STRIKE FREE Barn 12 Hip No

Total Page:16

File Type:pdf, Size:1020Kb

Load more

Consigned by Bluewater Sales LLC, Agent V Hip No. STRIKE FREE Barn 460 Dark Bay or Brown Mare; foaled 2013 12 Raise a Native Mr. Prospector ...................... Gold Digger Smart Strike .......................... Smarten Classy 'n Smart .................... No Class STRIKE FREE Harlan Menifee ................................ Anne Campbell Wow Me Free ........................ (2004) With Approval Double Wow ........................ Triple Wow By SMART STRIKE (1992). Black-type winner of $337,376, Philip H. Iselin H. [G1] , etc. Leading sire twice, sire of 19 crops of racing age, 1596 foals, 1292 starters, 136 black-type winners, 14 champions, 964 winners of 3196 races and earning $154,050,388. Sire of dams of 111 black-type winners, including champions Mine That Bird, Inglorious, Eye of the Leopard, Stacked Deck, Moonlit Promise, Desert Power, Smart D N A, Cowboy Son, and of Strong Return, Dullahan, Shared Account, First Dude, Dixie Strike. 1st dam WOW ME FREE , by Menifee. 5 wins, 2 to 4, $204,202, in N.A./U.S., Next Move H. [G3] (AQU, $63,840), Ladies H. [L] (AQU, $48,630), 3rd Shuvee H. [G2] (BEL, $15,000), Wide Country S. (LRL, $5,500). (Total: $215,739). Dam of 7 other registered foals, 6 of racing age, 6 to race, 2 winners-- Treasury Bill (c. by Lemon Drop Kid). 5 wins, 3 to 9, $318,707, 2nd San Vi - cente S. [G2] (SA, $30,000), Buddy Diliberto Memorial S. (FG, $10,000), 3rd Came Home S. (BHP, $8,622). Moon Launch (g. by Malibu Moon). Winner at 3 and 4, 2020, $46,417. 2nd dam DOUBLE WOW, by With Approval. 3 wins, $74,498. Dam of 9 winners, incl.-- WOW ME FREE (f. by Menifee). Black-type winner, above. LA PEROUSE (f. by El Prado (IRE)). 4 wins, 3 to 5, $96,390, Likely Ex - change S. (TP, $29,140). Real Wow. Winner at 3, 6,860, in France. (Total: $5,996). Dam of-- (c. by Mo€ntjeu). Winner at 3, 28,150, in France, 2nd Prix du Le Paradis € Lys [G3] . (Total: $37,615). Mambo Queen. Placed at 4 and 5, $11,125. Dam of 7 winners, including-- (c. by Rahy). 2 wins at 3, 82,380, in Italy, Premio Parioli- MALOSSOL € Italian Two Thousand Guineas [G3] , Premio Gardone [L]; winner at 4, 48,900, in France. (Total: $176,989). Sire. € 3rd dam TRIPLE WOW , by Coastal. 14 wins, $706,695, Next Move H. [G3] , etc. Half-sister to ZILZAL ZAMAAN [G3] , Quianlong [L], Star Reputation [L]. Dam of -- ALYWOW . 7 wins, 2 to 4, $648,431, horse of the year, champion 3-year-old filly, champion grass horse in Canada, Nijana S. [G3] , Canadian Breed - ers' Cup H. [L] (WO, $65,805(CAN))-cr, etc. Dam of CENTURY CITY (IRE) [G2] (Total: $678,892), HIDDEN CAT [L] (4 wins, Total: $101,515). RACE RECORD: Unraced. PRODUCE RECORD: 2018 Mischief Free, f. by Into Mischief. Unraced. 2019 f. by Kantharos; 2020 c. by West Coast. Mated to Constitution (Tapit--Baffled), last service May 15, 2020. (Believed to be PREGNANT )..
Recommended publications
  • Pacific Wind Captures the G2 Ruffian at Belmont Park

    Pacific Wind Captures the G2 Ruffian at Belmont Park

    PASSPORT Pacific Wind captures the G2 Ruffian at Belmont Park OVERVIEW G2 winner/G1Placed on the DIRT G2 placed on the TURF By leading sire CURLIN Half-Sister to multiple Graded Stakes Winner PACIFIC WIND HIP Curlin x Shag, by Dixieland Band 163 BARN 9 Selling Tuesday, November 5th PAST PERFORMANCES G1Ws G2Ws G1W GSP G2W G2W Pacific Wind put together an unforgettable debut performance winning by 4 ½ lengths (Replay) over a mile on the turf at Santa Anita and was anointed as a TDN ‘Rising Star’ for her efforts. Pacific Wind becomes a ‘Rising Star’ with a 4 ½ length, debut win at Santa Anita. She would earn graded blacktype in her next two races, finishing 3rd in both the G2 Honeymoon and the G3 Senorita, both over the TURF at Santa Anita. Later in her three-year-old season, she was tried on the dirt for the first time over 1 1/16 miles at Santa Anita and responded with a 1 ¾ lengths win (Replay), earning a then career best Beyer of 93, beating future G2W/G1P LA FORCE At four, she was sent east to the barn of Chad Brown, who brought her back in an allowance race at Keeneland over a mile on the dirt where she crushed her foes by 8 ¼ lengths (Replay), beating G1W SAILOR'S VALENTINE. Her (22) Thoro-Graph figure in this race matched the number that G1W SHE'S A JULIE earned when winning this year’s G1 La Troienne. Next out, she was sent off favored in the G2 Ruffian over a mile at Belmont Park, where she won by a length (Replay), defeating G2 winners HIGHWAY STAR, TEQUILITA, FAYPIEN and UNCHAINED MELODY.
  • Controversy Shadows Illinois Meeting In

