DOCSLIB.ORG

Expression Profiling of Macrophages Reveals Multiple Populations With

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Expression Profiling of Macrophages Reveals Multiple Populations With Downloaded from http://www.jimmunol.org/ by guest on September 28, 2021 M. is online at: average * The Journal of Immunology published online 12 February 2016 from submission to initial decision 4 weeks from acceptance to publication http://www.jimmunol.org/content/early/2016/02/11/jimmun ol.1502364 Expression Profiling of Macrophages Reveals Multiple Populations with Distinct Biological Roles in an Immunocompetent Orthotopic Model of Lung Cancer Joanna M. Poczobutt, Subhajyoti De, Vinod K. Yadav, Teresa T. Nguyen, Howard Li, Trisha R. Sippel, Mary C. Weiser-Evans and Raphael A. Nemenoff J Immunol Submit online. Every submission reviewed by practicing scientists ? is published twice each month by Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts http://jimmunol.org/subscription Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html http://www.jimmunol.org/content/suppl/2016/02/11/jimmunol.150236 4.DCSupplemental Information about subscribing to The JI No Triage! Fast Publication! Rapid Reviews! 30 days* Why • • • Material Permissions Email Alerts Subscription Supplementary The Journal of Immunology The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2016 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. This information is current as of September 28, 2021. Published February 12, 2016, doi:10.4049/jimmunol.1502364 The Journal of Immunology Expression Profiling of Macrophages Reveals Multiple Populations with Distinct Biological Roles in an Immunocompetent Orthotopic Model of Lung Cancer Joanna M. Poczobutt,* Subhajyoti De,* Vinod K. Yadav,* Teresa T. Nguyen,* Howard Li,*,† Trisha R. Sippel,* Mary C. M. Weiser-Evans,*,‡ and Raphael A. Nemenoff*,‡ Macrophages represent an important component of the tumor microenvironment and play a complex role in cancer progression. These cells are characterized by a high degree of plasticity, and they alter their phenotype in response to local environmental cues. Whereas the M1/M2 classification of macrophages has been widely used, the complexity of macrophage phenotypes has not been well studied, par- ticularly in lung cancer. In this study we employed an orthotopic immunocompetent model of lung adenocarcinoma in which murine lung cancer cells are directly implanted into the left lobe of syngeneic mice. Using multimarker flow cytometry, we defined and recovered several Downloaded from distinct populations of monocytes/macrophages from tumors at different stages of progression. We used RNA-seq transcriptional profiling to define distinct features of each population and determine how they change during tumor progression. We defined an alveolar resident macrophage population that does not change in number and expresses multiple genes related to lipid metabolism and lipid signaling. We also defined a population of tumor-associated macrophages that increase dramatically with tumor and selectively expresses a panel of chemokine genes. A third population, which resembles tumor-associated monocytes, expresses a large number of genes involved in matrix remodeling. By correlating transcriptional profiles with clinically prognostic genes, we show that specific monocyte/macrophage popu- http://www.jimmunol.org/ lations are enriched in genes that predict outcomes in lung adenocarcinoma, implicating these subpopulations as critical determinants of patient survival. Our data underscore the complexity of monocytes/macrophages in the tumor microenvironment, and they suggest that distinct populations play specific roles in tumor progression. The Journal of Immunology, 2016, 196: 000–000. ung cancer remains the leading cause of cancer death in Among the diverse cell types of the TME, macrophages have been men and women, and most patients die of complications of implicated as important participants and are the most abundant non– L metastatic disease (1). Whereas tumor initiation is driven tumor cell type in most cancers (3). Studies in several types of cancer, by somatic mutations in oncogenic