Anti-HIST1H3E (Full Length) Polyclonal Antibody (DPAB-DC3421) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

Total Page：16

File Type：pdf, Size：1020Kb

Anti-HIST1H3E (full length) polyclonal antibody (DPAB-DC3421) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H3 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. Immunogen HIST1H3E (AAH52981, 1 a.a. ~ 136 a.a) full-length recombinant protein with GST tag. The sequence is MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIR KLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR IRGERA Source/Host Mouse Species Reactivity Human Conjugate Unconjugated Applications WB (Recombinant protein), ELISA, Size 50 μl Buffer 50 % glycerol Preservative None Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION Gene Name HIST1H3E histone cluster 1, H3e [ Homo sapiens (human) ] 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved Official Symbol HIST1H3E Synonyms HIST1H3E; histone cluster 1, H3e; H3.1; H3/d; H3FD; histone H3.1; histone H3/d; histone 1, H3e; H3 histone family, member D; Entrez Gene ID 8353 Protein Refseq NP_003523 UniProt ID P68431 Chromosome Location 6p22.1 Pathway Alcoholism; Amyloids; Cell Cycle, Mitotic; Cellular responses to stress. 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.

Copy Link

Recommended publications

Aneuploidy: Using Genetic Instability to Preserve a Haploid Genome?
Health Science Campus FINAL APPROVAL OF DISSERTATION Doctor of Philosophy in Biomedical Science (Cancer Biology) Aneuploidy: Using genetic instability to preserve a haploid genome? Submitted by: Ramona Ramdath In partial fulfillment of the requirements for the degree of Doctor of Philosophy in Biomedical Science Examination Committee Signature/Date Major Advisor: David Allison, M.D., Ph.D. Academic James Trempe, Ph.D. Advisory Committee: David Giovanucci, Ph.D. Randall Ruch, Ph.D. Ronald Mellgren, Ph.D. Senior Associate Dean College of Graduate Studies Michael S. Bisesi, Ph.D. Date of Defense: April 10, 2009 Aneuploidy: Using genetic instability to preserve a haploid genome? Ramona Ramdath University of Toledo, Health Science Campus 2009 Dedication I dedicate this dissertation to my grandfather who died of lung cancer two years ago, but who always instilled in us the value and importance of education. And to my mom and sister, both of whom have been pillars of support and stimulating conversations. To my sister, Rehanna, especially- I hope this inspires you to achieve all that you want to in life, academically and otherwise. ii Acknowledgements As we go through these academic journeys, there are so many along the way that make an impact not only on our work, but on our lives as well, and I would like to say a heartfelt thank you to all of those people: My Committee members- Dr. James Trempe, Dr. David Giovanucchi, Dr. Ronald Mellgren and Dr. Randall Ruch for their guidance, suggestions, support and confidence in me. My major advisor- Dr. David Allison, for his constructive criticism and positive reinforcement.
[Show full text]
A Yeast Phenomic Model for the Influence of Warburg Metabolism on Genetic Buffering of Doxorubicin Sean M
Santos and Hartman Cancer & Metabolism (2019) 7:9 https://doi.org/10.1186/s40170-019-0201-3 RESEARCH Open Access A yeast phenomic model for the influence of Warburg metabolism on genetic buffering of doxorubicin Sean M. Santos and John L. Hartman IV* Abstract Background: The influence of the Warburg phenomenon on chemotherapy response is unknown. Saccharomyces cerevisiae mimics the Warburg effect, repressing respiration in the presence of adequate glucose. Yeast phenomic experiments were conducted to assess potential influences of Warburg metabolism on gene-drug interaction underlying the cellular response to doxorubicin. Homologous genes from yeast phenomic and cancer pharmacogenomics data were analyzed to infer evolutionary conservation of gene-drug interaction and predict therapeutic relevance. Methods: Cell proliferation phenotypes (CPPs) of the yeast gene knockout/knockdown library were measured by quantitative high-throughput cell array phenotyping (Q-HTCP), treating with escalating doxorubicin concentrations under conditions of respiratory or glycolytic metabolism. Doxorubicin-gene interaction was quantified by departure of CPPs observed for the doxorubicin-treated mutant strain from that expected based on an interaction model. Recursive expectation-maximization clustering (REMc) and Gene Ontology (GO)-based analyses of interactions identified functional biological modules that differentially buffer or promote doxorubicin cytotoxicity with respect to Warburg metabolism. Yeast phenomic and cancer pharmacogenomics data were integrated to predict differential gene expression causally influencing doxorubicin anti-tumor efficacy. Results: Yeast compromised for genes functioning in chromatin organization, and several other cellular processes are more resistant to doxorubicin under glycolytic conditions. Thus, the Warburg transition appears to alleviate requirements for cellular functions that buffer doxorubicin cytotoxicity in a respiratory context.
