DOCSLIB.ORG

Dullahan Ships in for Pacific Score Love and a Little Bit

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Dullahan Ships in for Pacific Score Love and a Little Bit MONDAY, AUGUST 27, 2012 732-747-8060 $ TDN Home Page Click Here DULLAHAN SHIPS IN FOR PACIFIC SCORE LOVE AND A LITTLE BIT OF LUCK Heading into yesterday=s GI Pacific Classic at Del Overlooked at odds of 10-1 in a field loaded with Mar, Donegal Racing=s Dullahan (Even the Score) hadn=t quality, Love and Pride (A.P. Indy) took advantage of a visited the winner=s circle since a solid score in the messy start by Grade I winner It=s Tricky (Mineshaft) Apr. 14 GI Blue Grass and repelled the late run of reigning champion 3-year- S. at Keeneland. Facing old filly Royal Delta (Empire Maker) to punch her ticket off in a competitive to Santa Anita when taking Sunday=s Breeders= Cup affair which included AWin and You=re In@ designated GI Personal Ensign S. at West Coast stand outs Saratoga. The tone for the race was set as soon as the Game On Dude gate flew open as favored It=s Tricky went to her knees, (Awesome Again), Rail spotting the field several lengths. Meanwhile, Love and Trip (Jump Start) and Pride--with blinkers off--enjoyed a better break and Richard=s Kid (Lemon settled in second behind Brushed by a Star (Eddington), Drop Kid), the striking who set an opening half in :47 3/5. Keeping that rival in Dullahan chestnut needed to her sights down the backstretch, the Green Hills Farm Benoit Photo produce his best effort runner inherited the lead as the pacesetter began to wilt and he did just that following three quarters in 1:11 1/5. Turning for home, with a record-setting performance, earning an Love and Pride drifted out enough to allow It=s Tricky, automatic berth in to the GI Breeders= Cup Classic at who was hustled into position after her troubled start, Santa Anita Nov. 3. AHow about that,@ said Tammy slip through along the inside as Royal Delta--with Mike Fox, assistant to trainer Dale Romans. AOh my God; he Smith at the helm--took the overland route. For a brief ran great. I=m so glad we can come to California and moment, it appeared the champion would not have the take the west coast money. They always take our necessary kick to challenge the new leader but, while money, now we=re taking theirs.@ Off at odds of 5-1, he she found extra to reel in Lone and Pride nearing the was well-rated under Joel Rosario as rank outsider wire, she didn=t have enough to seal the deal and had Riveting Reason (Fusaichi Pegasus) made the early to play the bridesmaid. Despite trying her best along running. Game On Dude, the expected pacesetter, was the inner, It=s Tricky=s early exertions appeared to have unhurried in third, and while he put his head in front as taken their toll in the stretch and the Godolphin runner they moved into the far turn, had to settle for third. Cont. p4 it was Dullahan who caught the eye as he began mowing down rivals with a five-wide move. Once into the stretch, Dullahan cut into Game On Dude's lead with every stride and was along in plenty of time to get up and win by a length. Richard's Kid (Lemon Drop Kid) finished third and Rail Trip (Jump Start) completed the super. A[Dullahan=s connections] didn=t give me any special instructions, said Rosario. Dullahan, Joel Rosario & @ Just said the obvious: he s a owner Jerry Crawford A = Benoit Photo closer, save ground if you can, then make a late run. It worked out perfect. He=s a one-paced horse. He just goes and goes. When we went for home and I saw [Game On Dude] in front of me, I knew I had a big chance. My horse was coming and coming. He doesn=t stop. He=s a nice horse; a very nice horse.