DOCSLIB.ORG

Desmosomal Glycoprotein DGI, a Component of Intercellular Cell

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Desmosomal Glycoprotein DGI, a Component of Intercellular Cell Proc. Nadl. Acad. Sci. USA Vol. 88, pp. 47%-4800, June 1991 Cell Biology Desmosomal glycoprotein DGI, a component of intercellular desmosome junctions, is related to the cadherin family of cell adhesion molecules (desmosome/desmoglein/ceD-cell junction) G. N. WHEELER*, A. E. PARKER*, C. L. THOMAS*, P. ATALIOTIS*, D. POYNTER*, J. ARNEMANN*, A. J. RUTMAN*, S. C. PIDSLEY*, F. M. WATTt, D. A. REES*, R. S. BUXTON*, AND A. I. MAGEE*t *National Institute for Medical Research, The Ridgeway, Mill Hill, London NW7 1AA, United Kingdom; and tImperial Cancer Research Fund, Lincoln's Inn Fields, London WC2A 3PX, United Kingdom Communicated by James Gowans, February 4, 1991 (received for review November 22, 1990) ABSTRACT Among the variety ofspecialized intercellular with the plaque or intermediate filaments. In contrast, the junctions, those of the adherens type have the most obvious cadherin family of proteins has been shown to codistribute association with cytoskeletal elements. This may be with the with actin bundles in the adherens type of cell junction (3). actin microfilanent system as in the zonula adherens or with intermediate ifiaments as in the macula adherens, or desmo- METHODS some. In the former case, it is clear that transmembrane glycoproteins of the cadherin family are important adhesive Generation and Screening ofAntibodies. Desmosomes were components of the molecular assembly. We now show for isolated from bovine muzzle epidermis (4). Rabbit anti-DGI desmosomes that a major glycoprotein component (desmo- serum was generated against DGI purified by SDS/PAGE somal glycoprotein DGI) has extensive homology with the and electroelution; its specificity was similar to the guinea pig cadherins, defining an extended fmily, but also has unique sera previously described (4). The serum specifically recog- features in its cytoplasmic domain that are likely to be relevant nized DGI on immunoblots of cow's nose desmosomes, to the association with intermediate rather than actin filaments. precipitated a 150-kDa protein from metabolically labeled A novel 282-residue extension contains repeats of --29 amino MDCK canine kidney epithelial cells, and stained MDCK acid residues predicted to have an antiparallel P-sheet struc- cells in a punctate cell junctional pattern by immunofluores- ture, followed by a glycine-rich sequence. As in the cadherins, cence microscopy (data not shown; ref. 4). Polyclonal anti- the extracellular domain contains possible Ca2+-binding se- bodies to DGI were affinity-purified on DGI immobilized on quences and a potential protease processing site. The cell Sepharose CL-4B (CNBr-Sepharose; Pharmacia). adhesion recognition region (His-Ala-Val) of the cadherins is A DGI-specific IgG mouse hybridoma (3D1) was generated modified to Arg-Ala-Leu. against bovine DGI. The antibody produced by this hybrid- oma recognized DGI on immunoblots of desmosomes, but The molecules that are involved in cell-cell adhesion are now did not immunoprecipitate well, and gave distinct punctate becoming known. Thus the Ca2l-dependent cadherin cell cell border staining on epithelial cell types, especially if the adhesion molecules (CAMs) have been distinguished from cells were unfixed (data not shown). Cell permeabilization the immunoglobulin-related proteins such as neural (N-) was required for staining, suggesting that the antibody rec- CAM (1). Little is known, however, of the molecules in- ognized intracellular epitopes (data not shown). volved in adhesion mediated by the desmosome, which is one For the preparation of antibodies to TrpE fusion proteins, of the major adhesive junctions of epithelial tissues with a a Sty I-Xho I fragment [base pairs (bp) 2218-3422] from clone characteristic and well-defined morphology (2). Two classes G4, encoding the intracellular part of the DGI molecule, of desmosomal