TSG101 Negatively Regulates Mitochondrial Biogenesis in Axons
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
UBAP1 Rabbit Pab
Leader in Biomolecular Solutions for Life Science UBAP1 Rabbit pAb Catalog No.: A4726 Basic Information Background Catalog No. This gene is a member of the UBA domain family, whose members include proteins A4726 having connections to ubiquitin and the ubiquitination pathway. The ubiquitin associated domain is thought to be a non-covalent ubiquitin binding domain consisting Observed MW of a compact three helix bundle. This particular protein originates from a gene locus in a 55kDa refined region on chromosome 9 undergoing loss of heterozygosity in nasopharyngeal carcinoma (NPC). Taking into account its cytogenetic location, this UBA domain family Calculated MW member is being studies as a putative target for mutation in nasopharyngeal 48kDa/55kDa/58kDa/61kDa carcinomas. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. Category Primary antibody Applications WB, IHC, FC Cross-Reactivity Human, Mouse Recommended Dilutions Immunogen Information WB 1:500 - 1:1000 Gene ID Swiss Prot 51271 Q9NZ09 IHC 1:20 - 1:50 Immunogen 1:20 - 1:50 FC A synthetic Peptide of human UBAP1 Synonyms UBAP1;NAG20;UAP;UBAP;UBAP-1 Contact Product Information www.abclonal.com Source Isotype Purification Rabbit IgG Affinity purification Storage Store at 4℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, pH7.3. Validation Data Western blot analysis of extracts of mouse liver, using UBAP1 antibody (A4726). Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Antibody | Protein | ELISA Kits | Enzyme | NGS | Service For research use only. -
A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated. -
Large Scale Organization of Chromatin
LARGE SCALE ORGANIZATION OF CHROMATIN MARIO Nicodemi Dip.to di Fisica, Uni.NA “Federico II”, INFN In the cell nucleus chromosomes have a complex architecture serving vital functional purposes. Problem: how is their 3D structure orchestrated? Our contribution: a model of the molecular mechanisms of their self- organization by use of classical polymer physics. (Mirò, Chiffres & Constellations 1941) Research collaborators MRC, Imperial College, London Ana Pombo,, Mita Chotalia, Ines de Santiago, Liron-Mark Lavitas, Sheila Xie, Kedar Natarajan, Carmelo Ferrai, Robert Beagrie, ... Biology, McGill, CA Josée Dostie, James Fraser Physics, Univ. di Napoli, Italy Mariano Barbieri, Ilaria Cataudella, Antonio Scialdone, Melania Barile, Paolo Casale, Valentino Bianco, Emanuela de Falco, Deborah Pallotti, Gaetano Pellegrino, Andrea Piccolo, ... Chromatin organization (I) (A) Linear expression units in compact genomes v.s. spatially assembled units in complex genomes. (B) Colocalization of coregulated genes. (C) ChromatinGene localization organizationat transcription factories (TFs). Example: the Xicʼs of the X Chromosome territories and map chrom.s colocalize at XCI (Heard et al.; Lee et al. ʻ07) Chromatin organizationNuclear scale (I) (A) Linear expression units in compact genomes v.s. spatially assembled units in complex genomes. (B) Colocalization of coregulated genes. (C) Gene localization at transcription factories (TFs). Colocalization of coregulated genes at transcription factories Example: the Xicʼs of the X Transcription chrom.s colocalize at XCI Factory (Heard et al.; Lee et al. ʻ07) (Pictures: Dekker et al. Science ʻ08) Distal regulatory elements Gene Gene Expression Units Assembly of expression units Gene scale (Pictures: Bolzer et al. PLoS Bio. ʼ05; Dekker et al. Science ʼ08) (Pictures: Dekker et al. -
Genetic Analysis of Over One Million People Identifies 535 New Loci Associated with Blood 2 Pressure Traits
1 Genetic analysis of over one million people identifies 535 new loci associated with blood 2 pressure traits. 3 4 Table of Contents 5 SUPPLEMENTARY TABLES LEGENDS……………………………………………………………………………….…….3 6 SUPPLEMENTARY FIGURES LEGENDS ........................................................................................ 6 7 SUPPLEMENTARY METHODS ................................................................................................... 10 8 1. UK Biobank data .................................................................................................................................... 10 9 2. UKB Quality Control ............................................................................................................................... 10 10 3. Phenotypic data ..................................................................................................................................... 11 11 4. UKB analysis ........................................................................................................................................... 11 12 5. Genomic inflation and confounding ....................................................................................................... 12 13 6. International Consortium for Blood Pressure (ICBP) GWAS .................................................................... 12 14 7. Meta-analyses of discovery datasets ..................................................................................................... 13 15 8. Linkage Disequilibrium calculations ...................................................................................................... -