@ Cont. p3 In This Issue Capital Account Tops 60 Broad St., Suite 100 Red Bank, NJ 07701 GII Pat O’Brien S. (732) 747-8060 (732) 747-8955 (fax) Already a J “TDN Rising Star” J, www.thoroughbreddailynews.com Capital Account (Closing Argument) rallied www.thetdn.com late to hand stablemate Coil (Point Given) a , co-publisher narrow defeat in Sunday’s GII Pat O’Brien S. Barry Weisbord [email protected] at Del Mar. Coverage page 6 Benoit Photo Sue Finley, co-publisher [email protected] First Cornerstone Takes G2 Futurity S. Editorial Supplemented to Sunday’s G2 Futurity S. by trainer Andrew Oliver last [email protected] Jessica Martini, Editor-in-Chief week, First Cornerstone (Ire) (Hurricane Run {Ire}) provided a quick return Alan Carasso, Managing Editor for his new owner Team Valor, who bought the colt last week. TDN’s Marie Kizenko, Senior Editor Kelsey Riley has the details today. Christina Bossinakis, Senior Editor Coverage begins page 8 Lucas Marquardt, Features Editor Steve Sherack, Racing Editor Brian DiDonato, Racing Analyst/Soc. Media Dir. Showdown at the Spa Rolls On Justina Severni, Assistant Editor Advertising [email protected] Coming down to the wire, TDN’s Steve Sherack and Brian DiDonato Alycia Borer, Director of Advertising draw ever closer in their battle for handicapping supremacy at the 2012 Lia Kusch, Senior Advertising Designer Saratoga meet. DiDonato takes his shot with a well-related longshot, while Sarah K. Andrew, Adv Assistant/Distribution Sherack tries his luck with a well-connected bay in the 7th. Check out Amanda Crelin, Advertising Assistant exactly what they’ve got going on Monday’s card. Page 1 (atw) Customer Service [email protected] Vicki Forbes, Director of Customer Service A Rising Star in our midst Information Technology Robert Williams, Director of IT A daughter of Pulpit earns J “TDN Rising Star” J status with an [email protected] impressive score in the second at the Spa Sunday. You can see exactly how Gregg Casillo, DB Administrator, Programming she did it in Monday’s TDN. [email protected] Coverage page 2 (atw) Marketing Gary King, Marketing Manager [email protected] Fasig-Tipton Hosts Texas Sale Monday TDN Newmarket Bureau: Cafe Racing The Fasig-Tipton Texas Summer Yearling Sale gets underway at Lone [email protected] Star Park in Grand Prairie Monday. Sean Cronin page 3 (atw) Tom Frary P TDN HEADLINE NEWS • 8/27/12 • PAGE 3 of 16 • thoroughbreddailynews.com Sunday, Del Mar TVG Pacific Classic TVG PACIFIC CLASSIC S.-GI, $1,000,000, DMR, 8-26, 3yo/up, 1 1/4m (AWT), 1:59 2/5 (NTR), ft. 1--DULLAHAN, 118, c, 3, by Even The Score 1st Dam: Mining My Own, by Smart Strike Trying to capture his fourth victory from five starts 2nd Dam: Aspenelle, by Vice Regent so far in 2012, Game on Dude entered this year=s 3rd Dam: Little To Do, by Dynastic Pacific Classic off wins in the June 2 GII Californian and ($250,000 yrl '10 KEESEP). O-Donegal Racing; the July 7 GI Hollywood Gold Cup. The bay finished B-Phil & Judy Needham & Bena Halecky (KY); fourth in last year=s renewal of the 1 T-Dale L Romans; J-Joel Rosario. $600,000. Lifetime 1/4-mile race. AThat was him Record: 12-3-2-3, $1,702,091. *1/2 to Mine That making that move on the Bird (Birdstone), Ch. 2yo-Can, GISW, $1,924,256. backstretch. I didn=t send him,@ Werk Nick Rating: A+++ *Triple Plus*. explained Chantal Sutherland, Click