US EPA, Pesticide Product Label, QUINCLORAC 4L AG,03/04/2019

Total Page:16

File Type:pdf, Size:1020Kb

Load more

81,7('67$7(6(19,5210(17$/3527(&7,21$*(1&< :$6+,1*721'& 2)),&(2)&+(0,&$/6$)(7< $1'32//87,2135(9(17,21 0DUFK 0RUULV*DVNLQV $OEDXJK//& 32%R[ 9DOGRVWD*$ 6XEMHFW /DEHO$PHQGPHQW±5HLQVWDWH3DVWXUHDQG5DQJHODQG8VH 3URGXFW1DPH48,1&/25$&/$* (3$5HJLVWUDWLRQ1XPEHU $SSOLFDWLRQ'DWH 'HFLVLRQ1XPEHU 'HDU0U*DVNLQV 7KHDPHQGHGODEHOUHIHUUHGWRDERYHVXEPLWWHGLQFRQQHFWLRQZLWKUHJLVWUDWLRQXQGHUWKH)HGHUDO ,QVHFWLFLGH)XQJLFLGHDQG5RGHQWLFLGH$FWDVDPHQGHGLVDFFHSWDEOH7KLVDSSURYDOGRHVQRW DIIHFWDQ\FRQGLWLRQVWKDWZHUHSUHYLRXVO\LPSRVHGRQWKLVUHJLVWUDWLRQ<RXFRQWLQXHWREH VXEMHFWWRH[LVWLQJFRQGLWLRQVRQ\RXUUHJLVWUDWLRQDQGDQ\GHDGOLQHVFRQQHFWHGZLWKWKHP $VWDPSHGFRS\RI\RXUODEHOLQJLVHQFORVHGIRU\RXUUHFRUGV7KLVODEHOLQJVXSHUVHGHVDOO SUHYLRXVO\DFFHSWHGODEHOLQJ<RXPXVWVXEPLWRQHFRS\RIWKHILQDOSULQWHGODEHOLQJEHIRUH\RX UHOHDVHWKHSURGXFWIRUVKLSPHQWZLWKWKHQHZODEHOLQJ,QDFFRUGDQFHZLWK&)5 F \RXPD\GLVWULEXWHRUVHOOWKLVSURGXFWXQGHUWKHSUHYLRXVO\DSSURYHGODEHOLQJIRUPRQWKV IURPWKHGDWHRIWKLVOHWWHU$IWHUPRQWKV\RXPD\RQO\GLVWULEXWHRUVHOOWKLVSURGXFWLILW EHDUVWKLVQHZUHYLVHGODEHOLQJRUVXEVHTXHQWO\DSSURYHGODEHOLQJ³7RGLVWULEXWHRUVHOO´LV GHILQHGXQGHU),)5$VHFWLRQ JJ DQGLWVLPSOHPHQWLQJUHJXODWLRQDW&)5 6KRXOG\RXZLVKWRDGGUHWDLQDUHIHUHQFHWRWKHFRPSDQ\¶VZHEVLWHRQ\RXUODEHOWKHQSOHDVHEH DZDUHWKDWWKHZHEVLWHEHFRPHVODEHOLQJXQGHUWKH)HGHUDO,QVHFWLFLGH)XQJLFLGHDQG5RGHQWLFLGH $FWDQGLVVXEMHFWWRUHYLHZE\WKH$JHQF\,IWKHZHEVLWHLVIDOVHRUPLVOHDGLQJWKHSURGXFW ZRXOGEHPLVEUDQGHGDQGXQODZIXOWRVHOORUGLVWULEXWHXQGHU),)5$VHFWLRQ D ( &)5 D OLVWH[DPSOHVRIVWDWHPHQWV(3$PD\FRQVLGHUIDOVHRUPLVOHDGLQJ,QDGGLWLRQ UHJDUGOHVVRIZKHWKHUDZHEVLWHLVUHIHUHQFHGRQ\RXUSURGXFW¶VODEHOFODLPVPDGHRQWKH ZHEVLWHPD\QRWVXEVWDQWLDOO\GLIIHUIURPWKRVHFODLPVDSSURYHGWKURXJKWKHUHJLVWUDWLRQSURFHVV 7KHUHIRUHVKRXOGWKH$JHQF\ILQGRULILWLVEURXJKWWRRXUDWWHQWLRQWKDWDZHEVLWHFRQWDLQVIDOVH RUPLVOHDGLQJVWDWHPHQWVRUFODLPVVXEVWDQWLDOO\GLIIHULQJIURPWKH(3$DSSURYHGUHJLVWUDWLRQ WKHZHEVLWHZLOOEHUHIHUUHGWRWKH(3$¶V2IILFHRI(QIRUFHPHQWDQG&RPSOLDQFH <RXUUHOHDVHIRUVKLSPHQWRIWKHSURGXFWFRQVWLWXWHVDFFHSWDQFHRIWKHVHFRQGLWLRQV,IWKHVH FRQGLWLRQVDUHQRWFRPSOLHGZLWKWKHUHJLVWUDWLRQZLOOEHVXEMHFWWRFDQFHOODWLRQLQDFFRUGDQFH ZLWK),)5$VHFWLRQ,I\RXKDYHDQ\TXHVWLRQVSOHDVHFRQWDFW6DUDK0HDGRZVE\SKRQHDW RUYLDHPDLODWPHDGRZVVDUDK#HSDJRY )DVW7UDFN/DEHO$FFHSWDEOHY 3DJHRI (3$5HJ1R 'HFLVLRQ1R 6LQFHUHO\ (PLO\6FKPLG$FWLQJ3URGXFW0DQDJHU +HUELFLGH%UDQFK 5HJLVWUDWLRQ'LYLVLRQ 3 2IILFHRI3HVWLFLGH3URJUDPV QUINCLORAC GROUP 4 HERBICIDE QUINCLORAC 4L AG Herbicide ACTIVE INGREDIENT: Quinclorac: 3,7-dichloro-8-quinolinecarboxylic acid . 40.0% OTHER INGREDIENTS: . 60.0% TOTAL: . 100.0% Contains 3.8 pounds of quinclorac per gallon KEEP OUT OF REACH OF CHILDREN CAUTION FIRST AID x Call a poison control center or doctor immediately for treatment advice. IF x Have person sip a glass of water if able to swallow. SWALLOWED: x Do not induce vomiting unless told to do so by a poison control center or doctor. x Do not give anything by mouth to an unconscious person. IF ON SKIN OR x Take off contaminated clothing. CLOTHING: x Rinse skin immediately with plenty of water for 15-20 minutes. x Call a poison control center or doctor for treatment advice. x Hold eye open and rinse slowly and gently with water for 15-20 minutes. IF IN EYES: x Remove contact lenses, if present, after first 5 minutes, then continue rinsing eye. x Call a poison control center or doctor for treatment advice. x Move person to fresh air. IF INHALED: x If person is not breathing, call 911 or an ambulance, then give artificial respiration, preferably by mouth-to-mouth, if possible. x Call a poison control center or doctor for further treatment advice. Have the product container or label with you when calling a poison control center or doctor or going for treatment. In Case of Emergency regarding this product, call: CHEMTREC 1-800-424-9300 EPA Reg. No. 42750-169 EPA Est. NO. XXXXX-XX-XXX NET CONTENTS: Manufactured For: ALBAUGH, LLC ANKENY, IA 50021 1 PRECAUTIONARY STATEMENTS HAZARDS TO HUMANS AND DOMESTIC ANIMALS CAUTION: Harmful if swallowed or absorbed through the skin. Causes moderate eye irritation. Avoid contact with skin, clothing, or eyes. Avoid breathing vapor or spray mist. Wash hands thoroughly with soap and water after handling and before eating, drinking, chewing gum, using tobacco, or using the toilet. Remove contaminated clothing and wash before reuse. PERSONAL PROTECTIVE EQUIPMENT (PPE) Applicators and other handlers must wear: x Long-sleeved shirt and long pants x Chemical-resistant gloves made of butyl rubber, natural rubber, neoprene rubber, or nitrile rubber >14 mils x Shoes plus socks Discard clothing and other absorbent materials that have been drenched or heavily contaminated with this product's concentrate. Do not re-use them. Follow the manufacturer's instructions for cleaning and maintaining PPE. If no such