Epigenome-Wide Exploratory Study of Monozygotic Twins Suggests Differentially Methylated Regions to Associate with Hand Grip Strength
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Analyse Genetischer Stabilität in Den Nachkommen Bestrahlter Zellen Mittels Klassischer Chromosomenbänderung Und Verschiedener Hochdurchsatz-Techniken
Analyse genetischer Stabilität in den Nachkommen bestrahlter Zellen mittels klassischer Chromosomenbänderung und verschiedener Hochdurchsatz-Techniken Dissertation zur Erlangung des naturwissenschaftlichen Doktorgrades der Julius-Maximilians-Universität Würzburg vorgelegt von Julia Flunkert geboren in Schwerte Würzburg, 2018 Eingereicht am: …………………………………………….................... Mitglieder der Promotionskommission: Vorsitzender: Gutachter: Univ.-Prof. Dr. med. Thomas Haaf Gutachter: Univ.-Prof. Dr. Thomas Dandekar Tag des Promotionskolloquiums: ……………………….................. Doktorurkunde ausgehändigt am: ………………………................. Eidesstattliche Versicherung Die vorliegende Arbeit wurde von November 2014 bis September 2018 am Institut für Humangenetik der Universität Würzburg unter Betreuung von Herrn Univ.-Prof. Dr. med. Thomas Haaf angefertigt. Hiermit erkläre ich an Eides statt, die Dissertation: „Analyse genetischer Stabilität in den Nachkommen bestrahlter Zellen mittels klassischer Chromosomenbänderung und verschiedener Hochdurchsatz-Techniken“, eigenständig, d. h. insbesondere selbständig und ohne Hilfe eines kommerziellen Promotionsberaters, angefertigt und keine anderen, als die von mir angegebenen Quellen und Hilfsmittel verwendet zu haben. Ich erkläre außerdem, dass die Dissertation weder in gleicher noch in ähnlicher Form bereits in einem anderen Prüfungsverfahren vorgelegen hat. Weiterhin erkläre ich, dass bei allen Abbildungen und Texten bei denen die Verwer- tungsrechte (Copyright) nicht bei mir liegen, diese von den Rechtsinhabern -
Mathiomica: an Integrative Platform for Dynamic Omics George I
MathIOmica: An Integrative Platform for Dynamic Omics George I. Mias1,*, Tahir Yusufaly2, Raeuf Roushangar1, Lavida R. K. Brooks1, Vikas V. Singh1, and Christina Christou3 1Michigan State University, Biochemistry and Molecular Biology, East Lansing, MI 48824, USA 2University of Southern California, Department of Physics and Astronomy, Los Angeles, CA, 90089, USA 3Mercy Cancer Center, Department of Radiation Oncology, Mason City, IA 50401, USA *[email protected] SUPPLEMENTARY NOTE 1 1 1 MathIOmica: Omics Analysis Tutorial Loading the MathIOmica Package Metabolomic Data Data in MathIOmica Combined Data Clustering Transcriptome Data Visualization Proteomic Data Annotation and Enrichment MathIOmica is an omics analysis package designed to facilitate method development for the analysis of multiple omics in Mathematica, particularly for dynamics (time series/longitudinal data). This extensive tutorial follows the analysis of multiple dynamic omics data (transcriptomics, proteomics, and metabolomics from human samples). Various MathIOmica functions are introduced in the tutorial, including additional discussion of related functionality. We should note that the approach methods are simply an illustration of MathIOmica functionality, and should not be considered as a definitive appoach. Additionally, certain details are included to illustrate common complications (e.g. renaming samples, combining datasets, transforming accessions from one database to another, dealing with replicates and Missing data, etc.). After a brief discussion of data in MathIOmica, each example data (transcriptome, proteome and metabolome) are imported and preprocessed. Next a simulation is carried out to obtain datasets for each omics used to assess statistical significance cutoffs. The datasets are combined, and classified for time series patterns, followed by clustering. The clusters are visualized, and biological annotation of Gene Ontology (GO) and pathway analysis (KEGG: Kyoto Encyclopedia of Genes and Genomes) are finally considered. -
A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated. -
Dissecting the Genomic Complexity Underlying Medulloblastoma