for the eNicks report & 5-cross pedigree. aboard the runner up. AHe just got A top heart score candidate at yrlg auction for EQB client Donegal Stable strong at the five [furlong pole]. He KY-BRED QUALITY wanted to go. When he put his KTA / KTOB head in front of David [Flores on 2--Game On Dude, 124, g, 5, Awesome Again- - longshot Riveting Reason], he was Worldly Pleasure, by Devil His Due. ($210,000 RNA fine. Then around the sixteenth yrl '08 KEESEP). O-Diamond Pride LLC, Lanni Family pole, as I was switching my stick to Trust, Mercedes Stable LLC & B Schiappa; the left hand, I pushed my rein B-Adena Springs (KY); T-Bob Baffert. $200,000. Dullahan loose. It was dangling at the end; it Hidden Brook consigned for Adena Springs Horsephotos looked awful sloppy. I haven=t done something like that in 13 years. But 3--Richard's Kid, 124, h, 7, Lemon Drop Kid- - Tough I don=t think it affected anything. He was still doing Broad, by Broad Brush. O-D Kenney, Triple B Farms what he could do. Just unfortunate.@ Dullahan launched (Boghossian), Westside Rentalscom & Et Al; his juvenile campaign with little fanfare sprinting at B-Fitzhugh LLC (MD); T-Leandro Mora. $120,000. Churchill Downs last summer, but was only a nose removed from getting off the duck going past a mile at Saratoga in August. Third in the grassy with GII With Margins: HF, 2 3/4, 1 1/4. Odds: 5.30, 1.30, 4.80. Anticipation S. in September, he came back to score in Also Ran: Rail Trip, Suggestive Boy (Arg), Amani (Chi), the GI Breeders= Futurity over Keeneland=s Polytrack Jaycito, Where's Sterling, Akkadian, Riveting Reason. Oct. 8. Sent off at 17-1 for the GI Breeders= Cup Click for the brisnet.com chart, the brisnet.com PPs o r Juvenile, the half to GI Kentucky Derby hero Mine That the free brisnet.com catalogue-style pedigree. Video, Bird (Birdstone) closed well to be fourth. Second in his sponsored by Taylor Made Sales.
Load more

Recommended publications
  • Pacific Wind Captures the G2 Ruffian at Belmont Park
    PASSPORT Pacific Wind captures the G2 Ruffian at Belmont Park OVERVIEW G2 winner/G1Placed on the DIRT G2 placed on the TURF By leading sire CURLIN Half-Sister to multiple Graded Stakes Winner PACIFIC WIND HIP Curlin x Shag, by Dixieland Band 163 BARN 9 Selling Tuesday, November 5th PAST PERFORMANCES G1Ws G2Ws G1W GSP G2W G2W Pacific Wind put together an unforgettable debut performance winning by 4 ½ lengths (Replay) over a mile on the turf at Santa Anita and was anointed as a TDN ‘Rising Star’ for her efforts. Pacific Wind becomes a ‘Rising Star’ with a 4 ½ length, debut win at Santa Anita. She would earn graded blacktype in her next two races, finishing 3rd in both the G2 Honeymoon and the G3 Senorita, both over the TURF at Santa Anita. Later in her three-year-old season, she was tried on the dirt for the first time over 1 1/16 miles at Santa Anita and responded with a 1 ¾ lengths win (Replay), earning a then career best Beyer of 93, beating future G2W/G1P LA FORCE At four, she was sent east to the barn of Chad Brown, who brought her back in an allowance race at Keeneland over a mile on the dirt where she crushed her foes by 8 ¼ lengths (Replay), beating G1W SAILOR'S VALENTINE. Her (22) Thoro-Graph figure in this race matched the number that G1W SHE'S A JULIE earned when winning this year’s G1 La Troienne. Next out, she was sent off favored in the G2 Ruffian over a mile at Belmont Park, where she won by a length (Replay), defeating G2 winners HIGHWAY STAR, TEQUILITA, FAYPIEN and UNCHAINED MELODY.
