium 3 Cancer Research Institute Ghent, Ghent University, Belgium 4 Center for Medical Genetics, Ghent University, Ghent, Belgium 5 INSERM UMR-S 903, SFR CAP-Santé, University of Reims Champagne-Ardenne, France 6 Laboratory of Histology, CHU Reims, France 7 Department of Pediatrics and Medical Genetics, Ghent University, Ghent, Belgium SUMMARY SUMMARY Nanos genes encode RNA-binding proteins (RBPs) that form a post-transcriptional repressor complex together with a Pumilio protein. This complex regulates transcript stability and translation upon binding Nanos regulatory/response elements (NREs), Pumilio-binding elements (PBEs), or both in the 3’UTR of mRNA targets. Nanos proteins belong to a highly conserved protein family found in both vertebrates and invertebrates. Since a general overview of the extent of this conservation was missing, we created a phylogenetic tree based on the C-terminal zinc finger domain, which is the only conserved domain among all nanos proteins. The normal physiologic expression of nanos proteins is mainly restricted to the gonads and the brain. As such, they have generally been studied with regard to their role in germ cell development. However, in humans, Nanos1 and Nanos3 are both upregulated in non-small cell lung cancers (NSCLCs). In NSCLC cell lines, overexpression and silencing of Nanos3 are linked to epithelial-mesenchymal transition (EMT) and mesenchymal-epithelial transition (MET), respectively. This occurs partly by negatively influencing E-cadherin transcription and stimulating vimentin expression. In this project, we investigated the expression of Nanos3 in several human cancer cell lines and we made use of NSCLC cell lines with and without Nanos3 overexpression to identify new mRNA targets. To examine the contribution of Nanos3 to tumor progression in vivo we generated a conditional Nanos3-expressing mouse, which was crossed with mice from established lung cancer mouse models and a prostate cancer mouse model. Prostate cancer was chosen since preliminary data in our group demonstrated a correlation between Nanos3 expression levels and tumor aggressiveness in human prostate cancer tissues. Both lung cancer and prostate cancer are frequently diagnosed cancers that are responsible for around 23% of the cancer deaths worldwide. Any research that focuses on better understanding the tumorigenesis of these cancers can be relevant in the search for better treatments for these cancers. In both LSL-KRasG12D;p53fl/fl;CCSP-rtTA+/-;TetO-Cre+/- and LSL-KRasG12D;CCSP-rtTA+/-;TetO-Cre+/- NSCLC models, after doxycycline induction, mice with ectopic Nanos3 expression (Nanos3LSL/- I SUMMARY ;LSL-KRasG12D;p53fl/fl;CCSP-rtTA+/-;TetO-Cre+/- and Nanos3LSL/-;LSL-KRasG12D;CCSP-rtTA+/-;TetO- Cre+/-) died earlier than the control mice (LSL-KRasG12D;p53fl/fl;CCSP-rtTA+/-;TetO-Cre+/- and LSL-KRasG12D;CCSP-rtTA+/-;TetO-Cre+/-). Mice from the LSL-KRasG12D;p53fl/fl;CCSP-rtTA+/-;TetO- Cre+/- NSCLC mouse model were used to further investigate this. The only notable difference between the lungs of both genotypes seemed to be the enhanced bronchiolar dysplasia observed in the Nanos3-expressing mice compared to the control mice. Several primary cell lines were established from the lung of a control and a Nanos3 NSCLC mouse. These were used in an allograft experiment and showed that Nanos3 expression did not seem to influence the ectopic tumor growth. Both mice, injected with either control or Nanos3-expressing lung tumor-derived (LuTD) cell lines, demonstrated lung metastases. Although lymph node metastases were observed in both mice injected with control or Nanos3-expressing LuTD cell lines, these metastases were bigger and differentiated in mice injected with the latter. Prostate-specific ectopic Nanos3 expression did not appear to effect the survival of Hi-Myc transgenic