    Controversy Shadows Illinois Meeting In

    DAILY MONDAY, JANUARY 25, 2016 WWW.BLOODHORSE.COM IN TODAY’S EDITION NYQUIST DRILLS TWO TURNS 2 OBS REPOSITORY PROVING POPULAR 3 GALILEO JOINS IRISH BREEDERS' HOF 4 SUN JEWELLERY DEFIES GATE IN CLASSIC MILE 4 FOUR FOOTED FOTOS FOUR FOOTED MARKETWATCH: WINTER DOESN'T CHILL DEMAND Arlington Park is one of three tracks at the center of a battle over FOR GOOD HORSES 5 proposed rule changes RESULTS 6 CONTROVERSY SHADOWS ILLINOIS MEETING By Tom LaMarra LEADING LISTS 8 he unsettled state of Illinois horse racing figures Tto be aired yet again Jan. 26 when the Illinois Racing Board considers several proposals endorsed by the state's racetracks but opposed by the Illinois Thoroughbred Horsemen's Association. Declining pari-mutuel handle, state budget woes, racetrack closures, and legislative gridlock on the slot machines issue have created an untenable situation for horse racing and breeding, Thoroughbred and Standardbred. As of early 2016 only three tracks remain in operation: Arlington and Hawthorne in the Chicago area and Fairmount Park near St. Louis. The tracks want the IRB to proceed with a rule change allowing their racing offices to have discre- tion over which races are carded so as to increase wagering by using races with fuller fields; the Illinois THA claims the change would create chaos and dis- courage shipping horses to the state. Other IRB agenda matters are a new Arlington stall application the Illinois THA said would institute a "facility fee," and regular approval of "recapture"—a mid-1990s regulation allowing tracks to compensate for revenue losses by taking a percentage from purse accounts money.
  • 138904 02 Classic.Pdf

    138904 02 Classic.Pdf

    breeders’ cup CLASSIC BREEDERs’ Cup CLASSIC (GR. I) 30th Running Santa Anita Park $5,000,000 Guaranteed FOR THREE-YEAR-OLDS & UPWARD ONE MILE AND ONE-QUARTER Northern Hemisphere Three-Year-Olds, 122 lbs.; Older, 126 lbs.; Southern Hemisphere Three-Year-Olds, 117 lbs.; Older, 126 lbs. All Fillies and Mares allowed 3 lbs. Guaranteed $5 million purse including travel awards, of which 55% of all monies to the owner of the winner, 18% to second, 10% to third, 6% to fourth and 3% to fifth; plus travel awards to starters not based in California. The maximum number of starters for the Breeders’ Cup Classic will be limited to fourteen (14). If more than fourteen (14) horses pre-enter, selection will be determined by a combination of Breeders’ Cup Challenge winners, Graded Stakes Dirt points and the Breeders’ Cup Racing Secretaries and Directors panel. Please refer to the 2013 Breeders’ Cup World Championships Horsemen’s Information Guide (available upon request) for more information. Nominated Horses Breeders’ Cup Racing Office Pre-Entry Fee: 1% of purse Santa Anita Park Entry Fee: 1% of purse 285 W. Huntington Dr. Arcadia, CA 91007 Phone: (859) 514-9422 To Be Run Saturday, November 2, 2013 Fax: (859) 514-9432 Pre-Entries Close Monday, October 21, 2013 E-mail: [email protected] Pre-entries for the Breeders' Cup Classic (G1) Horse Owner Trainer Declaration of War Mrs. John Magnier, Michael Tabor, Derrick Smith & Joseph Allen Aidan P. O'Brien B.c.4 War Front - Tempo West by Rahy - Bred in Kentucky by Joseph Allen Flat Out Preston Stables, LLC William I.
  • SMART STRIKE B, 1992