LETTER doi:10.1038/nature11284 Dissecting the genomic complexity underlying medulloblastoma A list of authors and their affiliations appears at the end of the paper Medulloblastoma is an aggressively growing tumour, arising in Some cases probably went through even higher polyploidy states the cerebellum or medulla/brain stem. It is the most common before reaching an approximately 4n baseline (for example malignant brain tumour in children, and shows tremendous bio- ICGC_MB45, displaying 4n chromosomes with 4:0 or 3:1 allele ratios; logical and clinical heterogeneity1. Despite recent treatment Supplementary Fig. 2). Across the discovery set, tetraploidy was most advances, approximately 40% of children experience tumour commonly observed in Group 3 (7 out of 13, 54%) and Group 4 recurrence, and 30% will die from their disease. Those who survive tumours (8 out of 20, 40%), followed by SHH (4 out of 14, 29%) and often have a significantly reduced quality of life. Four tumour WNT tumours (1 out of 7, 14%). Interestingly, the four tetraploid SHH subgroups with distinct clinical, biological and genetic profiles tumours all harboured TP53 mutations and also displayed chromo- are currently identified2,3. WNT tumours, showing activated thripsis6. Tetraploid Group 3 and 4 tumours showed significantly wingless pathway signalling, carry a favourable prognosis under more large-scale copy number alterations compared with diploid cases current treatment regimens4. SHH tumours show hedgehog (median 10 changes per tumour in tetraploid versus 4 per tumour in pathway activation, and have an intermediate prognosis2. Group 3 diploid cases, P 5 0.008, two-tailed Mann–Whitney U-test; Supplemen- and 4 tumours are molecularly less well characterized, and also tary Fig. -
Uptake and Processing of the Cytolethal Distending Toxin by Mammalian Cells
Toxins 2014, 6, 3098-3116; doi:10.3390/toxins6113098 OPEN ACCESS toxins ISSN 2072-6651 www.mdpi.com/journal/toxins Review Uptake and Processing of the Cytolethal Distending Toxin by Mammalian Cells Joseph M. DiRienzo Department of Microbiology, School of Dental Medicine, University of Pennsylvania, 240 South 40th Street, Philadelphia, PA 19104, USA; E-Mail: [email protected]; Tel.: +1-215-898-8238; Fax: +1-215-898-8385 External Editor: Holger Barth Received: 19 September 2014; in revised form: 10 October 2014 / Accepted: 10 October 2014 / Published: 31 October 2014 Abstract: The cytolethal distending toxin (Cdt) is a heterotrimeric holotoxin produced by a diverse group of Gram-negative pathogenic bacteria. The Cdts expressed by the members of this group comprise a subclass of the AB toxin superfamily. Some AB toxins have hijacked the retrograde transport pathway, carried out by the Golgi apparatus and endoplasmic reticulum (ER), to translocate to cytosolic targets. Those toxins have been used as tools to decipher the roles of the Golgi and ER in intracellular transport and to develop medically useful delivery reagents. In comparison to the other AB toxins, the Cdt exhibits unique properties, such as translocation to the nucleus, that present specific challenges in understanding the precise molecular details of the trafficking pathway in mammalian cells. The purpose of this review is to present current information about the mechanisms of uptake and translocation of the Cdt in relation to standard concepts of endocytosis and retrograde transport. Studies of the Cdt intoxication process to date have led to the discovery of new translocation pathways and components and most likely will continue to reveal unknown features about the mechanisms by which bacterial proteins target the mammalian cell nucleus. -
Cellular and Molecular Signatures in the Disease Tissue of Early