proteins are candidates for a role in cell including the DGI-specific repeats, was subcloned in frame adhesion: (i) the glycosylated proteins DGII (Mr 120,000) and into the Xba I-Sal I restriction sites ofthe pATH2 expression DGIII (Mr 110,000), which have been shown to be related to vector (5). The TrpE fusion protein was expressed, separated one another by peptide mapping and immunological criteria; in a polyacrylamide gel, excised, and electroeluted. Rabbits and (it) another glycosylated protein, DGI (desmoglein; Mr were immunized and the resulting sera were preabsorbed 150,000) (2). These proteins are, like the cadherins, Ca2 - with Sepharose-bound proteins from Escherichia coli ex- binding transmembrane proteins, unlike other desmosomal pressing the pATH2 vector alone. Immunoblot analysis of proteins such as plakoglobin and the desmoplakins, which are fusion proteins expressed by putative DGI recombinants was present in an electron-dense plaque zone underneath the cell carried out according to Price et al. (6). membrane. These latter proteins may provide a link to the Peptide Sequencing. Bovine DGI purified by SDS/PAGE intermediate filaments with which desmosomes interact. and electroelution was dialyzed against 50 mM Mops buffer Here we provide detailed information on the structure of (pH 7) containing 0.05% SDS and was concentrated using an the desmosomal glycoprotein DGI, through the isolation and Amicon CX30 immersible concentrator. The protein was sequence analysis of cDNA clones.§ Our results show that digested with trypsin or Staphylococcus aureus V8 protease DGI is indeed related to the cadherin family of cell adhesion (Boehringer Mannheim) (1-5% enzyme/substrate weight ra- proteins, albeit more distantly than other members of the tio) overnight at 370C. Fragments were resolved by SDS/ family, and is thus implicated as having a role in adhesion. PAGE and transferred to Immobilon membrane (0.45 Eum; DGI differs from the cadherins in having a unique large Millipore). After staining with Coomassie brilliant blue, the cytoplasmic domain, which may be involved in interactions Abbreviation: CAM, cell adhesion molecule. The publication costs ofthis article were defrayed in part by page charge tTo whom reprint requests should be addressed. payment. This article must therefore be hereby marked "advertisement" §The sequence reported in this paper has been deposited in the in accordance with 18 U.S.C. §1734 solely to indicate this fact. GenBank data base (accession no. X56654). 4796 Downloaded by guest on September 24, 2021 Cell Biology: Wheeler et al. Proc. Natl. Acad. Sci. USA 88 (1991) 4797 fragments were cut out and sequenced using an Applied 30 min at 65°C. They were then dried and exposed to Kodak Biosystems 477A sequenator with on-line phenylthiohydan- XAR-5 film. toin (PTH) analyzer model 120A. For Southern blotting, human genomic DNA was prepared Library Construction and Screening. A Agtll cDNA library from EDTA-treated blood of healthy male donors according (Clontech) prepared using mRNA from cultured human ke- to standard procedures (9). DNA (5 ,ug) was digested with ratinocytes was screened with affinity-purified anti-DGI an- various restriction enzymes, electrophoresed in 1% agarose tibodies (see above), essentially as detailed (7). The initial G1 gels, and transferred to Hybond-N membranes. Filters were clone was plaque-purified and shown to have an insert size of hybridized with various fragments of the DGI cDNA, 32p_ 1.1 kilobases (kb). To obtain clones covering more of the labeled by the random primer method (9). PCR-mediated coding sequence, we constructed a cDNA library in Agtll, amplification ofcDNA fragments was carried out in a volume using random hexanucleotide primers with 1 Ag of mRNA of 50 ,ud according to the supplier's recommendation (Cetus), isolated from human keratinocytes (Amersham cDNA syn- using cDNA clone pG4 as a source. thesis and cloning kit). This library and the poly(A)+ library DNASequencing. Phage A DNA was purifiedfromplate lysates