    [Show full text]
  • STRIKE FREE Barn 12 Hip No
    Consigned by Bluewater Sales LLC, Agent V Hip No. STRIKE FREE Barn 460 Dark Bay or Brown Mare; foaled 2013 12 Raise a Native Mr. Prospector ...................... Gold Digger Smart Strike .......................... Smarten Classy 'n Smart .................... No Class STRIKE FREE Harlan Menifee ................................ Anne Campbell Wow Me Free ........................ (2004) With Approval Double Wow ........................ Triple Wow By SMART STRIKE (1992). Black-type winner of $337,376, Philip H. Iselin H. [G1] , etc. Leading sire twice, sire of 19 crops of racing age, 1596 foals, 1292 starters, 136 black-type winners, 14 champions, 964 winners of 3196 races and earning $154,050,388. Sire of dams of 111 black-type winners, including champions Mine That Bird, Inglorious, Eye of the Leopard, Stacked Deck, Moonlit Promise, Desert Power, Smart D N A, Cowboy Son, and of Strong Return, Dullahan, Shared Account, First Dude, Dixie Strike. 1st dam WOW ME FREE , by Menifee. 5 wins, 2 to 4, $204,202, in N.A./U.S., Next Move H. [G3] (AQU, $63,840), Ladies H. [L] (AQU, $48,630), 3rd Shuvee H. [G2] (BEL, $15,000), Wide Country S. (LRL, $5,500). (Total: $215,739). Dam of 7 other registered foals, 6 of racing age, 6 to race, 2 winners-- Treasury Bill (c. by Lemon Drop Kid). 5 wins, 3 to 9, $318,707, 2nd San Vi - cente S. [G2] (SA, $30,000), Buddy Diliberto Memorial S. (FG, $10,000), 3rd Came Home S. (BHP, $8,622). Moon Launch (g. by Malibu Moon). Winner at 3 and 4, 2020, $46,417. 2nd dam DOUBLE WOW, by With Approval.
    [Show full text]
  • Fashionably Late
    drf.com/breeding DAILY RACING FORM Sunday, February 9, 2014 PAGE 11 fashionably late JOHN P. SPARKMAN As the stud career of the late, great Storm Cat began to wind down in the early 2000s, the Kentucky breeding indus- try needed a successor as the designated young sire of sires. The obvious choice seemed to be Unbridled’s Song, who had begun his stud career brilliantly, with Breeders’ Cup Distaff winner Unbridled Elaine, Grade 1 winner Songandaprayer, and multiple Grade 2 winner Even the Score in his first crop and Grade 1 winner Buddha in his second. As recently as the middle of last year, however, the investment the breeding industry made in sons of Unbridled’s Song looked like an expensive wager gone very wrong, since Even the Score, the sire of Dullahan and Take the Points, was his only son to have sired a Grade 1 winner. That lackluster record began to improve dramatically in the last half of the year, as Unbridled’s Song’s sons First Defence, Benoit & AssociAtes Dunkirk, and Rockport Harbor all added Fashion Plate wins the Las Virgenes Stakes on Feb. 1, becoming the first Grade 1 Grade 1 winners to their stud records. winner for Unbridled’s Song’s son Old Fashioned. After last Saturday’s Grade 1 Las Virgenes Stakes at Santa Anita, another Honest Man, both by Unbridled’s Song, with similar disdain in the 1 1/8-mile, name can be added to that list, a name that were only a few months away from their Grade 2 Remsen Stakes at Aqueduct a could turn out to be the most promising maiden victories.
    [Show full text]
  • Graydar Oxbow
    GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition.
    [Show full text]
  • SYMPATHETIC Barn 45 & 46 Hip No. 1224
    Consigned by Lane's End, Agent Barn SYMPATHETIC Hip No. 45 & 46 Dark Bay or Brown Mare; foaled 2014 1224 Raise a Native Mr. Prospector ...................... Gold Digger Smart Strike .......................... Smarten Classy 'n Smart .................... No Class SYMPATHETIC Vice Regent Deputy Minister .................... Mint Copy Initiation ................................ (2005) Mt. Livermore Proposal ................................ Lady of Choice By SMART STRIKE (1992). Black-type winner of $337,376, Philip H. Iselin H. [G1] , etc. Leading sire twice, sire of 19 crops of racing age, 1596 foals, 1292 starters, 136 black-type winners, 14 champions, 964 winners of 3196 races and earning $154,050,388. Sire of dams of 111 black-type winners, including champions Mine That Bird, Inglorious, Eye of the Leopard, Stacked Deck, Moonlit Promise, Desert Power, Smart D N A, Cowboy Son, and of Strong Return, Dullahan, Shared Account, First Dude, Dixie Strike. 1st dam INITIATION , by Deputy Minister. Winner at 2, $75,000, in Canada, Glorious Song S. [L] (WO, $75,000); winner at 2, $44,438, in N.A./U.S. (Total: $121,463). Dam of 6 other registered foals, 5 of racing age, 5 to race, 5 winners, incl.-- Forward Thinker (g. by Indian Charlie). 6 wins, 3 to 5, $190,706, 3rd Al - phabet Soup H.-R (PRX, $11,000), Leemat S.-R (PID, $8,250). Elysian (f. by Smart Strike). 3 wins at 3 and 5, $104,497. Brice (g. by Flatter). Winner at 3, 2020, $24,140. Sanguine. (f. by Quality Road). Winner at 4, 2020, $23,125. 2nd dam Proposal , by Mt. Livermore. 2 wins to 4, $115,021, 2nd Dearly Precious S.