Cellular and Molecular Signatures in the Disease Tissue of Early Rheumatoid Arthritis Stratify Clinical Response to csDMARD-Therapy and Predict Radiographic Progression Frances Humby1,* Myles Lewis1,* Nandhini Ramamoorthi2, Jason Hackney3, Michael Barnes1, Michele Bombardieri1, Francesca Setiadi2, Stephen Kelly1, Fabiola Bene1, Maria di Cicco1, Sudeh Riahi1, Vidalba Rocher-Ros1, Nora Ng1, Ilias Lazorou1, Rebecca E. Hands1, Desiree van der Heijde4, Robert Landewé5, Annette van der Helm-van Mil4, Alberto Cauli6, Iain B. McInnes7, Christopher D. Buckley8, Ernest Choy9, Peter Taylor10, Michael J. Townsend2 & Costantino Pitzalis1 1Centre for Experimental Medicine and Rheumatology, William Harvey Research Institute, Barts and The London School of Medicine and Dentistry, Queen Mary University of London, Charterhouse Square, London EC1M 6BQ, UK. Departments of 2Biomarker Discovery OMNI, 3Bioinformatics and Computational Biology, Genentech Research and Early Development, South San Francisco, California 94080 USA 4Department of Rheumatology, Leiden University Medical Center, The Netherlands 5Department of Clinical Immunology & Rheumatology, Amsterdam Rheumatology & Immunology Center, Amsterdam, The Netherlands 6Rheumatology Unit, Department of Medical Sciences, Policlinico of the University of Cagliari, Cagliari, Italy 7Institute of Infection, Immunity and Inflammation, University of Glasgow, Glasgow G12 8TA, UK 8Rheumatology Research Group, Institute of Inflammation and Ageing (IIA), University of Birmingham, Birmingham B15 2WB, UK 9Institute of -
CD29 Identifies IFN-Γ–Producing Human CD8+ T Cells With
+ CD29 identifies IFN-γ–producing human CD8 T cells with an increased cytotoxic potential Benoît P. Nicoleta,b, Aurélie Guislaina,b, Floris P. J. van Alphenc, Raquel Gomez-Eerlandd, Ton N. M. Schumacherd, Maartje van den Biggelaarc,e, and Monika C. Wolkersa,b,1 aDepartment of Hematopoiesis, Sanquin Research, 1066 CX Amsterdam, The Netherlands; bLandsteiner Laboratory, Oncode Institute, Amsterdam University Medical Center, University of Amsterdam, 1105 AZ Amsterdam, The Netherlands; cDepartment of Research Facilities, Sanquin Research, 1066 CX Amsterdam, The Netherlands; dDivision of Molecular Oncology and Immunology, Oncode Institute, The Netherlands Cancer Institute, 1066 CX Amsterdam, The Netherlands; and eDepartment of Molecular and Cellular Haemostasis, Sanquin Research, 1066 CX Amsterdam, The Netherlands Edited by Anjana Rao, La Jolla Institute for Allergy and Immunology, La Jolla, CA, and approved February 12, 2020 (received for review August 12, 2019) Cytotoxic CD8+ T cells can effectively kill target cells by producing therefore developed a protocol that allowed for efficient iso- cytokines, chemokines, and granzymes. Expression of these effector lation of RNA and protein from fluorescence-activated cell molecules is however highly divergent, and tools that identify and sorting (FACS)-sorted fixed T cells after intracellular cytokine + preselect CD8 T cells with a cytotoxic expression profile are lacking. staining. With this top-down approach, we performed an un- + Human CD8 T cells can be divided into IFN-γ– and IL-2–producing biased RNA-sequencing (RNA-seq) and mass spectrometry cells. Unbiased transcriptomics and proteomics analysis on cytokine- γ– – + + (MS) analyses on IFN- and IL-2 producing primary human producing fixed CD8 T cells revealed that IL-2 cells produce helper + + + CD8 Tcells. -
Seven Novel and Stable Translocations Associated with Oncogenic Gene Expression in Malignant Melanoma1
BRIEF ARTICLE Neoplasia . Vol. 7, No. 4, April 2005, pp. 303 – 311 303 www.neoplasia.com Seven Novel and Stable Translocations Associated with Oncogenic Gene Expression in Malignant Melanoma1 Ichiro Okamoto*, Christine Pirker y, Martin Bilban z, Walter Berger y, Doris Losert §, Christine Marosi b, Oskar A. Haas #, Klaus Wolff* and Hubert Pehamberger* *Division of General Dermatology, Department of Dermatology, Center of Excellence and the Ludwig Boltzmann Institut for Clinical and Experimental Oncology, Medical University of Vienna, Wa¨hringer Gu¨rtel 18-20, Vienna A-1090, Austria; y Institute of Cancer Research, Divisions of Applied and Experimental Oncology, Medical University of Vienna, Borschkegasse 8a, Vienna A-1090, Austria; z Department of Medical and Chemical Diagnostics, Medical University of Vienna, Wa¨hringer Gu¨rtel 18-20, Vienna A-1090, Austria; §Section of Experimental Oncology/Molecular Pharmacology, Department of Clinical Pharmacology, Medical University of Vienna, Wa¨hringer Gu¨rtel 18-20, Vienna A-1090, Austria; b Department of Internal Medicine I, Division of Oncology, Medical University of Vienna, Wa¨hringer Gu¨rtel 18-20, Vienna A-1090, Austria; # Children’s Cancer Research Institute (CCRI), Kinderspitalgasse 6, Vienna A-1090, Austria Abstract Cytogenetics has not only precipitated the discovery of Introduction several oncogenes, but has also led to the molecular Malignant melanoma (MM) is a fatal disease once metastasis classification of numerous malignancies. The correct has occurred and a dramatic increase in incidence has been identification of aberrations in many tumors has, how- recorded [1]. Despite successful identification of molecular ever, been hindered by extensive tumor complexity and mechanisms in many malignancies using cytogenetic data, the limitations of molecular cytogenetic techniques. -
KDELR3 Dnaxpab a C-Terminal Tetrapeptide Signal, Usually Lys-Asp-Glu-Leu (KDEL) in Animal Cells, and His-Asp-Glu-Leu (HDEL) in S
KDELR3 DNAxPab a C-terminal tetrapeptide signal, usually lys-asp-glu-leu (KDEL) in animal cells, and his-asp-glu-leu (HDEL) in S. Catalog Number: H00011015-W01P cerevisiae. This process is mediated by a receptor that recognizes, and binds the tetrapeptide-containing Regulation Status: For research use only (RUO) protein, and returns it to the ER. In yeast, the sorting receptor encoded by a single gene, ERD2, is a Product Description: Rabbit polyclonal antibody raised seven-transmembrane protein. Unlike yeast, several against a full-length human KDELR3 DNA using DNAx™ human homologs of the ERD2 gene, constituting the Immune technology. KDEL receptor gene family, have been described. KDELR3 was the third member of the family to be Immunogen: Full-length human DNA identified, and it encodes a protein highly homologous to KDELR1 and KDELR2 proteins. Two transcript variants Sequence: of KDELR3 that arise by alternative splicing, and encode MNVFRILGDLSHLLAMILLLGKIWRSKCCKGISGKSQIL different isoforms of KDELR3 receptor, have been FALVFTTRYLDLFTNFISIYNTVMKVVFLLCAYVTVYMIY described. [provided by RefSeq] GKFRKTFDSENDTFRLEFLLVPVIGLSFLENYSFTLLEIL WTFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYR ALYLANWIRRYQTENFYDQIAVVSGVVQTIFYCDFFYL YVTKVLKGKKLSLPMPI Host: Rabbit Reactivity: Human Applications: Flow Cyt-Tr, IF-Ex, IF-Tr, WB-Tr (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Purification: Protein A Storage Buffer: In 1x PBS, pH 7.4 Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 11015 Gene Symbol: KDELR3 Gene Alias: ERD2L3 Gene Summary: Retention of resident soluble proteins in the lumen of the endoplasmic reticulum (ER) is achieved in both yeast and animal cells by their continual retrieval from the cis-Golgi, or a pre-Golgi compartment. -
Ancient Genomic Regulatory Blocks Are a Major Source for Gene Deserts in Vertebrates After Whole Genome Duplications
Supplementary Information for: Ancient genomic regulatory blocks are a major source for gene deserts in vertebrates after whole genome duplications María Touceda-Suárez, Elizabeth M. Kita, Rafael D. Acemel, Panos N. Firbas, Marta S. Magri, Silvia Naranjo, Juan J. Tena, Jose Luis Gómez-Skarmeta, Ignacio Maeso, Manuel Irimia Corresponding Authors: Manuel Irimia Centre for Genomic Regulation Dr. Aiguader, 88, 08003 Barcelona, Spain e-mail: [email protected] Phone: +34933160212 Fax: +34933160099 Ignacio Maeso Centro Andaluz de Biología del Desarrollo (CABD-CSIC-UPO) Universidad Pablo de Olavide, Crta. Utrera km.1, 41013 Sevilla, España e-mail: [email protected] Phone: +34954348948 Fax: +34954349376 José Luis Gómez-Skarmeta Centro Andaluz de Biología del Desarrollo (CABD-CSIC-UPO) Universidad Pablo de Olavide, Crta. Utrera km.1, 41013 Sevilla, España e-mail: [email protected] Phone: +34954348948 Fax: +34954349376 1 Supplementary Figures Supplementary Figure S1 - Microsyntenic arrangements of ancient multi-bystander GRBs whose bystanders have become differentially retained next to different trans-dev ohnologs. For each case, the arrangement in a slow-evolving deuterostome (Bla, B. lanceolatum; Sko, S. kowalevskii; Spu, S. purpuratus) is provided on top (blue lines), followed by the GRB arrangements conserved in the human genome. 2 Supplementary Figure S2 - Evolution of the Hey-MrpS28-Hdcc2 GRB and its functional characterization in zebrafish. A) Phylogenetic distribution of the GRB across the studied metazoan species. Only B. floridae, S. kowalevskii, C. teleta and T. adhaerens have conserved both bystander genes: Hddc2 (grey) and MrpS28 (white), linked to the trans-dev gene Hey (black arrows). In vertebrates, each of the Hey paralogs has preserved only one of the bystander genes in a reciprocal manner. -