mice, as comparable prostate cancer progression was observed in Hi-Myc control mice and Nanos3-expressing mice. To further look into the mechanisms and possible pathways involved in the function of Nanos3 we used several approaches in search of interaction partners of Nanos3, including MAPPIT, co-immunoprecipitation and proximity-dependent biotin identification (BioID). This revealed DDX1 and several Argonaute proteins as new interaction partners of Nanos3. DDX1 seems to be involved in Nanos3-mediated post-transcriptional regulation. The interaction of Nanos3 with members of the Argonaute family further establishes the link between Nanos proteins and the miRNA regulatory network. Additionally, other interesting complexes, involved in mRNA regulation, were identified in the Nanos3 proxeome. In summary, the Nanos genes constitute a highly conserved gene family with a role in germ cell development. Recently, evidence for ectopic expression of Nanos proteins in human cancer is growing. We have clearly shown that expression of Nanos3 influences the survival of NSCLC mice and uncovered a link between Nanos3 expression and lymph node metastatic propensity. Further research will be necessary to further elucidate the molecular functions II SUMMARY of Nanos proteins and the involved molecular interaction partners, and to verify whether Nanos proteins are potent promoters of tumor formation and progression. III SAMENVATTING SAMENVATTING Nanos genen coderen voor RNA-bindende eiwitten die een posttranscriptioneel repressorcomplex vormen met een Pumilio eiwit. Dit complex reguleert de stabiliteit van de mRNA sequentie en de translatie na het binden van Nanos-regulatorische elementen, Pumilio-bindende elementen, of beide in de 3’UTR van de mRNA doelwitten. Nanos eiwitten behoren tot een sterk geconserveerde eiwitfamilie die zowel in gewervelde als in ongewervelde dieren voorkomt. Gezien een algemeen overzicht van de omvang van deze conservatie nog niet gerapporteerd was, hebben we een fylogenetische boom gemaakt op basis van het C-terminale zinkvinger domein, wat tevens het enige geconserveerde domein is van alle nanos eiwitten. De normale fysiologische synthese van nanos eiwitten is voornamelijk beperkt tot de geslachtsklieren en de hersenen. Zodoende worden ze voornamelijk bestudeerd met betrekking tot hun rol in de ontwikkeling van kiemcellen. In mensen worden Nanos1 en Nanos3 echter beide opgereguleerd in niet-kleincellige longcarcinomen (NSCLCs). In cellijnen van dit soort kanker zijn overexpressie en neerregulatie van Nanos3 respectievelijk gelinkt aan epitheliale-mesenchymale transitie (EMT) en mesenchymale-epitheliale transitie (MET). Dit gebeurt gedeeltelijk door de negatieve regulatie van E-cadherine transcriptie en het stimuleren van vimentine expressie. In dit project gingen we de expressie van Nanos3 na in verschillende humane kankercellijnen en maakten we gebruik van NSCLC cellijnen met en zonder overexpressie van Nanos3 met als doel nieuwe mRNA doelwitten te identificeren. Om de bijdrage van Nanos3 na te gaan in “in vivo tumorprogressie” hebben we een conditionele Nanos3-expresserende muis gecreëerd. Deze muis werd vervolgens gekruist met muizen van gevestigde muismodellen voor longkanker en een muismodel voor prostaatkanker. Dit laatste werd gekozen aangezien voorafgaande data in onze groep een correlatie aantoonde tussen Nanos3 expressie en de kwaadaardigheid van de tumor in humane prostaatkankerweefsels. Longkanker en prostaatkanker zijn vaak gediagnosticeerde kankers en zijn wereldwijd verantwoordelijk voor ongeveer 23% van alle sterfgevallen die te wijten zijn aan kanker. Elk onderzoek dat zich richt op een beter begrip van het ontstaan en de progressie van tumoren IV SAMENVATTING van deze kankers kan relevant zijn bij het zoeken naar betere behandelingen voor deze kankers. In beide onderzochte NSCLC modellen stierven muizen met ectopische expressie van Nanos3 (Nanos3LSL/-;LSL-KRasG12D;p53fl/fl;CCSP-rtTA+/-;TetO-Cre+/- en Nanos3LSL/-;LSL-KRasG12D;CCSP- rtTA+/-;TetO-Cre+/-), na doxycycline inductie, eerder dan de controle muizen (LSL- KRasG12D;p53fl/fl;CCSP-rtTA+/-;TetO-Cre+/- en LSL-KRasG12D;CCSP-rtTA+/-;TetO-Cre+/-). Muizen van het