    [Show full text]
  • LIZ HUNTER Barn 37 Hip No
    Consigned by James M. Herbener Jr., Agent IV Hip No. LIZ HUNTER Barn 879 Bay Mare; foaled 2006 37 Raise a Native Mr. Prospector .................. Gold Digger Smart Strike ...................... Smarten Classy 'n Smart ................ No Class LIZ HUNTER Exclusive Native Affirmed ............................ Won't Tell You Daisyago .......................... (1999) Northern Dancer Ladyago ............................ Queen of Song By SMART STRIKE (1992). Black-type winner of $337,376, Philip H. Iselin H. [G1] , etc. Leading sire twice, sire of 18 crops of racing age, 1592 foals, 1245 starters, 125 black-type winners, 12 champions, 911 winners of 2921 races and earning $141,503,289. Sire of dams of 78 black-type winners, including champions Mine That Bird, Inglorious, Eye of the Leopard, Stacked Deck, Desert Power, Smart D N A, Cowboy Son, and of Strong Return, Dullahan, Shared Account, First Dude, Dixie Strike, Stryker Phd. 1st dam Daisyago , by Affirmed. 3 wins at 2 and 3, $262,589, 2nd Hopemont S. [L] (KEE, $22,360), 3rd Miesque S. [G3] . Dam of 8 other registered foals, 8 of racing age, 7 to race, 6 winners, including-- Victory Nor Defeat (c. by Unbridled's Song). 2 wins at 3, $91,852, 3rd Super Derby [G2] (LAD, $40,000), Cherokee Run S. (GP, $7,050). Cheonjaeilu (c. by City Zip). Winner at 3, 2017 in Republic of Korea. 2nd dam LADYAGO , by Northern Dancer. 6 wins, 2 to 4, $116,439, Audubon Oaks (ELP, $18,090), 2nd American Beauty S. (RD, $5,640), etc. Half-sister to Pri - vate Song [G2] , Easy Song , Wise Words , Aspiring Diva . Dam of-- Daisyago (f.
    [Show full text]
  • Scorewithcater
    SCOREWITHCARTER:Layout 1 11/28/12 9:16 AM Page 1 ©Coady SCOREWITHCATER Even the Score—Runaway Cater, by Runaway Groom Grade 2-Placed & Grade 3-Placed Stakes Winner Of $332,754 Winner of the $100,000 Borderland Derby in 2009, defeating that year’s Kentucky Derby (G1) winner MINE THAT BIRD. Second in the $300,000 CANADIAN DERBY (G3) at 1 3/8 miles. Third in the $300,000 SWAPS STAKES (G2) at Hollywood Park, to SANTA ANITA HANDICAP (G1) winner MISREMEMBERED, &the$900,000 SUNLAND DERBY, to G2-placed KELLY LEAK, defeating MINE THAT BIRD. By multiple G2 winner EVEN THE SCORE ($751,629), sire of champions SIR VON & VANESSA WINS, 2012 PACIFIC CLASSIC STAKES (G1) winner DULLAHAN ($1,714,091) & multiple G1 winner TAKE THE POINTS ($834,435). Out of Runaway Cater, a Runaway Groom half-sister to stakes winner DIXIELAND JAZZ from the family of G1-placed Perfeccionista & multiple G3 winner SHAM’S PRINCESS. 2013 FEE: $2,000-LIVE FOAL (payable when foal stands and nurses) Property of R. M. Master Racing Stables Standing at R. M. MASTER RACING STABLES 47275 Lakeview Drive, Big Bear City, California 92314 (818) 404-3282 e-mail: [email protected] or website: www.rmmasterracingstables.com 114 California Thoroughbred 2013 Stallion Directory www.ctba.com StatPg11-27-2012 351pm ACCL NeedToCompare-Fee-Address-Email-BClogo-SIreLogo-TO-ConformtionCOLORPage:CS705901.qxd 11/27/12 7:04 AM Page93 SCOREWITHCATER 2 0 06 C he s tn u t - H eight 16.2 - Dosage Profile: 7-4-7-0-0; DI: 4.14; CD: +1.00 Mr.