drivers and tumor suppressor including lung cancer, have demonstrated that macrophage depletion genes, progression and metastasis involve critical crosstalk be- either through pharmacological or genetic approaches results in by guest on September 28, 2021 tween cancer cells and the tumor microenvironment (TME) (2). slower tumor growth, implicating these cells as mediators of tumor progression (4, 5). In lung cancer, several studies have described *Department of Medicine, University of Colorado Denver, Aurora, CO 80045; correlations in macrophage number or phenotype with clinical out- †Veterans Affairs Medical Center, Denver, CO 80220; and ‡Department of Pharma- comes (6). Many of these studies have employed the model of M1 cology, University of Colorado Denver, Aurora, CO 80045 andM2macrophages.Thismodel,whichisbasedonactivationof ORCIDs: 0000-0002-7211-4176 (T.T.N.); 0000-0002-1230-2941 (H.L.). macrophages in vitro, designates a macrophage phenotype as being Received for publication November 5, 2015. Accepted for publication January 7, either proinflammatory M1, which is proposed to inhibit cancer 2016. progression, or alternatively activated M2, which is proangiogenic, This work was supported by National Institutes of Health/National Cancer Institute Grants R01 CA162226, R01 CA164780, and R01 CA108610 (to R.A.N.); the Colorado immunosuppressive, and promotes cancer progression (7, 8). Al- Lung Specialized Program of Research Excellence (National Cancer Institute Grant P50 though the M1/M2 classification of macrophages serves as a useful CA058187); Ruth L. Kirschstein National Research Service Award T32CA17468 (to T.R.S.); and by Department of Veterans Affairs Grant CDA 1IK2BX001282-01A1 (to H.L.). The starting point, it does not take into account the complexity and Flow Cytometry and the Genomics and Microarray Shared Resources receive support plasticity of these cells. Recent studies have demonstrated that dis- from the National Institutes of Health/National Cancer Institute (University of Colorado tinct populations of macrophages exist in tissues such as the lung, and Cancer Center Support Grant P30 CA046934). S.D. acknowledges support from the Boettcher Foundation and the United Against Lung Cancer Foundation. that these different populations not only express distinct markers but The RNA-seq data presented in this article have been submitted to the National also have different developmental origins (9). For example, the Center for Biotechnology Information Gene Expression Omnibus repository (http:// resident alveolar macrophages in the lung are derived from the www.ncbi.nlm.nih.gov/geo/) under accession number GSE76033. embryonic yolk sac, whereas the recruited monocytes and macro- Address correspondence and reprint requests to Prof. Raphael A. Nemenoff, Univer- sity of Colorado Denver, Department of Medicine, Division of Renal Diseases and phages are derived from the bone marrow. Hypertension C-281, 12700 East 19th Avenue, Aurora, CO 80045. E-mail address: These different populations are likely to play distinct and po- [email protected] tentially opposing roles in cancer progression. In fact, tumors are The online version of this article contains supplemental material. infiltrated by different dynamically changing populations of Abbreviations used in this article: COX, cyclooxygenase; ECM, extracellular matrix; FPKM, monocytes/macrophages (8), and identifying key features of each fragments per kilobase of exon per million fragments mapped; GSEA, gene set enrich- ment analysis; ImmGen, Immunological Genome Project; LLC, Lewis lung carcinoma; population may help to target them therapeutically. LTC4, leukotriene C4; MHC II, MHC class II; -N, from naive mice; PPAR, peroxisome To study the role of the TME in lung cancer, we have devel- proliferator–activated receptor; RNA-seq, RNA sequencing; TME, tumor microenvironment; oped an orthotopic immunocompetent mouse model, in which -2wk, from 2 wk tumor-bearing mice; -3wk, from 3 wk tumor-bearing mice. Lewis lung carcinoma (LLC) cells, which were derived from a Copyright Ó 2016 by The American Association of Immunologists, Inc. 0022-1767/16/$30.00 spontaneous lung adenocarcinoma in C57BL/6 