Systems Consequences of Amplicon Formation in Human Breast Cancer
Downloaded from genome.cshlp.org on September 25, 2021 - Published by Cold Spring Harbor Laboratory Press Research Systems consequences of amplicon formation in human breast cancer Koichiro Inaki,1,2,9 Francesca Menghi,1,2,9 Xing Yi Woo,1,9 Joel P. Wagner,1,2,3 4,5 1 2 Pierre-Etienne Jacques, Yi Fang Lee, Phung Trang Shreckengast, Wendy WeiJia Soon,1 Ankit Malhotra,2 Audrey S.M. Teo,1 Axel M. Hillmer,1 Alexis Jiaying Khng,1 Xiaoan Ruan,6 Swee Hoe Ong,4 Denis Bertrand,4 Niranjan Nagarajan,4 R. Krishna Murthy Karuturi,4,7 Alfredo Hidalgo Miranda,8 andEdisonT.Liu1,2,7 1Cancer Therapeutics and Stratified Oncology, Genome Institute of Singapore, Genome, Singapore 138672, Singapore; 2The Jackson Laboratory for Genomic Medicine, Farmington, Connecticut 06030, USA; 3Department of Biological Engineering, Massachusetts Institute of Technology, Cambridge, Massachusetts 02139, USA; 4Computational and Systems Biology, Genome Institute of Singapore, Genome, Singapore 138672, Singapore; 5Universite de Sherbrooke, Sherbrooke, Quebec, J1K 2R1, Canada; 6Genome Technology and Biology, Genome Institute of Singapore, Genome, Singapore 138672, Singapore; 7The Jackson Laboratory, Bar Harbor, Maine 04609, USA; 8National Institute of Genomic Medicine, Periferico Sur 4124, Mexico City 01900, Mexico Chromosomal structural variations play an important role in determining the transcriptional landscape of human breast cancers. To assess the nature of these structural variations, we analyzed eight breast tumor samples with a focus on regions of gene amplification using mate-pair sequencing of long-insert genomic DNA with matched transcriptome profiling. We found that tandem duplications appear to be early events in tumor evolution, especially in the genesis of amplicons. -
UBAP1 Antibody
Product Datasheet UBAP1 Antibody Catalog No: #40173 Orders: [email protected] Description Support: [email protected] Product Name UBAP1 Antibody Host Species Rabbit Clonality Polyclonal Purification Antigen affinity purification. Applications IHC Species Reactivity Hu Specificity The antibody detects endogenous levels of total UBAP1 protein. Immunogen Type Protein Immunogen Description Fusion protein of human ubiquitin associated protein 1 Target Name UBAP1 Other Names UAP; UBAP; NAG20; UBAP-1 Accession No. Swiss-Prot:Q9NZ09Gene Accssion:BC098141 Concentration 1.1mg/ml Formulation Rabbit IgG in pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage Store at -20°C Application Details Immunohistochemistry:1:25-1:100 Images Immunohistochemical analysis of paraffin-embedded Human liver cancer tissue using #40173 at dilution 1/20. Background This gene is a member of the UBA domain family, whose members include proteins having connections to ubiquitin and the ubiquitination pathway. The ubiquitin associated domain is thought to be a non-covalent ubiquitin binding domain consisting of a compact three helix bundle. This particular protein originates from a gene locus in a refined region on chromosome 9 undergoing loss of heterozygosity in nasopharyngeal carcinoma (NPC). Taking into account its cytogenetic location, this UBA domain family member is being studies as a putative target for mutation in nasopharyngeal carcinomas. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. Address: 8400 Baltimore Ave., Suite 302, College Park, MD 20740, USA http://www.sabbiotech.com 1 Note: This product is for in vitro research use only and is not intended for use in humans or animals. Address: 8400 Baltimore Ave., Suite 302, College Park, MD 20740, USA http://www.sabbiotech.com 2. -
Structure-To-Function Computational Prediction of a Subset of Ribosomal Proteins for the Small Ribosome Subunit
International Journal of Bioscience, Biochemistry and Bioinformatics Structure-to-Function Computational Prediction of a Subset of Ribosomal Proteins for the Small Ribosome Subunit Edmund Ui-Hang Sim*, Chin-Ming Er Department of Molecular Biology, Faculty of Resource Science and Technology, Universiti Malaysia Sarawak, Kota Samarahan, Sarawak, Malaysia. * Corresponding author. Tel.: +60-82-583041; email: [email protected] Manuscript submitted July 18, 2014; accepted January 28, 2015. doi: 10.17706/ijbbb.2015.5.2.100-110 Abstract: Extra-ribosomal functions of ribosomal proteins have been widely accepted albeit an incomplete understanding of these roles. Standard experimental studies have limited usefulness in defining the complete biological significance of ribosomal proteins. An alternative strategy is via in silico analysis. Here, we sought a sequence-to-structure-to-function approach to computationally predict the extra-ribosomal functions of a subset of ribosomal proteins of the small ribosome subunit, namely RPS12, RPS19, RPS20 and RPS24. Three-dimensional structure constructed from amino acid sequence was precisely matched with structural neighbours to extrapolate possible functions. Our analysis reveals new logical roles for these ribosomal proteins, of which represent important information for planning experimental and further in silico studies to elucidate their physiological roles. Key words: Extra-ribosomal functions, RPS12, RPS19, RPS20, RPS24, structural neighbours, 3D modelling. 