    [Show full text]
  • Race and (Stakes)
    Entered Stud in 2014 ANIMAL KINGDOM 1 Dosage (2-0-6-0-0); DI: 1.67; CD: 0.50 ch, 2008 height 16.2 ⁄2 See gray pages—Nasrullah RACE AND (STAKES) RECORD Blushing Groom, 1974 Red God, by Nasrullah Age Starts 1st 2nd 3rd Earned 10s, SW, $407,153 Candy Stripes, 1982 512 f, 92 SW, 3.96 AEI Runaway Bride, by Wild Risk 2 2 1 1 0 $33,800 6s, wnr, $47,357 3 5 2(2) 2(1) 0 $1,904,900 1,001 f, 61 SW, 1.72 AEI Bubble Company, 1977 Lyphard, by Northern Dancer 12s, wnr, $27,027 4 2 1 1(1) 0 $388,800 Leroidesanimaux, ch, 2000 13s, SW, $1,658,377 10 f, 8 r, 6 w, 3 SW Prodice, by Prominer 5 in NA, Eng, UAE 3 1(1) 1(1) 0 $6,060,000 422 f, 18 SW, 1.75 AEI Totals 12 5(3) 5(3) 0 $8,387,500 Ahonoora, 1975 Lorenzaccio, by Klairon 6.99 AWD 20s, SW, $183,477 Won At 2 in North America Dissemble, 1989 467 f, 45 SW, 2.20 AEI Helen Nichols, by Martial Unraced A maiden special weight race at Kee ($47,000, 9f, AW 10 f, 8 r, 6 w, 3 SW Kerali, 1984 High Line, by High Hat in 1:49.01, by 3¼). 4s, wnr, $5,212 At 3 in North America 10 f, 8 r, 7 w, 3 SW Sookera, by Roberto Champion 3yo colt Surumu, 1974 Literat, by Birkhahn Won Kentucky Derby Presented by Yum! Brands (gr.
    [Show full text]
  • Kentucky Derby Presented by Yum! Brands Grade 1 - Thoroughbred for THREE YEAR OLDS with an ENTRY FEE of $25,000 EACH and a STARTING FEE of $25,000 EACH
    CHURCHILL DOWNS - May 5, 2012 - Race 11 STAKES Kentucky Derby Presented by Yum! Brands Grade 1 - Thoroughbred FOR THREE YEAR OLDS WITH AN ENTRY FEE OF $25,000 EACH AND A STARTING FEE OF $25,000 EACH. One And One Fourth Miles On The Dirt Track Record: (Secretariat - 1:59.40 - May 5, 1973) Purse: $2,000,000 Guaranteed Available Money: $2,219,600 Value of Race: $2,219,600 1st $1,459,600, 2nd $400,000, 3rd $200,000, 4th $100,000, 5th $60,000 Video Race Replay Weather: Cloudy Track: Fast Off at: 6:31 Start: Good for all except 16 Last Raced Pgm Horse Name (Jockey) Wgt M/E PP 1/4 1/2 3/4 1m Str Fin Odds Comments 7Apr12 6SA1 19 I'll Have Another (Gutierrez, Mario) 126 LA 19 6Head 72 1/2 61 41/2 22 11 1/2 15.30 4 wide 1/4 pl 14Apr12 11OP1 6 Bodemeister (Smith, Mike) 126 LA 6 1Head 11 11 13 13 2Neck 4.20* fast pace, gamely 14Apr12 11KEE1 5 Dullahan (Desormeaux, Kent) 126 LA 5 111/2 11Head 131 1/2 71/2 51 33/4 12.10 broke in, bmpd, 7w 1/4 24Mar12 10TP1 13 Went the Day Well (Velazquez, John) 126 LA b 13 171/2 171 151/2 141 1/2 9Head 41/2 30.60 bumped, 7w 1/4 pl 7Apr12 6SA2 8 Creative Cause (Rosario, Joel) 126 L 8 10Head 101/2 111/2 52 1/2 31/2 54 11.90 in close 7/8, 8w 1/4 7Apr12 6SA6 20 Liaison (Garcia, Martin) 126 LA b 20 91/2 8Head 71 6Head 6Head 61/2 56.20 4 wide, tired 31Mar12 11GP3 4 Union Rags (Leparoux, Julien) 126 LA 4 181 1/2 181/2 171 161 1/2 132 1/2 73/4 5.10 squeezed, took up 1Apr12 10FG3 7 Rousing Sermon (Lezcano, Jose) 126 LA b 7 14Head 14Head 9Head 91 81 1/2 82 40.70 waited, blocked 14Apr12 11KEE2 14 Hansen (Dominguez, Ramon) 126
    [Show full text]
  • Epiphaneia Breaks Through Dullahan Dies Suddenly