were probed with a 32P-labeled G1 cDNA and yielded several (9), digested with EcoRI, separated in agarose gels, purified using overlapping clones. Geneclean (Bio 101, LaJolla, CA), and subcloned into M13 mplO Northern and Southern Analysis. For Northern blot anal- and pBluescript KS(+). The DNA sequence was determined by ysis, poly(A)+ RNA was isolated from cultured human epi- the dideoxynucleotide chain-termination method (10) using Se- dermal keratinocytes essentially by the guanidinium isothio- quenase (United States Biochemical). The initial G1 clone was cyanate method of Chirgwin et al. (8). Total RNA was sequenced by subcloning restriction fragments into M13. Sub- isolated from a myeloma cell line (JKAg8) that does not sequent clones were sequenced using appropriate oligodeoxy- express DGI. The RNA was electrophoresed in a 1% agarose nucleotides (synthesized with an Applied Biosystems synthe- gel containing 2.2 M formaldehyde and transferred to Hy- sizer) as primers. The whole ofclone G4 was sequenced in both bond-N by standard procedures (9). Hybridizations were directions. carried out for 16 hr at 480C with 32P-labeled probes in 1.5x SSC (0.225 M NaCI/0.0225 M trisodium citrate, pH 7.0) RESULTS 50%o 1% dried milk containing (vol/vol) formamide, (wt/vol) Isolation and Characterization of DGI cDNA. A human (Marvel, U.K.), 50 mM Tris Cl (pH 7.6), 3% (wt/vol) SDS, keratinocyte Agtll library was screened using affinity- 10% (wt/vol) dextran sulfate, and boiled salmon sperm DNA purified rabbit anti-DGI antibodies (see Methods). Screening at 25 u&g/ml. Filters were washed once with lx SSC/0.2% of -150,000 recombinants identified 3 positive clones. The SDS for 30 min and three times with 0.lx SSC/O.1% SDS for fusion proteins encoded by these recombinants were ana- lyzed by Western immunoblotting; the results were the same 13, i.: ',All '.' for all three clones. The fusion protein of A clone G1 showed I a molecular mass of -150 kDa (Fig. 1A, lane 1) when probed A with an anti-l3-galactosidase antibody; the lower bands were probably due to degradation. The fusion protein reacted 21)0 - A\[ A.- ki - _ *f: .:,.. C4. f, 0 fi! fo M,,.* 6 ': 68 - D LERlH C DPLGYGNVTVTESYTTSDTLKPSVHVHDNRPASNVWVTERWVGPI SGADLHGMLEMPDLRDGS 1 111111 LIYFNVTVTEWYT V8 peptide 1111111111i 1111111111 VVGPISGADLQGMLEMPDLRDGS 11 I 11 tryptic peptide YTSSGTL V8 peptide FIG.
Load more

Recommended publications
  • Vocabulario De Morfoloxía, Anatomía E Citoloxía Veterinaria
    Vocabulario de Morfoloxía, anatomía e citoloxía veterinaria (galego-español-inglés) Servizo de Normalización Lingüística Universidade de Santiago de Compostela COLECCIÓN VOCABULARIOS TEMÁTICOS N.º 4 SERVIZO DE NORMALIZACIÓN LINGÜÍSTICA Vocabulario de Morfoloxía, anatomía e citoloxía veterinaria (galego-español-inglés) 2008 UNIVERSIDADE DE SANTIAGO DE COMPOSTELA VOCABULARIO de morfoloxía, anatomía e citoloxía veterinaria : (galego-español- inglés) / coordinador Xusto A. Rodríguez Río, Servizo de Normalización Lingüística ; autores Matilde Lombardero Fernández ... [et al.]. – Santiago de Compostela : Universidade de Santiago de Compostela, Servizo de Publicacións e Intercambio Científico, 2008. – 369 p. ; 21 cm. – (Vocabularios temáticos ; 4). - D.L. C 2458-2008. – ISBN 978-84-9887-018-3 1.Medicina �������������������������������������������������������������������������veterinaria-Diccionarios�������������������������������������������������. 2.Galego (Lingua)-Glosarios, vocabularios, etc. políglotas. I.Lombardero Fernández, Matilde. II.Rodríguez Rio, Xusto A. coord. III. Universidade de Santiago de Compostela. Servizo de Normalización Lingüística, coord. IV.Universidade de Santiago de Compostela. Servizo de Publicacións e Intercambio Científico, ed. V.Serie. 591.4(038)=699=60=20 Coordinador Xusto A. Rodríguez Río (Área de Terminoloxía. Servizo de Normalización Lingüística. Universidade de Santiago de Compostela) Autoras/res Matilde Lombardero Fernández (doutora en Veterinaria e profesora do Departamento de Anatomía e Produción Animal.