instructions for washables exist, use detergent and hot water. Keep and wash PPE separately from other laundry. ENGINEERING CONTROLS STATEMENT When handlers use closed systems, enclosed cabs, or aircraft in a manner that meets the requirements listed in the Worker Protection Standard (WPS) for agricultural pesticides [40 CFR 170.240(d)(4-6)], the handler PPE requirements may be reduced or modified as specified in the WPS. USER SAFETY RECOMMENDATIONS Users should: x Remove clothing/PPE immediately if pesticide gets inside. Then wash thoroughly and put on clean clothing. x Remove PPE immediately after handling this product. Wash the outside of gloves before removing. As soon as possible, wash thoroughly and change into clean clothing. ENVIRONMENTAL HAZARDS This chemical has properties and characteristics associated with chemicals detected in groundwater. The use of this chemical where soils are permeable, particularly where the water table is shallow, may result in groundwater contamination. Keep out of lakes, ponds and streams. Do not apply directly to water, areas where surface water is present, or to intertidal areas below the mean high water mark, except as specified on this label for use in rice. Do not contaminate water by cleaning of equipment or disposal of rinsate. DIRECTIONS FOR USE It is a violation of Federal law to use this product in a manner inconsistent with its labeling. Do not apply this product in a way that will contact workers or other persons, either directly or through drift. Only protected handlers may be in the area during application. For any requirements specific to your state or tribe, consult the agency responsible for pesticide regulation. All applicable directions, restrictions, precautions and Conditions of Sales and Warranty are to be followed. This labeling must be in the user's possession during application. 2 AGRICULTURAL USE REQUIREMENTS Use this product only in accordance with its labeling and with the Worker Protection Standard, 40 CFR part 170. This standard contains requirements for the protection of agricultural workers on farms, forests, nurseries, and greenhouses, and handlers of agricultural pesticides. It contains requirements for training, decontamination, notification, and emergency assistance. It also contains specific instructions and exceptions pertaining to the statements on this label about personal protective equipment (PPE), and restricted-entry interval. The requirements in this box only apply to uses of this product that are covered by the Worker Protection Standard. Do not enter or allow worker entry into treated areas during the restricted entry interval (REI) of 12 hours. PPE required for early entry to treated areas that is permitted under the Worker Protection Standard and that involves contact with anything that has been treated, such as plants, soil, or water, is: x Coveralls x Chemical resistant gloves made of butyl rubber, natural rubber, neoprene rubber, or nitrile rubber >14 mils x Shoes plus socks STORAGE AND DISPOSAL Do not contaminate water, food, or feed by storage and disposal. PESTICIDE STORAGE: Store in cool, dry and well ventilated area. Do not store containers under wet conditions. PESTICIDE DISPOSAL: Wastes resulting from this product must be disposed of on site or at an approved waste disposal facility. CONTAINER HANDLING: Non-refillable containers (1, 2.5, 30 & 55 gallon): Do not reuse or refill this container. Offer for recycling, if available. Triple rinse or pressure rinse container (or equivalent) promptly after emptying. (non-refillable <5 gallons): Triple rinse as follows: Empty the remaining contents into application equipment or a mix tank and drain for 10 seconds after the flow begins to drip. Fill the container ¼ full with water and recap. Shake for 10 seconds. Pour rinsate into application equipment or a mix tank or store rinsate for later use or disposal. Drain for 10 seconds after the flow begins to drip. Repeat this procedure two more times. Pressure rinse as follows: Empty the remaining contents into application equipment or a mix tank and continue to drain for 10 seconds after the flow begins to drip. Hold container upside down over application equipment or mix tank or collect rinsate for later use or disposal. Insert pressure rinsing nozzle in the side of the container, and rinse at about 40 PSI for at least 30 seconds. Drain for 10 seconds after the flow begins to drip. (non-refillable >5 gallons): Triple rinse as follows: Empty the remaining contents into application equipment or a mix tank. Fill the container ¼ full with water. Replace and tighten closures. Tip container on its side and roll it back and forth, ensuring at least one complete revolution, for 30 seconds. Stand the container on its end and tip it back and forth several
Recommended publications
  • 2,4-Dichlorophenoxyacetic Acid