mice, are directly www.jimmunol.org/cgi/doi/10.4049/jimmunol.1502364 2 EXPRESSION PROFILING OF MACROPHAGES IN LUNG CANCER implanted into the lungs of fully immunocompetent syngeneic RNA extraction and RNA-seq C57BL/6 mice. Within 2–3 wk these cells form a primary tumor Total RNAwas isolated from flow cytometry–sorted cells using QIAshredders that metastasizes to the other lung lobes, mediastinal lymph nodes, and an RNeasy Plus micro kit (Qiagen). RNA quality and quantity were liver, and brain. We have previously shown that tumor progression analyzed using a NanoDrop and Bioanalyzer. RNA-seq library preparation in this model is associated with increases in several monocyte/ and sequencing were conducted at the Genomics and Microarray Core at the macrophage populations (10). However, functional differences University of Colorado Denver–Anschutz Medical Campus. Libraries were constructed using a NuGen Ovation human FFPE RNA-seq multiplex system between these populations have not been identified, and the role of kit customized with mouse specific oligonucleotides for rRNA removal. specific monocyte/macrophage subtypes in tumor progression is Directional mRNA-seq was conducted
Load more

Recommended publications
  • Cytogenomic SNP Microarray - Fetal ARUP Test Code 2002366 Maternal Contamination Study Fetal Spec Fetal Cells
    Patient Report |FINAL Client: Example Client ABC123 Patient: Patient, Example 123 Test Drive Salt Lake City, UT 84108 DOB 2/13/1987 UNITED STATES Gender: Female Patient Identifiers: 01234567890ABCD, 012345 Physician: Doctor, Example Visit Number (FIN): 01234567890ABCD Collection Date: 00/00/0000 00:00 Cytogenomic SNP Microarray - Fetal ARUP test code 2002366 Maternal Contamination Study Fetal Spec Fetal Cells Single fetal genotype present; no maternal cells present. Fetal and maternal samples were tested using STR markers to rule out maternal cell contamination. This result has been reviewed and approved by Maternal Specimen Yes Cytogenomic SNP Microarray - Fetal Abnormal * (Ref Interval: Normal) Test Performed: Cytogenomic SNP Microarray- Fetal (ARRAY FE) Specimen Type: Direct (uncultured) villi Indication for Testing: Patient with 46,XX,t(4;13)(p16.3;q12) (Quest: EN935475D) ----------------------------------------------------------------- ----- RESULT SUMMARY Abnormal Microarray Result (Male) Unbalanced Translocation Involving Chromosomes 4 and 13 Classification: Pathogenic 4p Terminal Deletion (Wolf-Hirschhorn syndrome) Copy number change: 4p16.3p16.2 loss Size: 5.1 Mb 13q Proximal Region Deletion Copy number change: 13q11q12.12 loss Size: 6.1 Mb ----------------------------------------------------------------- ----- RESULT DESCRIPTION This analysis showed a terminal deletion (1 copy present) involving chromosome 4 within 4p16.3p16.2 and a proximal interstitial deletion (1 copy present) involving chromosome 13 within 13q11q12.12. This
    [Show full text]
  • Gene Expression Polarization
    Transcriptional Profiling of the Human Monocyte-to-Macrophage Differentiation and Polarization: New Molecules and Patterns of Gene Expression This information is current as of September 27, 2021. Fernando O. Martinez, Siamon Gordon, Massimo Locati and Alberto Mantovani J Immunol 2006; 177:7303-7311; ; doi: 10.4049/jimmunol.177.10.7303 http://www.jimmunol.org/content/177/10/7303 Downloaded from Supplementary http://www.jimmunol.org/content/suppl/2006/11/03/177.10.7303.DC1 Material http://www.jimmunol.org/ References This article cites 61 articles, 22 of which you can access for free at: http://www.jimmunol.org/content/177/10/7303.full#ref-list-1 Why The JI? Submit online. • Rapid Reviews! 30 days* from submission to initial decision by guest on September 27, 2021 • No Triage! Every submission reviewed by practicing scientists • Fast Publication! 4 weeks from acceptance to publication *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2006 by The American Association of Immunologists All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. The Journal of Immunology Transcriptional Profiling of the Human Monocyte-to-Macrophage Differentiation and Polarization: New Molecules and Patterns of Gene Expression1 Fernando O.