    [Show full text]
  • Plakoglobin Is Required for Effective Intermediate Filament Anchorage to Desmosomes Devrim Acehan1, Christopher Petzold1, Iwona Gumper2, David D
    ORIGINAL ARTICLE Plakoglobin Is Required for Effective Intermediate Filament Anchorage to Desmosomes Devrim Acehan1, Christopher Petzold1, Iwona Gumper2, David D. Sabatini2, Eliane J. Mu¨ller3, Pamela Cowin2,4 and David L. Stokes1,2,5 Desmosomes are adhesive junctions that provide mechanical coupling between cells. Plakoglobin (PG) is a major component of the intracellular plaque that serves to connect transmembrane elements to the cytoskeleton. We have used electron tomography and immunolabeling to investigate the consequences of PG knockout on the molecular architecture of the intracellular plaque in cultured keratinocytes. Although knockout keratinocytes form substantial numbers of desmosome-like junctions and have a relatively normal intercellular distribution of desmosomal cadherins, their cytoplasmic plaques are sparse and anchoring of intermediate filaments is defective. In the knockout, b-catenin appears to substitute for PG in the clustering of cadherins, but is unable to recruit normal levels of plakophilin-1 and desmoplakin to the plaque. By comparing tomograms of wild type and knockout desmosomes, we have assigned particular densities to desmoplakin and described their interaction with intermediate filaments. Desmoplakin molecules are more extended in wild type than knockout desmosomes, as if intermediate filament connections produced tension within the plaque. On the basis of our observations, we propose a particular assembly sequence, beginning with cadherin clustering within the plasma membrane, followed by recruitment of plakophilin and desmoplakin to the plaque, and ending with anchoring of intermediate filaments, which represents the key to adhesive strength. Journal of Investigative Dermatology (2008) 128, 2665–2675; doi:10.1038/jid.2008.141; published online 22 May 2008 INTRODUCTION dense plaque that is further from the membrane and that Desmosomes are large macromolecular complexes that mediates the binding of intermediate filaments.
    [Show full text]
  • Supplementary Table 1: Adhesion Genes Data Set
    Supplementary Table 1: Adhesion genes data set PROBE Entrez Gene ID Celera Gene ID Gene_Symbol Gene_Name 160832 1 hCG201364.3 A1BG alpha-1-B glycoprotein 223658 1 hCG201364.3 A1BG alpha-1-B glycoprotein 212988 102 hCG40040.3 ADAM10 ADAM metallopeptidase domain 10 133411 4185 hCG28232.2 ADAM11 ADAM metallopeptidase domain 11 110695 8038 hCG40937.4 ADAM12 ADAM metallopeptidase domain 12 (meltrin alpha) 195222 8038 hCG40937.4 ADAM12 ADAM metallopeptidase domain 12 (meltrin alpha) 165344 8751 hCG20021.3 ADAM15 ADAM metallopeptidase domain 15 (metargidin) 189065 6868 null ADAM17 ADAM metallopeptidase domain 17 (tumor necrosis factor, alpha, converting enzyme) 108119 8728 hCG15398.4 ADAM19 ADAM metallopeptidase domain 19 (meltrin beta) 117763 8748 hCG20675.3 ADAM20 ADAM metallopeptidase domain 20 126448 8747 hCG1785634.2 ADAM21 ADAM metallopeptidase domain 21 208981 8747 hCG1785634.2|hCG2042897 ADAM21 ADAM metallopeptidase domain 21 180903 53616 hCG17212.4 ADAM22 ADAM metallopeptidase domain 22 177272 8745 hCG1811623.1 ADAM23 ADAM metallopeptidase domain 23 102384 10863 hCG1818505.1 ADAM28 ADAM metallopeptidase domain 28 119968 11086 hCG1786734.2 ADAM29 ADAM metallopeptidase domain 29 205542 11085 hCG1997196.1 ADAM30 ADAM metallopeptidase domain 30 148417 80332 hCG39255.4 ADAM33 ADAM metallopeptidase domain 33 140492 8756 hCG1789002.2 ADAM7 ADAM metallopeptidase domain 7 122603 101 hCG1816947.1 ADAM8 ADAM metallopeptidase domain 8 183965 8754 hCG1996391 ADAM9 ADAM metallopeptidase domain 9 (meltrin gamma) 129974 27299 hCG15447.3 ADAMDEC1 ADAM-like,
    [Show full text]
  • Cell Biology of Tight Junction Barrier Regulation and Mucosal Disease