[Show full text]
Histone H3.1 (Human) Cell-Based ELISA Kit
Histone H3.1 (Human) Cell-Based ELISA Kit Catalog # : KA2761 規格 : [ 1 Kit ] List All Specification Application Image Product Histone H3.1 (Human) Cell-Based ELISA Kit is an indirect enzyme-linked Qualitative Description: immunoassay for qualitative determination of Histone H3 expression in cultured cells. Reactivity: Human, Mouse, Rat Storage Store the kit at 4°C. Instruction: Protocol: Protocol Download Suitable Attached Cell, Loosely Attached Cell, Suspension Cell Sample: Label: HRP-conjugated Detection Colorimetric Method: Regulation For research use only (RUO) Status: Datasheet: Download Applications Qualitative HIST1H3A HIST1H3D HIST1H3C HIST1H3E HIST1H3I HIST1H3G HIST1H3J HIST1H3H HIST1H3B HIST1H3F Gene Information Entrez GeneID: 8350 Protein P68431 Accession#: Gene Name: HIST1H3A Gene Alias: H3/A,H3FA Gene histone cluster 1, H3a Description: Omim ID: 602810 Gene Ontology: Hyperlink Gene Summary: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a Page 1 of 6 2021/6/18 nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3. [provided by RefSeq Other H3 histone family, member A,histone 1, H3a Designations: Gene Information Entrez GeneID: 8351 Protein P68431 Accession#: Gene Name: HIST1H3D Gene Alias: H3/b,H3FB Gene histone cluster 1, H3d Description: Omim ID: 602811 Gene Ontology: Hyperlink Gene Summary: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes.
[Show full text]
A Multiprotein Occupancy Map of the Mrnp on the 3 End of Histone
Downloaded from rnajournal.cshlp.org on October 6, 2021 - Published by Cold Spring Harbor Laboratory Press A multiprotein occupancy map of the mRNP on the 3′ end of histone mRNAs LIONEL BROOKS III,1 SHAWN M. LYONS,2 J. MATTHEW MAHONEY,1 JOSHUA D. WELCH,3 ZHONGLE LIU,1 WILLIAM F. MARZLUFF,2 and MICHAEL L. WHITFIELD1 1Department of Genetics, Dartmouth Geisel School of Medicine, Hanover, New Hampshire 03755, USA 2Integrative Program for Biological and Genome Sciences, University of North Carolina, Chapel Hill, North Carolina 27599, USA 3Department of Computer Science, University of North Carolina, Chapel Hill, North Carolina 27599, USA ABSTRACT The animal replication-dependent (RD) histone mRNAs are coordinately regulated with chromosome replication. The RD-histone mRNAs are the only known cellular mRNAs that are not polyadenylated. Instead, the mature transcripts end in a conserved stem– loop (SL) structure. This SL structure interacts with the stem–loop binding protein (SLBP), which is involved in all aspects of RD- histone mRNA metabolism. We used several genomic methods, including high-throughput sequencing of cross-linked immunoprecipitate (HITS-CLIP) to analyze the RNA-binding landscape of SLBP. SLBP was not bound to any RNAs other than histone mRNAs. We performed bioinformatic analyses of the HITS-CLIP data that included (i) clustering genes by sequencing read coverage using CVCA, (ii) mapping the bound RNA fragment termini, and (iii) mapping cross-linking induced mutation sites (CIMS) using CLIP-PyL software. These analyses allowed us to identify specific sites of molecular contact between SLBP and its RD-histone mRNA ligands. We performed in vitro crosslinking assays to refine the CIMS mapping and found that uracils one and three in the loop of the histone mRNA SL preferentially crosslink to SLBP, whereas uracil two in the loop preferentially crosslinks to a separate component, likely the 3′hExo.