1. Introduction Ribosomal proteins (RPs) are originally construed as only essential components of the ribosomes involved in protein biosynthesis. However, since the 1990s, their extra-ribosomal roles have been discussed revealing their association with congenital diseases and a wide range of cancers [1], [2]. For instance, over-expression of RPS12 has been observed in the tissues of colon adenocarcinomas and adenomatous polyps [3], squamous cell carcinoma of the human uterine cervix [4], and gastric cancer [5]. -
Hsa-Mir-21-5P
Supporting Information An exosomal urinary miRNA signature for early diagnosis of renal fibrosis in Lupus Nephritis 1 2 2 1 1 Cristina Solé , Teresa Moliné , Marta Vidal , Josep Ordi-Ros , Josefina Cortés-Hernández 1Hospital Universitari Vall d’Hebron, Vall d’Hebron Research Institute (VHIR), Lupus Unit, Barcelona, Spain; [email protected] (C.S); [email protected] (J.O-R.); [email protected] (J.C-H.) 2 Hospital Universitari Vall d’Hebron, Department of Renal Pathology, Barcelona, Spain; [email protected] (T.M); [email protected] (M.V). INDEX 1. SI Materials and Methods......................................................................................3 2. SI References…………………………………………………………………………….7 2. SI Figures................................................................................................................8 4. SI Tables................................................................................................................21 2 SI Materials and Methods Patients and samples Patients with biopsy-proven active LN were recruited from the Lupus Unit at Vall d’Hebron Hospital (N=45). All patients fulfilled at least 4 of the American College of rheumatology (ACR) revised classification criteria for SLE [1]. Healthy donors were used as controls (N=20). Urine samples were collected from each patient 1 day before renal biopsy and processed immediately to be stored at -80ºC. Patients with urinary tract infection, diabetes mellitus, pregnancy, malignancy and non-lupus-related renal failure were excluded. In addition, key laboratory measurements were obtained including complement levels (C3 and C4), anti-double-stranded DNA (anti-dsDNA), 24-h proteinuria, blood urea nitrogen (BUN), serum creatinine and the estimated glomerular filtration ratio (eGFR) using the Chronic Kidney Disease Epidemiology Collaboration (CKD-EPI) formula [2]. SLE disease activity was assessed by the SLE Disease Activity Index 2000 update (SLEDAI-2Ks; range 0–105) [3]. -
Vacuolar-Sorting Protein SNF8 (1-258, His-Tag) Human Protein Product Data
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for AR50418PU-S Vacuolar-sorting protein SNF8 (1-258, His-tag) Human Protein Product data: Product Type: Recombinant Proteins Description: Vacuolar-sorting protein SNF8 (1-258, His-tag) human recombinant protein, 0.1 mg Species: Human Expression Host: E. coli Tag: His-tag Predicted MW: 31.4 kDa Concentration: lot specific Purity: >90% by SDS - PAGE Buffer: Presentation State: Purified State: Liquid purified protein Buffer System: 20 mM Tris-HCl buffer, pH8.0, 50% glycerol, 2mM DTT, 200mM NaCl Preparation: Liquid purified protein Protein Description: Recombinant human SNF8 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques. Storage: Store undiluted at 2-8°C for one week or (in aliquots) at -20°C to -80°C for longer. Avoid repeated freezing and thawing. Stability: Shelf life: one year from despatch. RefSeq: NP_001304121 Locus ID: 11267 UniProt ID: Q96H20 Cytogenetics: 17q21.32 Synonyms: Dot3; EAP30; VPS22 Summary: The protein encoded by this gene is a component of the endosomal sorting complex required for transport II (ESCRT-II), which regulates the movement of ubiquitinylated transmembrane proteins to the lysosome for degradation. This complex also interacts with the RNA polymerase II elongation factor (ELL) to overcome the repressive effects of ELL on RNA polymerase II activity. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015] This product is to be used for laboratory only. -
Anti-VPS25 Monoclonal Antibody, Clone T3 (DCABH-13967) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use