    Downloaded from http://cshperspectives.cshlp.org/ on October 1, 2021 - Published by Cold Spring Harbor Laboratory Press Cell Biology of Tight Junction Barrier Regulation and Mucosal Disease Aaron Buckley and Jerrold R. Turner Departments of Pathology and Medicine (Gastroenterology), Brigham and Women’s Hospital and Harvard Medical School, Boston, Massachusetts 02115 Correspondence: [email protected] Mucosal surfaces are lined by epithelial cells. In the intestine, the epithelium establishes a selectively permeable barrier that supports nutrient absorption and waste secretion while preventing intrusion by luminal materials. Intestinal epithelia therefore play a central role in regulating interactions between the mucosal immune system and luminal contents, which include dietary antigens, a diverse intestinal microbiome, and pathogens. The paracellular space is sealed by the tight junction, which is maintained by a complex network of protein interactions. Tight junction dysfunction has been linked to a variety of local and systemic diseases. Two molecularly and biophysically distinct pathways across the intestinal tight junc- tion are selectively and differentially regulated by inflammatory stimuli. This review discusses the mechanisms underlying these events, their impact on disease, and the potential of using these as paradigms for development of tight junction-targeted therapeutic interventions. ucosal surfaces and the epithelial cells that adherens). The tight junction is a selectively Mline them are present at sites where tissues permeable barrier that generally represents the interface directly with the external environment rate-limiting step of paracellular transport. The or internal compartments that are contiguous adherens junction and desmosome provide es- with the external environment. Examples in- sential adhesive and mechanical properties that clude the gastrointestinal tract, the pulmonary contribute to barrier function but do not seal tree, and the genitourinary tract.
    [Show full text]
  • Hemidesmosomes Show Abnormal Association with the Keratin Filament Network in Junctional Forms of Epidermolysis Bullosa
    View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Elsevier - Publisher Connector Hemidesmosomes Show Abnormal Association with the Keratin Filament Network in Junctional Forms of Epidermolysis Bullosa James R. McMillan, John A. McGrath, Michael J. Tidman,* and Robin A. J. Eady Department of Cell Pathology, St John’s Institute of Dermatology, UMDS, St Thomas’s Hospital, London, U.K.; *Department of Dermatology, Royal Infirmary of Edinburgh, Edinburgh, U.K. Junctional epidermolysis bullosa is a group of hereditary respectively. In junctional epidermolysis bullosa with bullous disorders resulting from defects in several hemi- pyloric atresia (α6β4 abnormalities, n J 3) the values desmosome-anchoring filament components. Because were also reduced [41.8% K 7.0 (p < 0.001) and 44.5% hemidesmosomes are involved not only in keratinocyte- K 5.7 (p < 0.001), respectively]. In the non-Herlitz group extracellular matrix adherence, but also in normal (laminin 5 mutations, n J 3) the counts were 66.7% K anchorage of keratin intermediate filaments to the basal 7.1 (p > 0.05) and 70.5% K 8.5 (p < 0.05), and in keratinocyte membrane, we questioned whether this skin from patients with bullous pemphigoid antigen 2 intracellular function of hemidesmosomes was also per- mutations (n J 3) the counts were 54.3% K 13.8 (p < 0.01) turbed in junctional epidermolysis bullosa. We used and 57.1% K 13.9 (p < 0.01). In epidermolysis bullosa quantitative electron microscopic methods to assess cer- simplex associated with plectin mutations the values were tain morphologic features of hemidesmosome–keratin 31.9% K 8.9 (p < 0.001) for keratin intermediate filaments intermediate filaments interactions in skin from normal association and 39.9% K 7.1 (p < 0.001) for inner plaques.