[Show full text]
Mendelian Randomization Integrating GWAS and Eqtl Data Revealed
Yang et al. Translational Psychiatry (2021) 11:225 https://doi.org/10.1038/s41398-021-01348-0 Translational Psychiatry ARTICLE Open Access Mendelian randomization integrating GWAS and eQTL data revealed genes pleiotropically associated with major depressive disorder Huarong Yang1,DiLiu2, Chuntao Zhao3, Bowen Feng4, Wenjin Lu5, Xiaohan Yang6,MingluXu6, Weizhu Zhou7, Huiquan Jing 6 and Jingyun Yang 8,9 Abstract Previous genome-wide association studies (GWAS) have identified potential genetic variants associated with the risk of major depressive disorder (MDD), but the underlying biological interpretation remains largely unknown. We aimed to prioritize genes that were pleiotropically or potentially causally associated with MDD. We applied the summary data- based Mendelian randomization (SMR) method integrating GWAS and gene expression quantitative trait loci (eQTL) data in 13 brain regions to identify genes that were pleiotropically associated with MDD. In addition, we repeated the analysis by using the meta-analyzed version of the eQTL summary data in the brain (brain-eMeta). We identified multiple significant genes across different brain regions that may be involved in the pathogenesis of MDD. The prime- specific gene BTN3A2 (corresponding probe: ENSG00000186470.9) was the top hit showing pleiotropic association with MDD in 9 of the 13 brain regions and in brain-eMeta, after correction for multiple testing. Many of the identified genes are located in the human major histocompatibility complex (MHC) region on chromosome 6 and are mainly involved in the immune response. Our SMR analysis indicated that multiple genes showed pleiotropic association with fi 1234567890():,; 1234567890():,; 1234567890():,; 1234567890():,; MDD across the brain regions. These ndings provided important leads to a better understanding of the mechanism of MDD and revealed potential therapeutic targets for the prevention and effective treatment of MDD.
[Show full text]
Differential Gene Expression by RNA-Seq Analysis of the Primo Vessel in the Rabbit Lymph
J Acupunct Meridian Stud 2019;12(1):11e19 Available online at www.sciencedirect.com Journal of Acupuncture and Meridian Studies journal homepage: www.jams-kpi.com Research Article Differential Gene Expression by RNA-Seq Analysis of the Primo Vessel in the Rabbit Lymph Jun-Young Shin, Sang-Heon Choi, Da-Woon Choi, Ye-Jin An, Jae-Hyuk Seo, Jong-Gu Choi, Min-Suk Rho, Sang-Suk Lee* Department of Oriental Biomedical Engineering, Sangji University, Wonju, Republic of Korea Available online 28 October 2018 Received: May 31, 2018 Abstract Revised: Jul 26, 2018 For the connectome of primo vascular system, some long-type primo vessels dyed with Accepted: Oct 23, 2018 Alcian blue injected into inguinal nodes, abdominal node, and axially nodes were visual- ized, which passed over around the vena cava of the rabbit. The Alcian blue dye revealed KEYWORDS primo vessels and colored blue in the rabbit lymph vessels. The length of long-type primo e m gene expression level; vessels was 18 cm on average, of which diameters were about 20 30 m, and the lymph e m lymph node; vessels had diameters of 100 150 m. Three different tissues of pure primo vessel, mixed primo connectome; primo þ lymph vessel, and only lymph vessel were made to undergo RNA-Seq analysis by RNA-Seq analysis next-generation sequencing. We also analyzed differentially expressed genes (DEGs) from the RNA-Seq data, in which 30 genes of the primo vessels, primo þ lymph vessels, and lymph vessels were selected for primo marker candidates. From the plot of DEG analysis, 10 genes had remarkably different expression pattern on the Group 1 (primo vessel) vs Group 3 (lymph vessel).