    [Show full text]
  • Genome-Wide Analysis Reveals Selection Signatures Involved in Meat Traits and Local Adaptation in Semi-Feral Maremmana Cattle
    Genome-Wide Analysis Reveals Selection Signatures Involved in Meat Traits and Local Adaptation in Semi-Feral Maremmana Cattle Slim Ben-Jemaa, Gabriele Senczuk, Elena Ciani, Roberta Ciampolini, Gennaro Catillo, Mekki Boussaha, Fabio Pilla, Baldassare Portolano, Salvatore Mastrangelo To cite this version: Slim Ben-Jemaa, Gabriele Senczuk, Elena Ciani, Roberta Ciampolini, Gennaro Catillo, et al.. Genome-Wide Analysis Reveals Selection Signatures Involved in Meat Traits and Local Adaptation in Semi-Feral Maremmana Cattle. Frontiers in Genetics, Frontiers, 2021, 10.3389/fgene.2021.675569. hal-03210766 HAL Id: hal-03210766 https://hal.inrae.fr/hal-03210766 Submitted on 28 Apr 2021 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Distributed under a Creative Commons Attribution| 4.0 International License ORIGINAL RESEARCH published: 28 April 2021 doi: 10.3389/fgene.2021.675569 Genome-Wide Analysis Reveals Selection Signatures Involved in Meat Traits and Local Adaptation in Semi-Feral Maremmana Cattle Slim Ben-Jemaa 1, Gabriele Senczuk 2, Elena Ciani 3, Roberta
    [Show full text]
  • Downloaded from GEO
    bioRxiv preprint doi: https://doi.org/10.1101/2020.08.17.252007; this version posted November 3, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. Oxylipin metabolism is controlled by mitochondrial b-oxidation during bacterial inflammation. Mariya Misheva1, Konstantinos Kotzamanis1*, Luke C Davies1*, Victoria J Tyrrell1, Patricia R S Rodrigues1, Gloria A Benavides2, Christine Hinz1, Robert C Murphy3, Paul Kennedy4, Philip R Taylor1,5, Marcela Rosas1, Simon A Jones1, Sumukh Deshpande1, Robert Andrews1, Magdalena A Czubala1, Mark Gurney1, Maceler Aldrovandi1, Sven W Meckelmann1, Peter Ghazal1, Victor Darley-Usmar2, Daniel White1, and Valerie B O’Donnell1 1Systems Immunity Research Institute and Division of Infection and Immunity, and School of Medicine, Cardiff University, UK, 2Department of Pathology, University of Alabama at Birmingham, Birmingham, AL 35294, USA, 3Department of Pharmacology, University of Colorado Denver, Aurora, CO 80045, USA, 4Cayman Chemical 1180 E Ellsworth Rd, Ann Arbor, MI 48108, United States, 5UK Dementia Research Institute at Cardiff, Cardiff University, UK Address correspondence: Valerie O’Donnell, [email protected] or Daniel White, [email protected], Systems Immunity Research Institute, Cardiff University *Both authors contributed equally to the study 1 bioRxiv preprint doi: https://doi.org/10.1101/2020.08.17.252007; this version posted November 3, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity.