    [Show full text]
  • Nomina Histologica Veterinaria, First Edition
    NOMINA HISTOLOGICA VETERINARIA Submitted by the International Committee on Veterinary Histological Nomenclature (ICVHN) to the World Association of Veterinary Anatomists Published on the website of the World Association of Veterinary Anatomists www.wava-amav.org 2017 CONTENTS Introduction i Principles of term construction in N.H.V. iii Cytologia – Cytology 1 Textus epithelialis – Epithelial tissue 10 Textus connectivus – Connective tissue 13 Sanguis et Lympha – Blood and Lymph 17 Textus muscularis – Muscle tissue 19 Textus nervosus – Nerve tissue 20 Splanchnologia – Viscera 23 Systema digestorium – Digestive system 24 Systema respiratorium – Respiratory system 32 Systema urinarium – Urinary system 35 Organa genitalia masculina – Male genital system 38 Organa genitalia feminina – Female genital system 42 Systema endocrinum – Endocrine system 45 Systema cardiovasculare et lymphaticum [Angiologia] – Cardiovascular and lymphatic system 47 Systema nervosum – Nervous system 52 Receptores sensorii et Organa sensuum – Sensory receptors and Sense organs 58 Integumentum – Integument 64 INTRODUCTION The preparations leading to the publication of the present first edition of the Nomina Histologica Veterinaria has a long history spanning more than 50 years. Under the auspices of the World Association of Veterinary Anatomists (W.A.V.A.), the International Committee on Veterinary Anatomical Nomenclature (I.C.V.A.N.) appointed in Giessen, 1965, a Subcommittee on Histology and Embryology which started a working relation with the Subcommittee on Histology of the former International Anatomical Nomenclature Committee. In Mexico City, 1971, this Subcommittee presented a document entitled Nomina Histologica Veterinaria: A Working Draft as a basis for the continued work of the newly-appointed Subcommittee on Histological Nomenclature. This resulted in the editing of the Nomina Histologica Veterinaria: A Working Draft II (Toulouse, 1974), followed by preparations for publication of a Nomina Histologica Veterinaria.
    [Show full text]
  • Molecular Organization of the Desmosome As Revealed by Direct Stochastic Optical Reconstruction Microscopy Sara N
    © 2016. Published by The Company of Biologists Ltd | Journal of Cell Science (2016) 129, 2897-2904 doi:10.1242/jcs.185785 SHORT REPORT Molecular organization of the desmosome as revealed by direct stochastic optical reconstruction microscopy Sara N. Stahley1, Emily I. Bartle1, Claire E. Atkinson2, Andrew P. Kowalczyk1,3 and Alexa L. Mattheyses1,* ABSTRACT plakoglobin and plakophilin, and the plakin family member Desmosomes are macromolecular junctions responsible for providing desmoplakin contribute to the intracellular plaque (Fig. 1A). strong cell–cell adhesion. Because of their size and molecular Plaque ultrastructure is characterized by two electron-dense complexity, the precise ultrastructural organization of desmosomes regions: the plasma-membrane-proximal outer dense plaque and is challenging to study. Here, we used direct stochastic optical the inner dense plaque (Desai et al., 2009; Farquhar and Palade, reconstruction microscopy (dSTORM) to resolve individual plaque 1963; Stokes, 2007). The cadherin cytoplasmic tails bind to proteins pairs for inner and outer dense plaque proteins. Analysis methods in the outer dense plaque whereas the C-terminus of desmoplakin based on desmosomal mirror symmetry were developed to measure binds to intermediate filaments in the inner dense plaque. This plaque-to-plaque distances and create an integrated map. We tethers the desmosome to the intermediate filament cytoskeleton, quantified the organization of desmoglein 3, plakoglobin and establishing an integrated adhesive network (Bornslaeger et al., desmoplakin (N-terminal, rod and C-terminal domains) in primary 1996; Harmon and Green, 2013). human keratinocytes. Longer desmosome lengths correlated with Many desmosomal protein interactions have been characterized increasing plaque-to-plaque distance, suggesting that desmoplakin is by biochemical studies (Bass-Zubek and Green, 2007; Green and arranged with its long axis at an angle within the plaque.
    [Show full text]
  • Adherens Junctions, Desmosomes and Tight Junctions in Epidermal Barrier Function Johanna M
    14 The Open Dermatology Journal, 2010, 4, 14-20 Open Access Adherens Junctions, Desmosomes and Tight Junctions in Epidermal Barrier Function Johanna M. Brandner1,§, Marek Haftek*,2,§ and Carien M. Niessen3,§ 1Department of Dermatology and Venerology, University Hospital Hamburg-Eppendorf, Hamburg, Germany 2University of Lyon, EA4169 Normal and Pathological Functions of Skin Barrier, E. Herriot Hospital, Lyon, France 3Department of Dermatology, Center for Molecular Medicine, Cologne Excellence Cluster on Cellular Stress Responses in Aging-Associated Diseases (CECAD), University of Cologne, Germany Abstract: The skin is an indispensable barrier which protects the body from the uncontrolled loss of water and solutes as well as from chemical and physical assaults and the invasion of pathogens. In recent years several studies have suggested an important role of intercellular junctions for the barrier function of the epidermis. In this review we summarize our knowledge of the impact of adherens junctions, (corneo)-desmosomes and tight junctions on barrier function of the skin. Keywords: Cadherins, catenins, claudins, cell polarity, stratum corneum, skin diseases. INTRODUCTION ADHERENS JUNCTIONS The stratifying epidermis of the skin physically separates Adherens junctions are intercellular structures that couple the organism from its environment and serves as its first line intercellular adhesion to the cytoskeleton thereby creating a of structural and functional defense against dehydration, transcellular network that coordinate the behavior of a chemical substances, physical insults and micro-organisms. population of cells. Adherens junctions are dynamic entities The living cell layers of the epidermis are crucial in the and also function as signal platforms that regulate formation and maintenance of the barrier on two different cytoskeletal dynamics and cell polarity.
