KDELR3 DNAxPab a C-terminal tetrapeptide signal, usually lys-asp-glu-leu (KDEL) in animal cells, and his-asp-glu-leu (HDEL) in S. Catalog Number: H00011015-W01P cerevisiae. This process is mediated by a receptor that recognizes, and binds the tetrapeptide-containing Regulation Status: For research use only (RUO) protein, and returns it to the ER. In yeast, the sorting receptor encoded by a single gene, ERD2, is a Product Description: Rabbit polyclonal antibody raised seven-transmembrane protein. Unlike yeast, several against a full-length human KDELR3 DNA using DNAx™ human homologs of the ERD2 gene, constituting the Immune technology. KDEL receptor gene family, have been described. KDELR3 was the third member of the family to be Immunogen: Full-length human DNA identified, and it encodes a protein highly homologous to KDELR1 and KDELR2 proteins. Two transcript variants Sequence: of KDELR3 that arise by alternative splicing, and encode MNVFRILGDLSHLLAMILLLGKIWRSKCCKGISGKSQIL different isoforms of KDELR3 receptor, have been FALVFTTRYLDLFTNFISIYNTVMKVVFLLCAYVTVYMIY described. [provided by RefSeq] GKFRKTFDSENDTFRLEFLLVPVIGLSFLENYSFTLLEIL WTFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYR ALYLANWIRRYQTENFYDQIAVVSGVVQTIFYCDFFYL YVTKVLKGKKLSLPMPI

Host: Rabbit

Reactivity: Human

Applications: Flow Cyt-Tr, IF-Ex, IF-Tr, WB-Tr (See our web site product page for detailed applications information)

Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols

Purification: Protein A

Storage Buffer: In 1x PBS, pH 7.4

Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Entrez GeneID: 11015

Gene Symbol: KDELR3

Gene Alias: ERD2L3

Gene Summary: Retention of resident soluble proteins in the lumen of the endoplasmic reticulum (ER) is achieved in both yeast and animal cells by their continual retrieval from the cis-Golgi, or a pre-Golgi compartment. Sorting of these proteins is dependent on

Page 1/1

Powered by TCPDF (www.tcpdf.org)