[Show full text]
Feature Selection for Longitudinal Data by Using Sign Averages to Summarize Gene Expression Values Over Time
University of Kentucky UKnowledge Biostatistics Faculty Publications Biostatistics 3-19-2019 Feature Selection for Longitudinal Data by Using Sign Averages to Summarize Gene Expression Values over Time Suyan Tian The First Hospital of Jilin University, China, [email protected] Chi Wang University of Kentucky, [email protected] Right click to open a feedback form in a new tab to let us know how this document benefits oy u. Follow this and additional works at: https://uknowledge.uky.edu/biostatistics_facpub Part of the Biostatistics Commons, Computational Biology Commons, Longitudinal Data Analysis and Time Series Commons, and the Microarrays Commons Repository Citation Tian, Suyan and Wang, Chi, "Feature Selection for Longitudinal Data by Using Sign Averages to Summarize Gene Expression Values over Time" (2019). Biostatistics Faculty Publications. 43. https://uknowledge.uky.edu/biostatistics_facpub/43 This Article is brought to you for free and open access by the Biostatistics at UKnowledge. It has been accepted for inclusion in Biostatistics Faculty Publications by an authorized administrator of UKnowledge. For more information, please contact [email protected]. Feature Selection for Longitudinal Data by Using Sign Averages to Summarize Gene Expression Values over Time Notes/Citation Information Published in BioMed Research International, v. 2019, article ID 1724898, p. 1-12. © 2019 Suyan Tian and Chi Wang. This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use,
[Show full text]
Title: a Yeast Phenomic Model for the Influence of Warburg Metabolism on Genetic
bioRxiv preprint doi: https://doi.org/10.1101/517490; this version posted January 15, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC 4.0 International license. 1 Title Page: 2 3 Title: A yeast phenomic model for the influence of Warburg metabolism on genetic 4 buffering of doxorubicin 5 6 Authors: Sean M. Santos1 and John L. Hartman IV1 7 1. University of Alabama at Birmingham, Department of Genetics, Birmingham, AL 8 Email: [email protected], [email protected] 9 Corresponding author: [email protected] 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 1 bioRxiv preprint doi: https://doi.org/10.1101/517490; this version posted January 15, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC 4.0 International license. 26 Abstract: 27 Background: 28 Saccharomyces cerevisiae represses respiration in the presence of adequate glucose, 29 mimicking the Warburg effect, termed aerobic glycolysis. We conducted yeast phenomic 30 experiments to characterize differential doxorubicin-gene interaction, in the context of 31 respiration vs. glycolysis. The resulting systems level biology about doxorubicin 32 cytotoxicity, including the influence of the Warburg effect, was integrated with cancer 33 pharmacogenomics data to identify potentially causal correlations between differential 34 gene expression and anti-cancer efficacy.
[Show full text]
Regulatory Mechanisms of Epigenetic Mirna Relationships in Human Cancer and Potential As Therapeutic Targets
cancers Review Regulatory Mechanisms of Epigenetic miRNA Relationships in Human Cancer and Potential as Therapeutic Targets , K. M. Taufiqul Arif y , Esther K. Elliott y, Larisa M. Haupt z and Lyn R. Griffiths * z Centre for Genomics and Personalised Health, Genomics Research Centre, School of Biomedical Sciences, Institute of Health and Biomedical Innovation, Queensland University of Technology (QUT), 60 Musk Ave., Kelvin Grove, Queensland 4059, Australia; kmtaufi[email protected] (K.M.T.A.); [email protected] (E.K.E.); [email protected] (L.M.H.) * Correspondence: lyn.griffi[email protected]; Tel.: +61-7-3138-6102; Fax: +61-7-3138-6039 These authors contributed equally to this paper. y These authors contributed equally to this paper. z Received: 12 September 2020; Accepted: 7 October 2020; Published: 11 October 2020 Simple Summary: By the virtue of targeting multiple genes, a microRNA (miRNA) can infer variable consequences on tumorigenesis by appearing as both a tumour suppressor and oncogene. miRNAs can regulate gene expression by modulating genome-wide epigenetic status of genes that are involved in various cancers. These miRNAs perform direct inhibition of key mediators of the epigenetic machinery, such as DNA methyltransferases (DNMTs) and histone deacetylases (HDACs) genes. Along with miRNAs gene expression, similar to other protein-coding genes, miRNAs are also controlled by epigenetic mechanisms. Overall, this reciprocal interaction between the miRNAs and the epigenetic architecture is significantly implicated in the aberrant expression of miRNAs detected in various human cancers. Comprehensive knowledge of the miRNA-epigenetic dynamics in cancer is essential for the discovery of novel anticancer therapeutics.
[Show full text]
H3FD (HIST1H3E) (NM 003532) Human Tagged ORF Clone Lentiviral Particle Product Data
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC208655L4V H3FD (HIST1H3E) (NM_003532) Human Tagged ORF Clone Lentiviral Particle Product data: Product Type: Lentiviral Particles Product Name: H3FD (HIST1H3E) (NM_003532) Human Tagged ORF Clone Lentiviral Particle Symbol: H3C6 Synonyms: H3.1; H3/d; H3C1; H3C2; H3C3; H3C4; H3C7; H3C8; H3C10; H3C11; H3C12; H3FD; HIST1H3E Vector: pLenti-C-mGFP-P2A-Puro (PS100093) ACCN: NM_003532 ORF Size: 408 bp ORF Nucleotide The ORF insert of this clone is exactly the same as(RC208655). Sequence: OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_003532.2 RefSeq Size: 462 bp RefSeq ORF: 411 bp Locus ID: 8353 UniProt ID: P68431 Domains: H3, histone Protein Pathways: Systemic lupus erythematosus MW: 15.2 kDa This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 H3FD (HIST1H3E) (NM_003532) Human Tagged ORF Clone Lentiviral Particle – RC208655L4V Gene Summary: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes.