Load more

Recommended publications
  • Cytogenomic SNP Microarray - Fetal ARUP Test Code 2002366 Maternal Contamination Study Fetal Spec Fetal Cells
    Patient Report |FINAL Client: Example Client ABC123 Patient: Patient, Example 123 Test Drive Salt Lake City, UT 84108 DOB 2/13/1987 UNITED STATES Gender: Female Patient Identifiers: 01234567890ABCD, 012345 Physician: Doctor, Example Visit Number (FIN): 01234567890ABCD Collection Date: 00/00/0000 00:00 Cytogenomic SNP Microarray - Fetal ARUP test code 2002366 Maternal Contamination Study Fetal Spec Fetal Cells Single fetal genotype present; no maternal cells present. Fetal and maternal samples were tested using STR markers to rule out maternal cell contamination. This result has been reviewed and approved by Maternal Specimen Yes Cytogenomic SNP Microarray - Fetal Abnormal * (Ref Interval: Normal) Test Performed: Cytogenomic SNP Microarray- Fetal (ARRAY FE) Specimen Type: Direct (uncultured) villi Indication for Testing: Patient with 46,XX,t(4;13)(p16.3;q12) (Quest: EN935475D) ----------------------------------------------------------------- ----- RESULT SUMMARY Abnormal Microarray Result (Male) Unbalanced Translocation Involving Chromosomes 4 and 13 Classification: Pathogenic 4p Terminal Deletion (Wolf-Hirschhorn syndrome) Copy number change: 4p16.3p16.2 loss Size: 5.1 Mb 13q Proximal Region Deletion Copy number change: 13q11q12.12 loss Size: 6.1 Mb ----------------------------------------------------------------- ----- RESULT DESCRIPTION This analysis showed a terminal deletion (1 copy present) involving chromosome 4 within 4p16.3p16.2 and a proximal interstitial deletion (1 copy present) involving chromosome 13 within 13q11q12.12. This
    [Show full text]
  • Information to Users
    INFORMATION TO USERS This manuscript has been reproduced from the microfilm master. UMI films the text directly from the original or copy submitted. Thus, some thesis and dissertation copies are in typewriter face, while others may be from any type of computer printer. The quality of tftis reproduction is dependent upon the quality of the copy sutHnitted. Broken or indistinct print, colored or poor quality illustrations and photographs, print bleedthrough, substandard margins, and improper alignment can adversely affect reproduction. in the unlikely event that the author did not send UMI a complete manuscript and there are missing pages, these will be noted. Also, if unauthorized copyright material had to be removed, a note will indicate the deletion. Oversize materials (e.g., maps, drawings, charts) are reproduced by sectioning the original, beginning at the upper left-hand comer and continuing from left to right in equal sections with smal overlaps. Photographs included in the original manuscript have been reproduced xerographically in this copy. Higher quality 6" x 9* black and white photographic prints are available for any photographs or Uustrations appearing in this copy for an additional charge. Contact UMI directly to order. ProQuest Information and Learning 300 North Zeeb Road, Atm Arbor, Ml 48106-1346 USA 800-521-0600 UMT MOLECULAR ANALYSIS OF L7/PCP-2 MESSENGER RNA AND ITS INTERACTING PROTEINS DISSERTATION Presented in Partial Fulfillment of the Requirements for The Degree Doctor of Philosophy in Ohio State Biochemistry Program of The Ohio State University By Xulun Zhang, M.S. ***** The Ohio State University 2001 Dissertation Committee: Approved by Professor John D.