    2,4-Dichlorophenoxyacetic Acid

    2,4-Dichlorophenoxyacetic acid 2,4-Dichlorophenoxyacetic acid IUPAC (2,4-dichlorophenoxy)acetic acid name 2,4-D Other hedonal names trinoxol Identifiers CAS [94-75-7] number SMILES OC(COC1=CC=C(Cl)C=C1Cl)=O ChemSpider 1441 ID Properties Molecular C H Cl O formula 8 6 2 3 Molar mass 221.04 g mol−1 Appearance white to yellow powder Melting point 140.5 °C (413.5 K) Boiling 160 °C (0.4 mm Hg) point Solubility in 900 mg/L (25 °C) water Related compounds Related 2,4,5-T, Dichlorprop compounds Except where noted otherwise, data are given for materials in their standard state (at 25 °C, 100 kPa) 2,4-Dichlorophenoxyacetic acid (2,4-D) is a common systemic herbicide used in the control of broadleaf weeds. It is the most widely used herbicide in the world, and the third most commonly used in North America.[1] 2,4-D is also an important synthetic auxin, often used in laboratories for plant research and as a supplement in plant cell culture media such as MS medium. History 2,4-D was developed during World War II by a British team at Rothamsted Experimental Station, under the leadership of Judah Hirsch Quastel, aiming to increase crop yields for a nation at war.[citation needed] When it was commercially released in 1946, it became the first successful selective herbicide and allowed for greatly enhanced weed control in wheat, maize (corn), rice, and similar cereal grass crop, because it only kills dicots, leaving behind monocots. Mechanism of herbicide action 2,4-D is a synthetic auxin, which is a class of plant growth regulators.
  • Herbicide Mode of Action Table High Resistance Risk