Anti-VPS25 monoclonal antibody, clone T3 (DCABH-13967) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description VPS25, VPS36 (MIM 610903), and SNF8 (MIM 610904) form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. VPS25, VPS36, and SNF8 are also associated in a multiprotein complex with RNA polymerase II elongation factor (ELL; MIM 600284) (Slagsvold et al., 2005 [PubMed 15755741]; Kamura et al., 2001 [PubMed 11278625]). Immunogen VPS25 (AAH06282.1, 1 a.a. ~ 176 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Isotype IgG1 Source/Host Mouse Species Reactivity Human Clone T3 Conjugate Unconjugated Applications Western Blot (Cell lysate); Western Blot (Recombinant protein); ELISA Sequence Similarities MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNN VKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFT LYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF Size 1 ea Buffer In ascites fluid Preservative None Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION Gene Name VPS25 vacuolar protein sorting 25 homolog (S. cerevisiae) [ Homo sapiens ] 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved Official Symbol VPS25 Synonyms VPS25; vacuolar protein sorting 25 homolog (S. cerevisiae); -
Jhaldeman Dissertation
Creation of Versatile Cloning Platforms for Transgene Expression and Epigenome Editing and Their Application to Pancreatic Islet Biology by Jonathan Mark Haldeman Department of Pharmacology and Cancer Biology Duke University Date:_______________________ Approved: ___________________________ Christopher Newgard, Supervisor ___________________________ Deborah Muoio ___________________________ Donald McDonnell ___________________________ Qi-Jing Li ___________________________ Praveen Sethupathy Dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy in the Department of Pharmacology and Cancer Biology in the Graduate School of Duke University 2018 i v ABSTRACT Creation of Versatile Cloning Platforms for Transgene Expression and Epigenome Editing and Their Application to Pancreatic Islet Biology by Jonathan Mark Haldeman Department of Pharmacology and Cancer Biology Duke University Date:_______________________ Approved: ___________________________ Christopher Newgard, Supervisor ___________________________ Deborah Muoio ___________________________ Donald McDonnell ___________________________ Qi-Jing Li ___________________________ Praveen Sethupathy An abstract of a dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy in the Department of Pharmacology and Cancer Biology in the Graduate School of Duke University 2018 Copyright by Jonathan Mark Haldeman 2018 Abstract Insulin secreting β-cells within the pancreatic islets of Langerhans are vital to maintaining glycemic control. β-cell functional mass is lost during the progression to both Type 1 and Type 2 diabetes mellitus, resulting in hyperglycemia. Therefore, a major goal of diabetes research is to uncover pathways that can be exploited to induce β-cell replication while simultaneously maintaining β-cell function. We previously reported that adenovirus-mediated overexpression of the transcription factor PDX1 is sufficient to induce β-cell replication, but underlying mechanisms remain to be resolved. -
Systemic Investigation of Promoter-Wide Methylome and Genome Variations in Gout
International Journal of Molecular Sciences Article Systemic Investigation of Promoter-wide Methylome and Genome Variations in Gout Chia-Chun Tseng 1,2, Man Chun Wong 3, Wei-Ting Liao 3,4,*, Chung-Jen Chen 5, Su-Chen Lee 6, Jeng-Hsien Yen 1,2,7,8 and Shun-Jen Chang 9,* 1 Graduate Institute of Clinical Medicine, College of Medicine, Kaohsiung Medical University, Kaohsiung 80708, Taiwan; [email protected] (C.-C.T.); [email protected] (J.-H.Y.) 2 Division of Rheumatology, Department of Internal Medicine, Kaohsiung Medical University Hospital, Kaohsiung 80756, Taiwan 3 Department of Biotechnology, College of Life Science, Kaohsiung Medical University, Kaohsiung 80708, Taiwan; [email protected] 4 Department of Medical Research, Kaohsiung Medical University Hospital, Kaohsiung 80756, Taiwan 5 Department of Internal Medicine, Kaohsiung Municipal Ta-Tung Hospital, Kaohsiung 80145, Taiwan; [email protected] 6 Laboratory Diagnosis of Medicine, College of Medicine, Kaohsiung Medical University, Kaohsiung 80708, Taiwan; [email protected] 7 Institute of Biomedical Sciences, National Sun Yat-Sen University, Kaohsiung 80424, Taiwan 8 Department of Biological Science and Technology, National Chiao-Tung University, Hsinchu 30010, Taiwan 9 Department of Kinesiology, Health and Leisure Studies, National University of Kaohsiung, Kaohsiung 81148, Taiwan * Correspondence: [email protected] (W.-T.L.); [email protected] (S.-J.C.); Tel.: +886-7-3121101 (W.-T.L.); +886-7-5916679 (S.-J.C.); Fax: +886-7-3125339 (W.-T.L.); +886-7-5919264 (S.-J.C.) Received: 19 May 2020; Accepted: 29 June 2020; Published: 1 July 2020 Abstract: Current knowledge of gout centers on hyperuricemia.