    [Show full text]
  • Identification of the Binding Partners for Hspb2 and Cryab Reveals
    Brigham Young University BYU ScholarsArchive Theses and Dissertations 2013-12-12 Identification of the Binding arP tners for HspB2 and CryAB Reveals Myofibril and Mitochondrial Protein Interactions and Non- Redundant Roles for Small Heat Shock Proteins Kelsey Murphey Langston Brigham Young University - Provo Follow this and additional works at: https://scholarsarchive.byu.edu/etd Part of the Microbiology Commons BYU ScholarsArchive Citation Langston, Kelsey Murphey, "Identification of the Binding Partners for HspB2 and CryAB Reveals Myofibril and Mitochondrial Protein Interactions and Non-Redundant Roles for Small Heat Shock Proteins" (2013). Theses and Dissertations. 3822. https://scholarsarchive.byu.edu/etd/3822 This Thesis is brought to you for free and open access by BYU ScholarsArchive. It has been accepted for inclusion in Theses and Dissertations by an authorized administrator of BYU ScholarsArchive. For more information, please contact [email protected], [email protected]. Identification of the Binding Partners for HspB2 and CryAB Reveals Myofibril and Mitochondrial Protein Interactions and Non-Redundant Roles for Small Heat Shock Proteins Kelsey Langston A thesis submitted to the faculty of Brigham Young University in partial fulfillment of the requirements for the degree of Master of Science Julianne H. Grose, Chair William R. McCleary Brian Poole Department of Microbiology and Molecular Biology Brigham Young University December 2013 Copyright © 2013 Kelsey Langston All Rights Reserved ABSTRACT Identification of the Binding Partners for HspB2 and CryAB Reveals Myofibril and Mitochondrial Protein Interactors and Non-Redundant Roles for Small Heat Shock Proteins Kelsey Langston Department of Microbiology and Molecular Biology, BYU Master of Science Small Heat Shock Proteins (sHSP) are molecular chaperones that play protective roles in cell survival and have been shown to possess chaperone activity.
    [Show full text]
  • Supporting Information for Proteomics DOI 10.1002/Pmic.200400896
    Supporting Information for Proteomics DOI 10.1002/pmic.200400896 Odette Prat, Frdric Berenguer, Vronique Malard, Emmanuelle Tavan, Nicole Sage, Grard Steinmetz and Eric Quemeneur Transcriptomic and proteomic responses of human renal HEK293 cells to uranium toxicity ª 2004 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim www.proteomics-journal.de Table 1 : Differentially expressed genes in HEK293 cells treated with uranium at CI50 , CI30 and CI20. GENE ID GENE DESCRIPTION CI50 CI30 CI20 AANAT arylalkylamine N-acetyltransferase 1.66 AASDHPPT aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase -1.73 ABCC8 ATP-binding cassette, sub-family C (CFTR/MRP), member 8 2.96 2.9 ABCF2 ATP-binding cassette, sub-family F (GCN20), member 2 1.86 ACAT2 acetyl-Coenzyme A acetyltransferase 2 (acetoacetyl Coenzyme A thiolase) -2.47 ACTB actin, beta -2.12 ACTR2 ARP2 actin-related protein 2 homolog (yeast) -1.94 ADAR adenosine deaminase, RNA-specific 1.87 1.92 ADNP activity-dependent neuroprotector -1.03 ADPRTL1 ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase)-like 1 1.48 2.31 2.1 AKAP1 A kinase (PRKA) anchor protein 1 1.59 AKR1C3 aldo-keto reductase family 1, member C3 -1.37 (3-alpha hydroxysteroid dehydrogenase, type II) ALS2CR3 amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 3 -1.21 APBB1 amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65) 4.41 APC adenomatosis polyposis coli -1.66 APP amyloid beta (A4) precursor protein (protease nexin-II, Alzheimer disease) -1.32 APPBP1 amyloid beta precursor
    [Show full text]
  • Prostate Cancer Prognostics Using Biomarkers Prostatakrebsprognostik Mittels Biomarkern Prognostic Du Cancer De La Prostate Au Moyen De Biomarqueurs
    (19) TZZ Z_T (11) EP 2 885 640 B1 (12) EUROPEAN PATENT SPECIFICATION (45) Date of publication and mention (51) Int Cl.: of the grant of the patent: G01N 33/574 (2006.01) C12Q 1/68 (2018.01) 18.07.2018 Bulletin 2018/29 C40B 30/04 (2006.01) (21) Application number: 13829137.2 (86) International application number: PCT/US2013/055429 (22) Date of filing: 16.08.2013 (87) International publication number: WO 2014/028884 (20.02.2014 Gazette 2014/08) (54) PROSTATE CANCER PROGNOSTICS USING BIOMARKERS PROSTATAKREBSPROGNOSTIK MITTELS BIOMARKERN PROGNOSTIC DU CANCER DE LA PROSTATE AU MOYEN DE BIOMARQUEURS (84) Designated Contracting States: • GHADESSI, Mercedeh AL AT BE BG CH CY CZ DE DK EE ES FI FR GB New Westminster, British Columbia V3M 6E2 (CA) GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO • JENKINS, Robert, B. PL PT RO RS SE SI SK SM TR Rochester, Minnesota 55902 (US) • VERGARA CORREA, Ismael A. (30) Priority: 16.08.2012 US 201261684066 P Bundoora, Victoria 3083 (AU) 13.02.2013 US 201361764365 P 14.03.2013 US 201361783124 P (74) Representative: Cornish, Kristina Victoria Joy et al Kilburn & Strode LLP (43) Date of publication of application: Lacon London 24.06.2015 Bulletin 2015/26 84 Theobalds Road London WC1X 8NL (GB) (73) Proprietors: • Genomedx Biosciences, Inc. (56) References cited: Vancouver BC V6B 2W9 (CA) WO-A1-2009/143603 WO-A1-2013/090620 • MAYO FOUNDATION FOR MEDICAL WO-A2-2006/091776 WO-A2-2006/110264 EDUCATION AND RESEARCH WO-A2-2007/056049 US-A1- 2006 134 663 Rochester, MN 55905 (US) US-A1- 2007 037 165 US-A1- 2007 065 827 US-A1-
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • DM Domain Proteins in Sexual Regulation 875 Transformation Marker Prf4 (Containing the Mutant Rol-6 Allele Green fluorescent Protein (GFP) Coding Region
    Development 126, 873-881 (1999) 873 Printed in Great Britain © The Company of Biologists Limited 1999 DEV5283 Similarity of DNA binding and transcriptional regulation by Caenorhabditis elegans MAB-3 and Drosophila melanogaster DSX suggests conservation of sex determining mechanisms Woelsung Yi1 and David Zarkower1,2,* 1Biochemistry, Molecular Biology and Biophysics Graduate Program, and 2Department of Genetics, Cell Biology and Development, University of Minnesota, Minneapolis, MN 55455, USA *Author for correspondence (e-mail: [email protected]) Accepted 17 December 1998; published on WWW 2 February 1999 SUMMARY Although most animals occur in two sexes, the molecular transcription, resulting in expression in both sexes, and the pathways they employ to control sexual development vary vitellogenin genes have potential MAB-3 binding sites considerably. The only known molecular similarity upstream of their transcriptional start sites. MAB-3 binds between phyla in sex determination is between two genes, to a site in the vit-2 promoter in vitro, and this site is mab-3 from C. elegans, and doublesex (dsx) from required in vivo to prevent transcription of a vit-2 reporter Drosophila. Both genes contain a DNA binding motif called construct in males, suggesting that MAB-3 is a direct a DM domain and they regulate similar aspects of sexual repressor of vitellogenin transcription. This is the first development, including yolk protein synthesis and direct link between the sex determination regulatory peripheral nervous system differentiation. Here we show pathway and sex-specific structural genes in C. elegans, and that MAB-3, like the DSX proteins, is a direct regulator of it suggests that nematodes and insects use at least some of yolk protein gene transcription.
    [Show full text]
  • Genetic Analysis of Over One Million People Identifies 535 New Loci Associated with Blood 2 Pressure Traits
    1 Genetic analysis of over one million people identifies 535 new loci associated with blood 2 pressure traits. 3 4 Table of Contents 5 SUPPLEMENTARY TABLES LEGENDS……………………………………………………………………………….…….3 6 SUPPLEMENTARY FIGURES LEGENDS ........................................................................................ 6 7 SUPPLEMENTARY METHODS ................................................................................................... 10 8 1. UK Biobank data .................................................................................................................................... 10 9 2. UKB Quality Control ............................................................................................................................... 10 10 3. Phenotypic data ..................................................................................................................................... 11 11 4. UKB analysis ........................................................................................................................................... 11 12 5. Genomic inflation and confounding ....................................................................................................... 12 13 6. International Consortium for Blood Pressure (ICBP) GWAS .................................................................... 12 14 7. Meta-analyses of discovery datasets ..................................................................................................... 13 15 8. Linkage Disequilibrium calculations ......................................................................................................