[Show full text]
Title Cancer-Associated Mutations of Histones H2B, H3.1 and H2A.Z.1 Affect the Structure and Stability of the Nucleosome Author(
Cancer-associated mutations of histones H2B, H3.1 and Title H2A.Z.1 affect the structure and stability of the nucleosome Arimura, Yasuhiro; Ikura, Masae; Fujita, Risa; Noda, Mamiko; Kobayashi, Wataru; Horikoshi, Naoki; Sun, Jiying; Shi, Lin; Author(s) Kusakabe, Masayuki; Harata, Masahiko; Ohkawa, Yasuyuki; Tashiro, Satoshi; Kimura, Hiroshi; Ikura, Tsuyoshi; Kurumizaka, Hitoshi Citation Nucleic acids research (2018), 46(19): 10007-10018 Issue Date 2018-11-02 URL http://hdl.handle.net/2433/235734 © The Author(s) 2018. Published by Oxford University Press on behalf of Nucleic Acids Research. This is an Open Access article distributed under the terms of the Creative Commons Attribution Non-Commercial License Right (http://creativecommons.org/licenses/by-nc/4.0/), which permits non-commercial re-use, distribution, and reproduction in any medium, provided the original work is properly cited. For commercial re-use, please contact [email protected] Type Journal Article Textversion publisher Kyoto University Published online 24 July 2018 Nucleic Acids Research, 2018, Vol. 46, No. 19 10007–10018 doi: 10.1093/nar/gky661 Cancer-associated mutations of histones H2B, H3.1 and H2A.Z.1 affect the structure and stability of the nucleosome 1,2 3 1,2 2 1,2 Yasuhiro Arimura , Masae Ikura , Risa Fujita , Mamiko Noda , Wataru Kobayashi , Downloaded from https://academic.oup.com/nar/article-abstract/46/19/10007/5057090 by Kyoto University user on 19 December 2018 Naoki Horikoshi2, Jiying Sun4, Lin Shi4, Masayuki Kusakabe5, Masahiko Harata5, Yasuyuki
[Show full text]
Supplementary Material Peptide-Conjugated Oligonucleotides Evoke Long-Lasting Myotonic Dystrophy Correction in Patient-Derived C
Supplementary material Peptide-conjugated oligonucleotides evoke long-lasting myotonic dystrophy correction in patient-derived cells and mice Arnaud F. Klein1†, Miguel A. Varela2,3,4†, Ludovic Arandel1, Ashling Holland2,3,4, Naira Naouar1, Andrey Arzumanov2,5, David Seoane2,3,4, Lucile Revillod1, Guillaume Bassez1, Arnaud Ferry1,6, Dominic Jauvin7, Genevieve Gourdon1, Jack Puymirat7, Michael J. Gait5, Denis Furling1#* & Matthew J. A. Wood2,3,4#* 1Sorbonne Université, Inserm, Association Institut de Myologie, Centre de Recherche en Myologie, CRM, F-75013 Paris, France 2Department of Physiology, Anatomy and Genetics, University of Oxford, South Parks Road, Oxford, UK 3Department of Paediatrics, John Radcliffe Hospital, University of Oxford, Oxford, UK 4MDUK Oxford Neuromuscular Centre, University of Oxford, Oxford, UK 5Medical Research Council, Laboratory of Molecular Biology, Francis Crick Avenue, Cambridge, UK 6Sorbonne Paris Cité, Université Paris Descartes, F-75005 Paris, France 7Unit of Human Genetics, Hôpital de l'Enfant-Jésus, CHU Research Center, QC, Canada † These authors contributed equally to the work # These authors shared co-last authorship Methods Synthesis of Peptide-PMO Conjugates. Pip6a Ac-(RXRRBRRXRYQFLIRXRBRXRB)-CO OH was synthesized and conjugated to PMO as described previously (1). The PMO sequence targeting CUG expanded repeats (5′-CAGCAGCAGCAGCAGCAGCAG-3′) and PMO control reverse (5′-GACGACGACGACGACGACGAC-3′) were purchased from Gene Tools LLC. Animal model and ASO injections. Experiments were carried out in the “Centre d’études fonctionnelles” (Faculté de Médecine Sorbonne University) according to French legislation and Ethics committee approval (#1760-2015091512001083v6). HSA-LR mice are gift from Pr. Thornton. The intravenous injections were performed by single or multiple administrations via the tail vein in mice of 5 to 8 weeks of age.
[Show full text]