    MONDAY, OCTOBER 21, 2013 732-747-8060 $ TDN Home Page Click Here EPIPHANEIA BREAKS THROUGH FTKOCT BEGINS THREE-DAY STAND On paper, this year=s G1 Kikuka Sho at Kyoto Spurred by a reduction in supply and a healthy appeared relatively weak, lacking a previous Group 1 increase in demand, the 2013 yearling sales season has winner and following on the heels of a pair of stellar turned out strong numbers renewals dominated by Japanese Triple Crown winner so far, and Fasig-Tipton Orfevre (Jpn) (Stay Gold {Jpn}) in 2011, and four-time hopes the momentum Group 1 winner Gold Ship (Jpn) (Stay Gold {Jpn}) last continues heading into year. However, by the race=s end, Epiphaneia (Jpn) today=s October Fall Yearling (Symboli Kris S.) gave the Kyoto faithful something to Sale in Kentucky. The three- cheer about as he effortlessly ran away with the day sale begins this morning country=s third and final colts= Classic. The Carrot Farm and runs through silkbearer, who kicked off his career with three straight Wednesday, with sessions victories last year and won his prep for this in the starting daily at 10:00 a.m. G2 Kobe Shimbun Hai Sept. 22, could be considered A total of 1,134 horses, unlucky not to have won a Group 1 prior to yesterday. Boyd Browning, Jr. including four added horses, In fact, he came up just a length short of sweeping the L. Marquardt have been catalogued. Triple Crown, having finished second, beaten a half- AWe=re certainly in the length, in both the G1 Japanese 2000 Guineas and the midst of a recovery and have supply and demand G1 Japanese Derby.
    [Show full text]
  • Dullahan A+ Based on the Cross of Even the Score/Mr
    06/07/12 16:36:48 EDT Dullahan A+ Based on the cross of Even the Score/Mr. Prospector and his sons and grandsons Variant = 5.94 Breeder: Phil Needham, Judy Needham & Bena Halecky (KY) Mr. Prospector, 70 b Fappiano, 77 b Killaloe, 70 b Unbridled, 87 b *Le Fabuleux, 61 ch Gana Facil, 81 ch Charedi, 76 dk b/ Unbridled's Song, 93 gr/ro =Fortino II (FR), 59 gr Caro (IRE), 67 gr =Chambord, 55 ch Trolley Song, 83 gr/ro Lucky Mel, 54 ch Lucky Spell, 71 b Incantation, 65 dk b/ Even the Score, 98 gr/ro Red God, 54 ch Blushing Groom (FR), 74 ch Runaway Bride (GB), 62 b Rahy, 85 ch Halo, 69 dk b/ Glorious Song, 76 b Ballade, 72 dk b/ Ashtabula, 91 ch Raise a Native, 61 ch Native Royalty, 67 b Queen Nasra, 52 b Now Your Teapottin, 83 ch Speak John, 58 b Sweet Bernice, 73 ch Dullahan La Eva, 66 b Chestnut Colt Native Dancer, 50 gr Foaled Feb 08, 2009 Raise a Native, 61 ch in Kentucky Raise You, 46 ch Mr. Prospector, 70 b Nashua, 52 b Gold Digger, 62 b Sequence, 46 dk b Smart Strike, 92 b Cyane, 59 b Smarten, 76 dk b/ Smartaire, 62 dk b/ Classy 'n Smart, 81 b Nodouble, 65 ch No Class, 74 b Classy Quillo, 69 dk b/ Mining My Own, 01 ch Nearctic, 54 br Northern Dancer, 61 b Natalma, 57 b Vice Regent, 67 ch *Menetrier, 44 br Victoria Regina, 58 ch Victoriana, 52 b Aspenelle, 90 ch Bold Ruler, 54 dk b Dynastic, 68 dk b/ Track Medal, 50 br Little to Do, 80 ch Restless Native, 60 gr Tribal to Do, 74 ch Marge's Request, 69 dk b/ Note on terminology in this report: Direct Cross refers to Dosage Profile: 8 8 10 0 0 Inbreeding: Mr.