Senescence-Associated Ribosome Biogenesis Defects Contributes to Cell Cycle Arrest Through the Rb Pathway
ARTICLES https://doi.org/10.1038/s41556-018-0127-y Senescence-associated ribosome biogenesis defects contributes to cell cycle arrest through the Rb pathway Frédéric Lessard1, Sebastian Igelmann1, Christian Trahan2, Geneviève Huot1, Emmanuelle Saint-Germain1, Lian Mignacca1, Neylen Del Toro1, Stéphane Lopes-Paciencia1, Benjamin Le Calvé5, Marinieve Montero1, Xavier Deschênes-Simard4, Marina Bury6, Olga Moiseeva7, Marie-Camille Rowell1, Cornelia E. Zorca1, Daniel Zenklusen 1, Léa Brakier-Gingras1, Véronique Bourdeau1, Marlene Oeffinger1,2,3 and Gerardo Ferbeyre 1* Cellular senescence is a tumour suppressor programme characterized by a stable cell cycle arrest. Here we report that cellular senescence triggered by a variety of stimuli leads to diminished ribosome biogenesis and the accumulation of both rRNA pre- cursors and ribosomal proteins. These defects were associated with reduced expression of several ribosome biogenesis factors, the knockdown of which was also sufficient to induce senescence. Genetic analysis revealed that Rb but not p53 was required for the senescence response to altered ribosome biogenesis. Mechanistically, the ribosomal protein S14 (RPS14 or uS11) accu- mulates in the soluble non-ribosomal fraction of senescent cells, where it binds and inhibits CDK4 (cyclin-dependent kinase 4). Overexpression of RPS14 is sufficient to inhibit Rb phosphorylation, inducing cell cycle arrest and senescence. Here we describe a mechanism for maintaining the senescent cell cycle arrest that may be relevant for cancer therapy, as well as biomarkers to identify senescent cells. ellular senescence opposes neoplastic transformation by by cyclin-dependent kinases such as CDK2, CDK4 and CDK618. preventing the proliferation of cells that have experienced Genetic inactivation of CDK4 leads to p53-independent senes- oncogenic stimuli1. -
Hippo and Sonic Hedgehog Signalling Pathway Modulation of Human Urothelial Tissue Homeostasis
Hippo and Sonic Hedgehog signalling pathway modulation of human urothelial tissue homeostasis Thomas Crighton PhD University of York Department of Biology November 2020 Abstract The urinary tract is lined by a barrier-forming, mitotically-quiescent urothelium, which retains the ability to regenerate following injury. Regulation of tissue homeostasis by Hippo and Sonic Hedgehog signalling has previously been implicated in various mammalian epithelia, but limited evidence exists as to their role in adult human urothelial physiology. Focussing on the Hippo pathway, the aims of this thesis were to characterise expression of said pathways in urothelium, determine what role the pathways have in regulating urothelial phenotype, and investigate whether the pathways are implicated in muscle-invasive bladder cancer (MIBC). These aims were assessed using a cell culture paradigm of Normal Human Urothelial (NHU) cells that can be manipulated in vitro to represent different differentiated phenotypes, alongside MIBC cell lines and The Cancer Genome Atlas resource. Transcriptomic analysis of NHU cells identified a significant induction of VGLL1, a poorly understood regulator of Hippo signalling, in differentiated cells. Activation of upstream transcription factors PPARγ and GATA3 and/or blockade of active EGFR/RAS/RAF/MEK/ERK signalling were identified as mechanisms which induce VGLL1 expression in NHU cells. Ectopic overexpression of VGLL1 in undifferentiated NHU cells and MIBC cell line T24 resulted in significantly reduced proliferation. Conversely, knockdown of VGLL1 in differentiated NHU cells significantly reduced barrier tightness in an unwounded state, while inhibiting regeneration and increasing cell cycle activation in scratch-wounded cultures. A signalling pathway previously observed to be inhibited by VGLL1 function, YAP/TAZ, was unaffected by VGLL1 manipulation.