    Herbicide Mode of Action Table High Resistance Risk

    Herbicide Mode of Action Table High resistance risk Chemical family Active constituent (first registered trade name) GROUP 1 Inhibition of acetyl co-enzyme A carboxylase (ACC’ase inhibitors) clodinafop (Topik®), cyhalofop (Agixa®*, Barnstorm®), diclofop (Cheetah® Gold* Decision®*, Hoegrass®), Aryloxyphenoxy- fenoxaprop (Cheetah®, Gold*, Wildcat®), fluazifop propionates (FOPs) (Fusilade®), haloxyfop (Verdict®), propaquizafop (Shogun®), quizalofop (Targa®) Cyclohexanediones (DIMs) butroxydim (Factor®*), clethodim (Select®), profoxydim (Aura®), sethoxydim (Cheetah® Gold*, Decision®*), tralkoxydim (Achieve®) Phenylpyrazoles (DENs) pinoxaden (Axial®) GROUP 2 Inhibition of acetolactate synthase (ALS inhibitors), acetohydroxyacid synthase (AHAS) Imidazolinones (IMIs) imazamox (Intervix®*, Raptor®), imazapic (Bobcat I-Maxx®*, Flame®, Midas®*, OnDuty®*), imazapyr (Arsenal Xpress®*, Intervix®*, Lightning®*, Midas®* OnDuty®*), imazethapyr (Lightning®*, Spinnaker®) Pyrimidinyl–thio- bispyribac (Nominee®), pyrithiobac (Staple®) benzoates Sulfonylureas (SUs) azimsulfuron (Gulliver®), bensulfuron (Londax®), chlorsulfuron (Glean®), ethoxysulfuron (Hero®), foramsulfuron (Tribute®), halosulfuron (Sempra®), iodosulfuron (Hussar®), mesosulfuron (Atlantis®), metsulfuron (Ally®, Harmony®* M, Stinger®*, Trounce®*, Ultimate Brushweed®* Herbicide), prosulfuron (Casper®*), rimsulfuron (Titus®), sulfometuron (Oust®, Eucmix Pre Plant®*, Trimac Plus®*), sulfosulfuron (Monza®), thifensulfuron (Harmony®* M), triasulfuron (Logran®, Logran® B-Power®*), tribenuron (Express®),
  • INDEX to PESTICIDE TYPES and FAMILIES and PART 180 TOLERANCE INFORMATION of PESTICIDE CHEMICALS in FOOD and FEED COMMODITIES

    INDEX to PESTICIDE TYPES and FAMILIES and PART 180 TOLERANCE INFORMATION of PESTICIDE CHEMICALS in FOOD and FEED COMMODITIES

    US Environmental Protection Agency Office of Pesticide Programs INDEX to PESTICIDE TYPES and FAMILIES and PART 180 TOLERANCE INFORMATION of PESTICIDE CHEMICALS in FOOD and FEED COMMODITIES Note: Pesticide tolerance information is updated in the Code of Federal Regulations on a weekly basis. EPA plans to update these indexes biannually. These indexes are current as of the date indicated in the pdf file. For the latest information on pesticide tolerances, please check the electronic Code of Federal Regulations (eCFR) at http://www.access.gpo.gov/nara/cfr/waisidx_07/40cfrv23_07.html 1 40 CFR Type Family Common name CAS Number PC code 180.163 Acaricide bridged diphenyl Dicofol (1,1-Bis(chlorophenyl)-2,2,2-trichloroethanol) 115-32-2 10501 180.198 Acaricide phosphonate Trichlorfon 52-68-6 57901 180.259 Acaricide sulfite ester Propargite 2312-35-8 97601 180.446 Acaricide tetrazine Clofentezine 74115-24-5 125501 180.448 Acaricide thiazolidine Hexythiazox 78587-05-0 128849 180.517 Acaricide phenylpyrazole Fipronil 120068-37-3 129121 180.566 Acaricide pyrazole Fenpyroximate 134098-61-6 129131 180.572 Acaricide carbazate Bifenazate 149877-41-8 586 180.593 Acaricide unclassified Etoxazole 153233-91-1 107091 180.599 Acaricide unclassified Acequinocyl 57960-19-7 6329 180.341 Acaricide, fungicide dinitrophenol Dinocap (2, 4-Dinitro-6-octylphenyl crotonate and 2,6-dinitro-4- 39300-45-3 36001 octylphenyl crotonate} 180.111 Acaricide, insecticide organophosphorus Malathion 121-75-5 57701 180.182 Acaricide, insecticide cyclodiene Endosulfan 115-29-7 79401
  • U.S. EPA, Pesticide Product Label, QUINCLORAC 75 SWF, 02/06/2006