    [Show full text]
  • Potassium Channels in Epilepsy
    Downloaded from http://perspectivesinmedicine.cshlp.org/ on September 28, 2021 - Published by Cold Spring Harbor Laboratory Press Potassium Channels in Epilepsy Ru¨diger Ko¨hling and Jakob Wolfart Oscar Langendorff Institute of Physiology, University of Rostock, Rostock 18057, Germany Correspondence: [email protected] This review attempts to give a concise and up-to-date overview on the role of potassium channels in epilepsies. Their role can be defined from a genetic perspective, focusing on variants and de novo mutations identified in genetic studies or animal models with targeted, specific mutations in genes coding for a member of the large potassium channel family. In these genetic studies, a demonstrated functional link to hyperexcitability often remains elusive. However, their role can also be defined from a functional perspective, based on dy- namic, aggravating, or adaptive transcriptional and posttranslational alterations. In these cases, it often remains elusive whether the alteration is causal or merely incidental. With 80 potassium channel types, of which 10% are known to be associated with epilepsies (in humans) or a seizure phenotype (in animals), if genetically mutated, a comprehensive review is a challenging endeavor. This goal may seem all the more ambitious once the data on posttranslational alterations, found both in human tissue from epilepsy patients and in chronic or acute animal models, are included. We therefore summarize the literature, and expand only on key findings, particularly regarding functional alterations found in patient brain tissue and chronic animal models. INTRODUCTION TO POTASSIUM evolutionary appearance of voltage-gated so- CHANNELS dium (Nav)andcalcium (Cav)channels, Kchan- nels are further diversified in relation to their otassium (K) channels are related to epilepsy newer function, namely, keeping neuronal exci- Psyndromes on many different levels, ranging tation within limits (Anderson and Greenberg from direct control of neuronal excitability and 2001; Hille 2001).
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • UNIVERSITY of CALIFORNIA Los Angeles
    UNIVERSITY OF CALIFORNIA Los Angeles Integrating molecular phenotypes and gene expression to characterize DNA variants for cardiometabolic traits A dissertation submitted in partial satisfaction of the requirements for the degree Doctor of Philosophy in Human Genetics by Alejandra Rodriguez 2018 ABSTRACT OF THE DISSERTATION Integrating molecular phenotypes and gene expression to characterize DNA variants for cardiometabolic traits by Alejandra Rodriguez Doctor of Philosophy in Human Genetics University of California, Los Angeles, 2018 Professor Päivi Elisabeth Pajukanta, Chair In-depth understanding of cardiovascular disease etiology requires characterization of its genetic, environmental, and molecular architecture. Genetic architecture can be defined as the characteristics of genetic variation responsible for broad-sense phenotypic heritability. Massively parallel sequencing has generated thousands of genomic datasets in diverse human tissues. Integration of such datasets using data mining methods has been used to extract biological meaning and has significantly advanced our understanding of the genome-wide nucleotide sequence, its regulatory elements, and overall chromatin architecture. This dissertation presents integration of “omics” data sets to understand the genetic architecture and molecular mechanisms of cardiovascular lipid disorders (further reviewed in Chapter 1). In 2013, Daphna Weissglas-Volkov and coworkers1 published an association between the chromosome 18q11.2 genomic region and hypertriglyceridemia in a genome-wide
    [Show full text]
  • Microarray‑Based Identification of Nerve Growth‑Promoting Genes in Neurofibromatosis Type I
    192 MOLECULAR MEDICINE REPORTS 9: 192-196, 2014 Microarray‑based identification of nerve growth‑promoting genes in neurofibromatosis type I YUFEI LIU1*, DONG KANG2*, CHUNYAN LI3, GUANG XU4, YAN TAN5 and JINHONG WANG6 1Department of Pediatric Intensive Care Unit, The First Affiliated Hospital of Jilin University, Changchun, Jilin 130000; 2Huiqiao Department, South Hospital of Southern Medical University, Guangdong 510630; Departments of 3Pediatric Respiratory and 4Infectious Diseases, The First Affiliated Hospital of Jilin University; 5Cancer Biotherapy Center, People's Hospital of Jilin Province, Changchun, Jilin 130000; 6Department of Respiratory, The Third Affiliated Hospital of Southern Medical University, Guangzhou, Guangdong 510630, P.R. China Received May 16, 2013; Accepted October 29, 2013 DOI: 10.3892/mmr.2013.1785 Abstract. As a genetic disease, neurofibromatosis patients, target molecules contributing to nerve growth during type 1 (NF1) is characterized by abnormalities in multiple NF1 development were investigated, which aided in improving tissues derived from the neural crest, including neoplasms in our understanding of this disease, and may provide a novel the ends of the limbs. The exact mechanism of nerve growth direction for nerve repair and regeneration. in NF1 is unclear. In the present study, the gene expression profile of nerves in healthy controls and NF1 patients with Introduction macrodactylia of the fingers or toes were analyzed in order to identify possible genes associated with nerve growth. The Neurofibromatosis is characterized by café-au-lait spots, Whole Human Genome Microarray was selected to screen for iris Lisch nodules and cutaneous or subcutaneous skin different gene expression profiles, and the result was analyzed tumors termedneurofibromas (1).