    [Show full text]
  • Basic Features of All Cells
    Plasma Lab 4 membrane Basic Semifluid Ribosomes features substance (make called proteins) of all cytosol cells Chromosomes (carry genes) © 2014 Pearson Education, Inc. Prokaryotic cells are characterized by having . No nucleus . DNA in an unbound region called the nucleoid . No membrane-bound organelles . Cytoplasm bound by the plasma membrane © 2014 Pearson Education, Inc. Eukaryotic cells are characterized by having • DNA in a nucleus that is bounded by a membranous nuclear envelope • Membrane-bound organelles • Cytoplasm in the region between the plasma membrane and nucleus Eukaryotic cells are generally much larger than prokaryotic cells © 2014 Pearson Education, Inc. Figure 6.8a ENDOPLASMIC RETICULUM (ER) Nuclear envelope Rough ER Smooth ER Nucleolus NUCLEUS Flagellum Chromatin Centrosome Plasma membrane CYTOSKELETON: Microfilaments Intermediate filaments Microtubules Ribosomes Microvilli Golgi apparatus Peroxisome Lysosome Mitochondrion © 2014 Pearson Education, Inc. Figure 6.8b Nuclear envelope NUCLEUS Nucleolus Rough ER Chromatin Smooth ER Ribosomes Golgi Central vacuole apparatus Microfilaments CYTOSKELETON Microtubules Mitochondrion Peroxisome Plasma Chloroplast membrane Cell wall Plasmodesmata Wall of adjacent cell © 2014 Pearson Education, Inc. © 2014 Pearson Education, Inc. © 2014 Pearson Education, Inc. © 2014 Pearson Education, Inc. Table 6.1 © 2014 Pearson Education, Inc. Cell Walls of Plants The cell wall is an extracellular structure that distinguishes plant cells from animal cells Plant cell walls Prokaryotes, are made
    [Show full text]
  • Nanoscale ARTICLE
    Electronic Supplementary Material (ESI) for Nanoscale. This journal is © The Royal Society of ChemistryPlease do2019 not adjust margins Nanoscale ARTICLE The Impact of Tomato Fruits Containing Multi-walled Carbon Nanotube Residues on Human Intestinal Epithelial Cell Barrier Accepted 00th January 20xx Function and Intestinal Microbiome Composition a,b b b c,d c DOI: 10.1039/x0xx00000x Mohamed H. Lahiani , Sangeeta Khare , Carl E. Cerniglia , Ramiz Boy , Ilia Ivanov , and Mariya Khodakovskaya1* www.rsc.org/ a. Department of Biology, University of Arkansas at Little Rock, Little Rock, AR, 72204, USA e-mail: [email protected] b. Division of Microbiology, National Center for Toxicological Research, FDA, Jefferson, AR, 72079. c. Center for Nanophase Materials Sciences, Oak Ridge National Laboratory, Oak Ridge, TN, 37831, USA d. .Department of Textile Engineering, Çorlu Faculty of Engineering, Namık Kemal University, Çorlu-Tekirdağ 59860, TURKEY † Footnotes relating to the title and/or authors should appear here. Electronic Supplementary Information (ESI) available:Fig. S1 is Bright field microscopy of T-84 cells after exposure to CNT, Fig. S2 is shematic diagram o fNGS data analysis, Fig. S3-5 deatiled heatmap of top significantly altered genes, Table S1- 3 include list of gene classification, Fig. S6 confirmation of NGS data using Real-time PCR, Fig S7-9 PCA based on time, indivudals and doses used. See DOI: 10.1039/x0xx00000x J. Name., 2013, 00, 1-3 | 1 This journal is © The Royal Society of Chemistry 20xx Please do not adjust margins Figure S1. Bright field microscopy of T-84 cells after exposure to CNT at different doses (0.001, 0.1, and 10 µg/ml), control fruits extract (CP4), and CNT-containing fruits (CNT4) during two-time points (1- and 48-hour post-exposures).