    U.S. EPA, Pesticide Product Label, QUINCLORAC 75 SWF, 02/06/2006

    u.s. ENVIRONM£~J7AL PkO';EC';ION N:JENCY EPfI, Req. Cate ~f Issuance: Office of t'esticide "roqram.<; Number: Keqistratlon Divlsion (7:'()SC) 1200 Pennsylvania Ave., N.W. WashingtrJII, D.::'. ?046D 42750- 131 FEE - 6 2006 NOTICE OF PESTICIDE: Term of Issuance: ~ Registration Conditional __ Reregistration : under r: fRJ'l., as am'?nd'O'd: Name of ~esticide Product: Quinclorac 75DF SWF Name and Address of RegIstrant ,include ZIP Codej: Albaugh, Inc. P.O. Box 2127 Valdosta, GA 31604-2127 Note: Changes in .LabEoli~fg differing in suostance from that accepted in connection with this registration must be submitted to and accepted by the Registratlon Division prior to use of the label in commerce. In any correspondence on this product always refer to the above EPA registration number. em ::he bas':s of lnformat':on f ~rr,lshed by the reg:s'Crant, the above llamed pesticide ':5 hereby roegisterea/reregJ.3terec under :::--.e federa; =nsec::':c:ide, fungicide and Rodenticide Act. Reg':straL,on is ir. no (.Jay tc be ::onstrued as an endorsement or recommendation of this product by the Agency. =n urder to protect hea~ttJ and tr.e ",nvil"onment, ::he Admir.istrator, on his motion, may at any time suspend or cancel the regi3t:::ation of a pesticide in accoraance with the Act. The acceptance of any name 1.n connection with the registration of a product under this Act is not to be construed as giving the registrant a right to -=xclusive use of the r,ame or to its use if it has been coveroed by others.
  • Thickening Glyphosate Formulations

    Thickening Glyphosate Formulations

    (19) TZZ _T (11) EP 2 959 777 A1 (12) EUROPEAN PATENT APPLICATION (43) Date of publication: (51) Int Cl.: 30.12.2015 Bulletin 2015/53 A01N 57/20 (2006.01) A01N 25/30 (2006.01) A01P 13/00 (2006.01) (21) Application number: 15175726.7 (22) Date of filing: 17.08.2009 (84) Designated Contracting States: (71) Applicant: Akzo Nobel N.V. AT BE BG CH CY CZ DE DK EE ES FI FR GB GR 6824 BM Arnhem (NL) HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO SE SI SK SM TR (72) Inventor: ZHU, Shawn Stormville, NY New York 12582 (US) (30) Priority: 19.08.2008 US 90010 P 09.09.2008 EP 08163910 (74) Representative: Akzo Nobel IP Department Velperweg 76 (62) Document number(s) of the earlier application(s) in 6824 BM Arnhem (NL) accordance with Art. 76 EPC: 11191518.7 / 2 425 716 Remarks: 09781884.3 / 2 315 524 This application was filed on 07-07-2015 as a divisional application to the application mentioned under INID code 62. (54) THICKENING GLYPHOSATE FORMULATIONS (57) The present invention generally relates to a glyphosate formulation with enhanced viscosity, said formulation containing a thickening composition comprising at least one nitrogen- containing surfactant. EP 2 959 777 A1 Printed by Jouve, 75001 PARIS (FR) EP 2 959 777 A1 Description FIELD OF THE INVENTION 5 [0001] The present invention relates to a glyphosate formulations thickened by nitrogen containing surfactants. BACKGROUND OF THE INVENTION [0002] Glyphosate is the most widely used herbicide in the world.
  • List of Herbicide Groups