    [Show full text]
  • Product Datasheet Qprest
    Product Datasheet QPrEST PRODUCT SPECIFICATION Product Name QPrEST TMM98 Mass Spectrometry Protein Standard Product Number QPrEST39234 Protein Name Transmembrane protein 98 Uniprot ID Q9Y2Y6 Gene TMEM98 Product Description Stable isotope-labeled standard for absolute protein quantification of Transmembrane protein 98. Lys (13C and 15N) and Arg (13C and 15N) metabolically labeled recombinant human protein fragment. Application Absolute protein quantification using mass spectrometry Sequence (excluding CRQRYCRPRDLLQRYDSKPIVDLIGAMETQSEPSELELDDVVITNPHIEA fusion tag) ILENEDWIEDASGLMSHCIAILKICHTLTEKLVAMTMGSGAKMKTSASVS Theoretical MW 28997 Da including N-terminal His6ABP fusion tag Fusion Tag A purification and quantification tag (QTag) consisting of a hexahistidine sequence followed by an Albumin Binding Protein (ABP) domain derived from Streptococcal Protein G. Expression Host Escherichia coli LysA ArgA BL21(DE3) Purification IMAC purification Purity >90% as determined by Bioanalyzer Protein 230 Purity Assay Isotopic Incorporation >99% Concentration >5 μM after reconstitution in 100 μl H20 Concentration Concentration determined by LC-MS/MS using a highly pure amino acid analyzed internal Determination reference (QTag), CV ≤10%. Amount >0.5 nmol per vial, two vials supplied. Formulation Lyophilized in 100 mM Tris-HCl 5% Trehalose, pH 8.0 Instructions for Spin vial before opening. Add 100 μL ultrapure H2O to the vial. Vortex thoroughly and spin Reconstitution down. For further dilution, see Application Protocol. Shipping Shipped at ambient temperature Storage Lyophilized product shall be stored at -20°C. See COA for expiry date. Reconstituted product can be stored at -20°C for up to 4 weeks. Avoid repeated freeze-thaw cycles. Notes For research use only Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use.
    [Show full text]
  • Leukocyte-Specific Adaptor Protein Grap2 Interacts with Hematopoietic
    Oncogene (2001) 20, 1703 ± 1714 ã 2001 Nature Publishing Group All rights reserved 0950 ± 9232/01 $15.00 www.nature.com/onc Leukocyte-speci®c adaptor protein Grap2 interacts with hematopoietic progenitor kinase 1 (HPK1) to activate JNK signaling pathway in T lymphocytes Wenbin Ma1, Chunzhi Xia1, Pin Ling2, Mengsheng Qiu3, Ying Luo4, Tse-Hua Tan2 and Mingyao Liu*,1 1Department of Medical Biochemistry and Genetics, Center for Cancer Biology and Nutrition, Institute of Biosciences and Technology, Texas A&M University System Health Science Center, 2121 W. Holcombe Blvd., Houston, Texas, TX 77030, USA; 2Department of Immunology, Baylor College of Medicine, Houston, Texas, TX 77030, USA; 3Department of Anatomical Sciences and Neurobiology, School of Medicine, University of Louisville, Louisville, Kentucky, KY 40202, USA; 4Shanghai Genomics, Inc., Zhangjiang Hi-Tech Park, Pudong, Shangai 201204, P.R.C. Immune cell-speci®c adaptor proteins create various Introduction combinations of multiprotein complexes and integrate signals from cell surface receptors to the nucleus, Activation of resting T cells through the T-cell antigen modulating the speci®city and selectivity of intracellular receptor triggers a cascade of intracellular signaling signal transduction. Grap2 is a newly identi®ed adaptor events that lead to enhanced gene transcription, protein speci®cally expressed in lymphoid tissues. This cellular dierentiation and proliferation (Cantrell, protein shares 40 ± 50% sequence homology in the SH3 1996; Weiss and Littman, 1994; Chan and Shaw, and the SH2 domain with Grb2 and Grap. However, the 1996; Crabtree and Clipstone, 1994; Wange and Grap2 protein has a unique 120-amino acid glutamine- Samelson, 1996). Although components of the T-cell and proline-rich domain between the SH2 and C- receptor complex have no intrinsic kinase activity, the terminal SH3 domains.