    [Show full text]
  • A W-Linked DM-Domain Gene, DM-W, Participates in Primary Ovary Development in Xenopus Laevis
    A W-linked DM-domain gene, DM-W, participates in primary ovary development in Xenopus laevis Shin Yoshimoto*, Ema Okada*, Hirohito Umemoto*, Kei Tamura*, Yoshinobu Uno†, Chizuko Nishida-Umehara†, Yoichi Matsuda†, Nobuhiko Takamatsu*, Tadayoshi Shiba*, and Michihiko Ito*‡ *Department of Bioscience, School of Science, Kitasato University, 1-15-1 Kitasato, Sagamihara, Kanagawa 228-8555, Japan; and †Division of Genome Dynamics, Creative Research Initiative ‘‘Sousei,’’ Hokkaido University, North10 West8, Kita-ku, Sapporo, Hokkaido 060-0810, Japan Communicated by Satoshi Omura,¯ The Kitasato Institute, Tokyo, Japan, December 27, 2007 (received for review September 11, 2007) In the XX/XY sex-determining system, the Y-linked SRY genes of In some species of amphibians, sex determination is controlled most mammals and the DMY/Dmrt1bY genes of the teleost fish genetically (13), even though the animals’ sex chromosomes are medaka have been characterized as sex-determining genes that morphologically indistinguishable from the autosomes. The trigger formation of the testis. However, the molecular mechanism South African clawed frog Xenopus laevis uses the ZZ/ZW of the ZZ/ZW-type system in vertebrates, including the clawed frog system, which was demonstrated by backcrosses between sex- Xenopus laevis, is unknown. Here, we isolated an X. laevis female reversed and normal individuals (14), but its sex chromosomes genome-specific DM-domain gene, DM-W, and obtained molecular have not yet been identified. Moreover, as with other animals evidence of a W-chromosome in this species. The DNA-binding that use the ZZ/ZW system, no sex-determining gene(s) has domain of DM-W showed a strikingly high identity (89%) with that been identified.
    [Show full text]
  • Noelia Díaz Blanco
    Effects of environmental factors on the gonadal transcriptome of European sea bass (Dicentrarchus labrax), juvenile growth and sex ratios Noelia Díaz Blanco Ph.D. thesis 2014 Submitted in partial fulfillment of the requirements for the Ph.D. degree from the Universitat Pompeu Fabra (UPF). This work has been carried out at the Group of Biology of Reproduction (GBR), at the Department of Renewable Marine Resources of the Institute of Marine Sciences (ICM-CSIC). Thesis supervisor: Dr. Francesc Piferrer Professor d’Investigació Institut de Ciències del Mar (ICM-CSIC) i ii A mis padres A Xavi iii iv Acknowledgements This thesis has been made possible by the support of many people who in one way or another, many times unknowingly, gave me the strength to overcome this "long and winding road". First of all, I would like to thank my supervisor, Dr. Francesc Piferrer, for his patience, guidance and wise advice throughout all this Ph.D. experience. But above all, for the trust he placed on me almost seven years ago when he offered me the opportunity to be part of his team. Thanks also for teaching me how to question always everything, for sharing with me your enthusiasm for science and for giving me the opportunity of learning from you by participating in many projects, collaborations and scientific meetings. I am also thankful to my colleagues (former and present Group of Biology of Reproduction members) for your support and encouragement throughout this journey. To the “exGBRs”, thanks for helping me with my first steps into this world. Working as an undergrad with you Dr.