    [Show full text]
  • I'll Have Another Bodemeister Dullahan Went
    Daily Racing Form 2012 Derby. Churchill Downs. 1 1/4 Miles. Dirt. Thoroughbred Ch. c. 3 (Apr) OBSAPR11 $35,000 Life 5 3 1 0 $634,000 101 D.Fst 2 2 0 0 $570,000 96 I'll Have Another Sire: Flower Alley (Distorted Humor) $7,500 Wet(403) 1 0 0 0 $1,000 40 Own: Reddam Racing LLC 2012 2 2 0 0 $570,000 101 Dam:Arch's Gal Edith (Arch) Synth 2 1 1 0 $63,000 84 Br: Harvey Clarke (Ky) 2011 3 1 1 0 $64,000 84 Turf(314) 0 0 0 0 $0 - Tr: O'Neill Doug F(7 1 1 0 .14) 2012:(554 94 .17) Cd 0 0 0 0 $0 - Dst(326*) 0 0 0 0 $0 - 7ß12= 6SA fst 1° :47 1:11 1:35¦1:47© SADerby-G1 95 3 2§ô 2§ô 3§ 3ô 1ó Gutierrez Mario L122 4.10 93= 08 IllHveAnothr122ó CrtivCus122ô Bluskisnrinbows122¨õ Bid 3wd 1/8,gamely 9 4á12= 6SA fst 1 :23 :46¨ 1:10§1:40© RBLewis-G2 96 4 2¦ô 2¦ô 2Ç 1§ 1§ö Gutierrez Mario L118 43.30 97= 03 IllHvAnothr118§ö EmpirWy118§ö ìGroovinSolo118¦õ Stalked,bid,led,clear 8 5æ11= 9Sar slyø 7f :21© :45 1:11§1:26 Hopeful-G1 40 8 9 9¬ö 10¦¥ 6¦© 6¦® Leparoux J R L120 11.90 58= 19 CurrencySwp120ö Trinnibrg120¨ö BigBluNtion120©ô 5w7/16,3w3/8,rail 5/16 10 7Ý11= 8Dmr fst 6ôf ú :22§ :45 1:09§1:15¨ BestPal-G2 84 1 2 1Ç 1Ç 1¦ 2¦ö Rosario J L119 6.80 94= 06 CrtvCs119¦ö IllHvAnothr119¨õ MghtyMonsoon119©õ Inside duel,2nd best 6 3Û11= 2Hol fst 5ôf ú :22¦ :45© :57©1:03© Md Sp Wt 55k 83 7 1 1¦ 1¦ 1¦ 1ö Rosario J L118 4.80 92= 17 IllHvAnothr118ö ScorpionWrrior118©õ Tumml118ó Angled in, held gamely 7 TRAINER: +180Days(27 .11 $1.35) WonLastStart(121 .21 $2.19) Dirt(333 .17 $1.88) Routes(354 .16 $2.03) Stakes(134 .12 $2.62) B.
    [Show full text]