    [Show full text]
  • Restoration of Desmosomal Junction Protein Expression and Inhibition Of
    MOLECULAR AND CLINICAL ONCOLOGY 3: 171-178, 2015 Restoration of desmosomal junction protein expression and inhibition of H3K9‑specifichistone demethylase activity by cytostatic proline‑rich polypeptide‑1 leads to suppression of tumorigenic potential in human chondrosarcoma cells KARINA GALOIAN1, AMIR QURESHI1, GINA WIDEROFF1 and H.T. TEMPLE2 1Department of Orthopaedic Surgery; 2University of Miami Tissue Bank Division, Miller School of Medicine, University of Miami, Miami, FL 33136, USA Received September 18, 2014; Accepted October 8, 2014 DOI: 10.3892/mco.2014.445 Abstract. Disruption of cell-cell junctions and the concomi- and inhibits H3K9 demethylase activity, contributing to the tant loss of polarity, downregulation of tumor-suppressive suppression of tumorigenic potential in chondrosarcoma cells. adherens junctions and desmosomes represent hallmark phenotypes for several different cancer cells. Moreover, a Introduction variety of evidence supports the argument that these two common phenotypes of cancer cells directly contribute to Chondrosarcoma is a highly aggressive bone cancer of tumorigenesis. In this study, we aimed to determine the status mesenchymal origin, which is resistant to chemo- and radia- of intercellular junction proteins expression in JJ012 human tion therapies, leaving surgical resection as the only option. malignant chondrosarcoma cells and investigate the effect Metastatic spread of malignant cells eventually develops of the antitumorigenic cytokine, proline-rich polypeptide-1 following surgical resection. The malignant progression to (PRP-1) on their expression. The cell junction pathway array chondrosarcoma has been suggested to involve a degree of data indicated downregulation of desmosomal proteins, mesenchymal-to-epithelial transition (MET) and it has been such as desmoglein (1,428-fold), desmoplakin (620-fold) and demonstrated in an in vitro model that chondrosarcoma cells plakoglobin (442-fold).
    [Show full text]
  • Desmosome Structure, Composition and Function ⁎ David Garrod A, Martyn Chidgey B
    CORE Metadata, citation and similar papers at core.ac.uk Provided by Elsevier - Publisher Connector Available online at www.sciencedirect.com Biochimica et Biophysica Acta 1778 (2008) 572–587 www.elsevier.com/locate/bbamem Review Desmosome structure, composition and function ⁎ David Garrod a, Martyn Chidgey b, a Faculty of Life Sciences, University of Manchester, Michael Smith Building, Oxford Road, Manchester M13 9PT, UK b Division of Medical Sciences, University of Birmingham, Clinical Research Block, Queen Elizabeth Hospital, Birmingham B15 2TH, UK Received 24 May 2007; received in revised form 19 July 2007; accepted 20 July 2007 Available online 9 August 2007 Abstract Desmosomes are intercellular junctions of epithelia and cardiac muscle. They resist mechanical stress because they adopt a strongly adhesive state in which they are said to be hyper-adhesive and which distinguishes them from other intercellular junctions; desmosomes are specialised for strong adhesion and their failure can result in diseases of the skin and heart. They are also dynamic structures whose adhesiveness can switch between high and low affinity adhesive states during processes such as embryonic development and wound healing, the switching being signalled by protein kinase C. Desmosomes may also act as signalling centres, regulating the availability of signalling molecules and thereby participating in fundamental processes such as cell proliferation, differentiation and morphogenesis. Here we consider the structure, composition and function of desmosomes, and their role in embryonic development and disease. © 2007 Elsevier B.V. All rights reserved. Contents 1. Introduction .............................................................. 573 1.1. The strength of the desmosome–intermediate filament complex ................................ 573 1.2. Desmosomes resist mechanical stress because they are hyper-adhesive .
    [Show full text]