    [Show full text]
  • PRODUCT SPECIFICATION Product Datasheet
    Product Datasheet QPrEST PRODUCT SPECIFICATION Product Name QPrEST K1841 Mass Spectrometry Protein Standard Product Number QPrEST29029 Protein Name Uncharacterized protein KIAA1841 Uniprot ID Q6NSI8 Gene KIAA1841 Product Description Stable isotope-labeled standard for absolute protein quantification of Uncharacterized protein KIAA1841. Lys (13C and 15N) and Arg (13C and 15N) metabolically labeled recombinant human protein fragment. Application Absolute protein quantification using mass spectrometry Sequence (excluding EQCIQYCHKNMNAIVATPCNMNCINANLLTRIADLFSHNEVDDLKDKKDK fusion tag) FKSKLFCKKIERLFDPEYLNPDSRSNAA Theoretical MW 26883 Da including N-terminal His6ABP fusion tag Fusion Tag A purification and quantification tag (QTag) consisting of a hexahistidine sequence followed by an Albumin Binding Protein (ABP) domain derived from Streptococcal Protein G. Expression Host Escherichia coli LysA ArgA BL21(DE3) Purification IMAC purification Purity >90% as determined by Bioanalyzer Protein 230 Purity Assay Isotopic Incorporation >99% Concentration >5 μM after reconstitution in 100 μl H20 Concentration Concentration determined by LC-MS/MS using a highly pure amino acid analyzed internal Determination reference (QTag), CV ≤10%. Amount >0.5 nmol per vial, two vials supplied. Formulation Lyophilized in 100 mM Tris-HCl 5% Trehalose, pH 8.0 Instructions for Spin vial before opening. Add 100 μL ultrapure H2O to the vial. Vortex thoroughly and spin Reconstitution down. For further dilution, see Application Protocol. Shipping Shipped at ambient temperature Storage Lyophilized product shall be stored at -20°C. See COA for expiry date. Reconstituted product can be stored at -20°C for up to 4 weeks. Avoid repeated freeze-thaw cycles. Notes For research use only Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use.
    [Show full text]
  • Supplementary Table S4. FGA Co-Expressed Gene List in LUAD
    Supplementary Table S4. FGA co-expressed gene list in LUAD tumors Symbol R Locus Description FGG 0.919 4q28 fibrinogen gamma chain FGL1 0.635 8p22 fibrinogen-like 1 SLC7A2 0.536 8p22 solute carrier family 7 (cationic amino acid transporter, y+ system), member 2 DUSP4 0.521 8p12-p11 dual specificity phosphatase 4 HAL 0.51 12q22-q24.1histidine ammonia-lyase PDE4D 0.499 5q12 phosphodiesterase 4D, cAMP-specific FURIN 0.497 15q26.1 furin (paired basic amino acid cleaving enzyme) CPS1 0.49 2q35 carbamoyl-phosphate synthase 1, mitochondrial TESC 0.478 12q24.22 tescalcin INHA 0.465 2q35 inhibin, alpha S100P 0.461 4p16 S100 calcium binding protein P VPS37A 0.447 8p22 vacuolar protein sorting 37 homolog A (S. cerevisiae) SLC16A14 0.447 2q36.3 solute carrier family 16, member 14 PPARGC1A 0.443 4p15.1 peroxisome proliferator-activated receptor gamma, coactivator 1 alpha SIK1 0.435 21q22.3 salt-inducible kinase 1 IRS2 0.434 13q34 insulin receptor substrate 2 RND1 0.433 12q12 Rho family GTPase 1 HGD 0.433 3q13.33 homogentisate 1,2-dioxygenase PTP4A1 0.432 6q12 protein tyrosine phosphatase type IVA, member 1 C8orf4 0.428 8p11.2 chromosome 8 open reading frame 4 DDC 0.427 7p12.2 dopa decarboxylase (aromatic L-amino acid decarboxylase) TACC2 0.427 10q26 transforming, acidic coiled-coil containing protein 2 MUC13 0.422 3q21.2 mucin 13, cell surface associated C5 0.412 9q33-q34 complement component 5 NR4A2 0.412 2q22-q23 nuclear receptor subfamily 4, group A, member 2 EYS 0.411 6q12 eyes shut homolog (Drosophila) GPX2 0.406 14q24.1 glutathione peroxidase
    [Show full text]