    List of Herbicide Groups

    List of herbicides Group Scientific name Trade name clodinafop (Topik®), cyhalofop (Barnstorm®), diclofop (Cheetah® Gold*, Decision®*, Hoegrass®), fenoxaprop (Cheetah® Gold* , Wildcat®), A Aryloxyphenoxypropionates fluazifop (Fusilade®, Fusion®*), haloxyfop (Verdict®), propaquizafop (Shogun®), quizalofop (Targa®) butroxydim (Falcon®, Fusion®*), clethodim (Select®), profoxydim A Cyclohexanediones (Aura®), sethoxydim (Cheetah® Gold*, Decision®*), tralkoxydim (Achieve®) A Phenylpyrazoles pinoxaden (Axial®) azimsulfuron (Gulliver®), bensulfuron (Londax®), chlorsulfuron (Glean®), ethoxysulfuron (Hero®), foramsulfuron (Tribute®), halosulfuron (Sempra®), iodosulfuron (Hussar®), mesosulfuron (Atlantis®), metsulfuron (Ally®, Harmony®* M, Stinger®*, Trounce®*, B Sulfonylureas Ultimate Brushweed®* Herbicide), prosulfuron (Casper®*), rimsulfuron (Titus®), sulfometuron (Oust®, Eucmix Pre Plant®*), sulfosulfuron (Monza®), thifensulfuron (Harmony®* M), triasulfuron, (Logran®, Logran® B Power®*), tribenuron (Express®), trifloxysulfuron (Envoke®, Krismat®*) florasulam (Paradigm®*, Vortex®*, X-Pand®*), flumetsulam B Triazolopyrimidines (Broadstrike®), metosulam (Eclipse®), pyroxsulam (Crusader®Rexade®*) imazamox (Intervix®*, Raptor®,), imazapic (Bobcat I-Maxx®*, Flame®, Midas®*, OnDuty®*), imazapyr (Arsenal Xpress®*, Intervix®*, B Imidazolinones Lightning®*, Midas®*, OnDuty®*), imazethapyr (Lightning®*, Spinnaker®) B Pyrimidinylthiobenzoates bispyribac (Nominee®), pyrithiobac (Staple®) C Amides: propanil (Stam®) C Benzothiadiazinones: bentazone (Basagran®,
  • 287 Part 180—Tolerances and Ex- Emptions

    287 Part 180—Tolerances and Ex- Emptions

    Environmental Protection Agency Pt. 180 (iv) The data and information sub- (c) The presiding officer may reopen mitted in support of the petition. the record to receive further evidence (v) The notice of filing of the peti- at any time before the filing of the ini- tion. tial decision. (3) Any order issued under § 177.130 of this chapter to which the objection re- PART 180ÐTOLERANCES AND EX- lated, the regulation that was the sub- EMPTIONS FROM TOLERANCES ject of that order, and each related No- FOR PESTICIDE CHEMICALS IN tice of Proposed Rulemaking. (4) Any order issued under § 180.7(g) of FOOD this chapter to which the objection re- lated, and: EDITORIAL NOTE: An alphabetical listing of (i) The regulation or petition denial pesticide chemicals appears at the end of that was the subject of that order. this table of contents. (ii) The petition to which such order Subpart AÐDefinitions and Interpretative responded. Regulations (iii) Any amendment or supplement of the petition. DEFINITIONS AND INTERPRETATIONS (iv) The data and information sub- Sec. mitted in support of the petition. 180.1 Definitions and interpretations. (v) The notice of filing of the peti- 180.2 Pesticide chemicals considered safe. tion. 180.3 Tolerances for related pesticide chemi- (5) Any order issued under § 180.29(f) cals. of this chapter to which the objection 180.4 Exceptions. related, the regulation that was the 180.5 Zero tolerances. subject of that order, and each related 180.6 Pesticide tolerances regarding milk, eggs, meat, and/or poultry; statement of Notice of Proposed Rulemaking.
  • Chemical Weed Control

    Chemical Weed Control

    2014 North Carolina Agricultural Chemicals Manual The 2014 North Carolina Agricultural Chemicals Manual is published by the North Carolina Cooperative Extension Service, College of Agriculture and Life Sciences, N.C. State University, Raleigh, N.C. These recommendations apply only to North Carolina. They may not be appropriate for conditions in other states and may not comply with laws and regulations outside North Carolina. These recommendations are current as of November 2013. Individuals who use agricultural chemicals are responsible for ensuring that the intended use complies with current regulations and conforms to the product label. Be sure to obtain current information about usage regulations and examine a current product label before applying any chemical. For assistance, contact your county Cooperative Extension agent. The use of brand names and any mention or listing of commercial products or services in this document does not imply endorsement by the North Carolina Cooperative Extension Service nor discrimination against similar products or services not mentioned. VII — CHEMICAL WEED CONTROL 2014 North Carolina Agricultural Chemicals Manual VII — CHEMICAL WEED CONTROL Chemical Weed Control in Field Corn ...................................................................................................... 224 Weed Response to Preemergence Herbicides — Corn ........................................................................... 231 Weed Response to Postemergence Herbicides — Corn ........................................................................
  • Control of Crabgrass in Home Lawns