    [Show full text]
  • Aneuploidy: Using Genetic Instability to Preserve a Haploid Genome?
    Health Science Campus FINAL APPROVAL OF DISSERTATION Doctor of Philosophy in Biomedical Science (Cancer Biology) Aneuploidy: Using genetic instability to preserve a haploid genome? Submitted by: Ramona Ramdath In partial fulfillment of the requirements for the degree of Doctor of Philosophy in Biomedical Science Examination Committee Signature/Date Major Advisor: David Allison, M.D., Ph.D. Academic James Trempe, Ph.D. Advisory Committee: David Giovanucci, Ph.D. Randall Ruch, Ph.D. Ronald Mellgren, Ph.D. Senior Associate Dean College of Graduate Studies Michael S. Bisesi, Ph.D. Date of Defense: April 10, 2009 Aneuploidy: Using genetic instability to preserve a haploid genome? Ramona Ramdath University of Toledo, Health Science Campus 2009 Dedication I dedicate this dissertation to my grandfather who died of lung cancer two years ago, but who always instilled in us the value and importance of education. And to my mom and sister, both of whom have been pillars of support and stimulating conversations. To my sister, Rehanna, especially- I hope this inspires you to achieve all that you want to in life, academically and otherwise. ii Acknowledgements As we go through these academic journeys, there are so many along the way that make an impact not only on our work, but on our lives as well, and I would like to say a heartfelt thank you to all of those people: My Committee members- Dr. James Trempe, Dr. David Giovanucchi, Dr. Ronald Mellgren and Dr. Randall Ruch for their guidance, suggestions, support and confidence in me. My major advisor- Dr. David Allison, for his constructive criticism and positive reinforcement.
    [Show full text]
  • Ion Channels 3 1
    r r r Cell Signalling Biology Michael J. Berridge Module 3 Ion Channels 3 1 Module 3 Ion Channels Synopsis Ion channels have two main signalling functions: either they can generate second messengers or they can function as effectors by responding to such messengers. Their role in signal generation is mainly centred on the Ca2 + signalling pathway, which has a large number of Ca2+ entry channels and internal Ca2+ release channels, both of which contribute to the generation of Ca2 + signals. Ion channels are also important effectors in that they mediate the action of different intracellular signalling pathways. There are a large number of K+ channels and many of these function in different + aspects of cell signalling. The voltage-dependent K (KV) channels regulate membrane potential and + excitability. The inward rectifier K (Kir) channel family has a number of important groups of channels + + such as the G protein-gated inward rectifier K (GIRK) channels and the ATP-sensitive K (KATP) + + channels. The two-pore domain K (K2P) channels are responsible for the large background K current. Some of the actions of Ca2 + are carried out by Ca2+-sensitive K+ channels and Ca2+-sensitive Cl − channels. The latter are members of a large group of chloride channels and transporters with multiple functions. There is a large family of ATP-binding cassette (ABC) transporters some of which have a signalling role in that they extrude signalling components from the cell. One of the ABC transporters is the cystic − − fibrosis transmembrane conductance regulator (CFTR) that conducts anions (Cl and HCO3 )and contributes to the osmotic gradient for the parallel flow of water in various transporting epithelia.
    [Show full text]