    Control of Crabgrass in Home Lawns

    AY-10-W IL-IN TW 33 CControlontrol ooff CrabgrassCrabgrass inin HomeHome LawnsLawns Crabgrass is a common weed that infests home lawns in the Midwest (Figure 1). Crabgrass is an summer annual weed that germinates when soil temperatures are approximately 60º F for 3-5 days at the 1/4” level. It begins fl owering and setting seed in July and dyes with the fi rst frost of fall. Crabgrass has tremendous survival reproductive Purdue University capabilities. Because of this, it is unrealistic Turf Science to expect a crabgrass free lawn. You cannot Department of eradicate crabgrass (or any other pest for that Agronomy matter); a few crabgrass plants in your lawn are Figure 1. Mature crabgrass plant (Zac Reicher). www.agry.purdue.edu/turf acceptable. Cultural Crabgrass Control The most effective way to control crabgrass is University of Illinois to create a dense, healthy turf. A healthy turf will Turfgrass Program compete well with crabgrass and prevent it from Department of establishing. Natural Mowing Resources and Environmental • Mow at 2.5 to 3.0 inches depending on the turf Sciences species. Mowing below this range will increase www.turf.uiuc.edu crabgrass populations (Figure 2). • Mow frequently so as not to remove more than Figure 2. High crabgrass population in a Kentucky 1/3 of the leaf blade at one time. This may mean bluegrass lawn mown at 1.0 inch (Aaron Patton). mowing twice weekly in spring and every other week in summer. Fertilization Irrigation Apply 2 to 4 pounds nitrogen per 1000 ft2 each Irrigate deeply and infrequently.
  • Making Sense of All the Post Emergent Herbicide Options in Turf

    Making Sense of All the Post Emergent Herbicide Options in Turf

    Making Sense of All the Post Emergent Herbicide Options in Turf Brian McDonald OSU Horticulture Dec 17, 2013 Turf Herbicides are Like Cereals – more choices than you need. PBI Gordon Has 8 “Trimec’s”! 1. Super Trimec 2. Trimec 1000 3. Trimec 992 4. Trimec – Bentgrass Formula 5. Trimec Classic 6. Trimec LAF – 637 7. Trimec Plus 8. Trimec Southern NuFarm Has Even More Choices! 1. 4-Speed (Pyraflufen + 2,4-D, MCPP, Dicamba) 2. 4-Speed XT (Pyraflufen + 2,4-D, Triclopyr, Dicamba) 3. Cool Power (Ester Triclopyr, MCPA, Dicamba) 4. Escalade 2 (2,4-D, Fluroxypyr, & Dicamba) 5. Horsepower (MCPA, Triclopyr, and Dicamba) 6. Quincept (2,4-D, Drive, & Dicamba) 7. (3) different “Triplet”s (Low odor, Sensitive & SF) 8. Change Up (MCPA, fluroxypyr, dicamba) 9. Elliptical (2,4-D, Fluroxypyr, & Dicamba) 10. Millennium Ultra 2 (2,4-D, Clopyralid, & Dicamba) How do we make sense out of all of these? Overview 1. Making sense of all the Choices a. Review the “standard” 3 – way mixes b. Look at “newer kids” on the block c. Review “alternative” herbicide mixes 2. Review the common weeds and match the herbicides to the weeds. 3. Maximizing weed kill – other factors. 4. Go through a few scenarios. Common Broadleaf Chemicals Chemical Common formulations 2,4-D Amine salt Ester 2,4-DP Amine salt Ester MCPA Amine salt Ester MCPP Amine salt Dicamba Amine salt Triclopyr Amine salt Ester Clopyralid Amine salt Quinclorac Amine salt “New Kids on the Block” Chemical Common formulations Fluroxypyr (Spotlight/Escalade 2) Ester Carfentrazone (Quicksilver/SpeedZone/ PowerZone) Sulfentrazone (in Q4) Pyraflufen (in 4-Speed + 2,4-D, MCPP, Dicamba) Pyraflufen (in 4-Speed XT + 2,4-D, Triclopyr, Dicamba) Penoxulam (Sapphire) Florasulam (Defendor) Tenacity (Mesotrione) – Post/Pre emergent My Classifications 1.
  • Method 515.4 Determination of Chlorinated Acids In

    Method 515.4 Determination of Chlorinated Acids In

    METHOD 515.4 DETERMINATION OF CHLORINATED ACIDS IN DRINKING WATER BY LIQUID-LIQUID MICROEXTRACTION, DERIVATIZATION, AND FAST GAS CHROMATOGRAPHY WITH ELECTRON CAPTURE DETECTION Revision 1.0 April 2000 S.C. Wendelken, M.V. Bassett, T.A. Dattilio, and B.V. Pepich (IT Corporation) D.J. Munch (US EPA, Office of Ground Water and Drinking Water) - Method 515.4, Revision 1.0 (2000) A. M. Pawlecki-Vonderheide (ICI) and D.J. Munch (US EPA, Office of Ground Water and Drinking Water) - Method 515.3, Revision 1.0 (1996) J.W. Hodgeson - Method 515.2, Revision 1.0 (1992) R.L. Graves - Method 515.1, Revision 4.0 (1989) T. Engels (Batelle Columbus Laboratory) and D.J. Munch (US EPA, Office of Ground Water and Drinking Water) - National Pesticide Survey Method 3, Revision 3.0 (1987) J.W. Hodgeson - Method 515, Revision 2.0 (1986) TECHNICAL SUPPORT CENTER OFFICE OF GROUND WATER AND DRINKING WATER U. S. ENVIRONMENTAL PROTECTION AGENCY CINCINNATI, OHIO 45268 515.4-1 METHOD 515.4 DETERMINATION OF CHLORINATED ACIDS IN DRINKING WATER BY LIQUID-LIQUID MICROEXTRACTION, DERIVATIZATION, AND FAST GAS CHROMATOGRAPHY WITH ELECTRON CAPTURE DETECTION 1. SCOPE AND APPLICATION 1.1 This is a fast gas chromatography (GC) method for the determination of chlorinated acids in drinking waters. Accuracy, precision, and Detection Limit data have been generated for the following compounds in reagent water and finished ground and surface waters. Analyte Chemical Abstracts Service Registry Number Acifluorfen(a) 50594-66-6 Bentazon 25057-89-0 Chloramben 133-90-4 2,4-D 94-75-7 Dalapon 75-99-0 2,4-DB 94-82-6 Dacthal acid metabolites(b) Dicamba 1918-00-9 3,5-Dichlorobenzoic acid 51-36-5 Dichlorprop 120-36-5 Dinoseb 88-85-7 Pentachlorophenol 87-86-5 Picloram 1918-02-1 2,4,5-T 93-76-5 2,4,5-TP (Silvex) 93-72-1 Quinclorac 84087-01-4 (a) The herbicide Lactofen will be quantitated as Acifluorfen as their structures represent different esters of the same acid herbicide.
  • ABSTRACT VINCENT, WILLIAM JACOB. Evaluating Quinclorac For

    ABSTRACT VINCENT, WILLIAM JACOB. Evaluating Quinclorac For

    ABSTRACT VINCENT, WILLIAM JACOB. Evaluating Quinclorac for Grass Weed Management in Grain Sorghum in North Carolina. (Under the direction of Wesley J. Everman). Grain sorghum [Sorghum bicolor (L.) Moench] is the sixth most popularly grown cereal grain crop globally behind rice [Oryza sativa (L.)], wheat [Triticum aestivum (L.)], corn [Zea mays (L.)], soybean [Glycine max (L.)], and barley [Hordeum vulgare (L.)]. Weed management is a concern for grain sorghum growers as few herbicides are developed for grain sorghum use because of its relatively small planted area in the United States compared to corn and soybean. Many herbicides are available to control broadleaf weeds in grain sorghum but few exist for selective annual grass weed management. In 2013, quinclorac previously used in rice, turf, switchgrass [Panicum virgatum (L.)], and pre-plant wheat scenarios was registered for in-crop grain sorghum use. Literature review of previous work indicated the susceptibility of many common annual grass weed species to quinclorac. Experiments were conducted to evaluate crop safety and herbicide system strategies for grain sorghum weed management in North Carolina. Adjuvants are commonly used to enhance the efficacy of postemergence (POST) herbicides. However, discrepancy exists about which products to use with quinclorac. Field and greenhouse experiments were conducted to investigate the impact of quinclorac rate, application timing according to weed growth stage, fertilizer additive, and spray adjuvant on problem weeds and grain sorghum. Increased quinclorac rate proved to be important to weed control when applications were made to weeds beyond 5 cm; otherwise results were not in support of using higher quinclorac rates. In general, oil-based adjuvants enhanced the activity of quinclorac compared with nonionic surfactant.