    SMART STRIKE B, 1992

    SMART STRIKE b, 1992 height 16.0 Dosage (20-7-17-0-2); DI: 3.38; CD: 0.93 RACE AND (STAKES) RECORD See gray pages—Polynesian Age Starts 1st 2nd 3rd Earned Native Dancer, 1950 Polynesian, by Unbreakable 22s, SW, $785,240 2 0 0 0 0 — Raise a Native, 1961 304 f, 43 SW, 4.06 AEI Geisha, by Discovery 3 4 3 1 0 $51,416 4s, SW, $45,955 4 4 3(2) 0 0 $285,960 838 f, 78 SW, 2.34 AEI Raise You, 1946 Case Ace, by Teddy 24s, SW, $37,220 Totals 8 6(2) 1 0 $337,376 Mr. Prospector, b, 1970 14s, SW, $112,171 14 f, 12 r, 11 w, 2 SW Lady Glory, by American Flag Won Philip H. Iselin H (gr. I, 8.5f), Salvator Mile H 1,178 f, 181 SW, 3.98 AEI Nashua, 1952 Nasrullah, by Nearco (gr. III, 8f). 7.62 AWD 30s, SW, $1,288,565 SIRE LINE Gold Digger, 1962 638 f, 77 SW, 2.37 AEI Segula, by Johnstown 35s, SW, $127,255 SMART STRIKE is by MR. PROSPECTOR, stakes 12 f, 7 r, 7 w, 3 SW Sequence, 1946 Count Fleet, by Reigh Count winner of $112,171, Gravesend H, etc., and sire of 181 17s, SW, $54,850 stakes winners, including champions CONQUISTADOR 8 f, 8 r, 8 w, 3 SW Miss Dogwood, by Bull Dog CIELO (Horse of the Year and champion 3yo colt), Cyane, 1959 Turn-to, by Royal Charger RAVINELLA (in Eur, Eng, and Fr), GULCH, FORTY NINER, 14s, SW, $176,367 ALDEBARAN, RHYTHM, IT’S IN THE AIR, GOLDEN Smarten, 1976 401 f, 47 SW, 2.34 AEI Your Game, by Beau Pere 27s, SW, $716,426 ATTRACTION, EILLO, QUEENA, MACHIAVELLIAN, etc.
  • SOUTHERN STRIKE Barn 5 Hip No

    SOUTHERN STRIKE Barn 5 Hip No

    Consigned by Glennwood Farm Inc., Agent Hip No. SOUTHERN STRIKE Barn 154 Bay Mare; foaled 2007 5 Raise a Native Mr. Prospector ...................... Gold Digger Smart Strike .......................... Smarten Classy 'n Smart .................... No Class SOUTHERN STRIKE His Majesty Pleasant Colony .................... Sun Colony Promenade Colony .............. (1992) Northern Dancer Dance Review ........................ Dumfries By SMART STRIKE (1992). Black-type winner of $337,376, Philip H. Iselin H. [G1] , etc. Leading sire twice, sire of 19 crops of racing age, 1596 foals, 1284 starters, 131 black-type winners, 13 champions, 949 winners of 3055 races and earning $146,878,217. Sire of dams of 96 black-type winners, including champions Mine That Bird, Inglorious, Eye of the Leopard, Stacked Deck, Desert Power, Smart D N A, Cowboy Son, and of Strong Return, Dullahan, Shared Account, First Dude, Dixie Strike, Cambodia. 1st dam PROMENADE COLONY, by Pleasant Colony. Winner at 3, $20,910. Sister to DANCE COLONY [G2] , Colonial Review [L], half-sister to ANOTHER REVIEW [G1] ($752,370), NO REVIEW [G1] ($634,545), Rap and Dance , Pleasant Review [L]. Dam of 18 registered foals, 18 of racing age, including a 2-year-old of 2019, 12 to race, 8 winners, including-- PROMENADE GIRL (f. by Carson City). 8 wins, 2 to 4, $678,990, Molly Pitcher Breeders' Cup H. [G2] (MTH, $180,000), Nellie Morse S. [L] (LRL, $51,000), etc. Dam of CAVORTING (f. by Bernardini, 8 wins, $2,063,000, Ogden Phipps D. [G1] (BEL, $535,000), etc.), Thirstforlife (g. by Stay Thirsty, to 4, 2018, $328,665, 2nd Mineshaft H. [G3] (FG, $30,000), etc.).
  • Record Sire Line Family Stud Analysis

    Record Sire Line Family Stud Analysis

    Enters Stud in 2016 BLUESKIESNRAINBOWS 1 Dosage (6-8-12-0-0); DI: 3.33; CD: 0.77 ch, 2009 height 16.2 ⁄2 See gray pages—Polynesian RACE AND (STAKES) RECORD Mr. Prospector, 1970 Raise a Native, by Native Dancer Age Starts 1st 2nd 3rd Earned 14s, SW, $112,171 Smart Strike, 1992 1,178 f, 181 SW, 3.98 AEI Gold Digger, by Nashua 2 3 1 0 0 $13,900 8s, SW, $337,376 3 7 2(1) 0 2(1) $213,382 1,384 f, 116 SW, 2.21 AEI Classy 'n Smart, 1981 Smarten, by Cyane 9s, SW, $303,222 4 12 3(2) 3(1) 1(1) $322,270 English Channel, ch, 2002 23s, SW, $5,319,028 9 f, 5 r, 5 w, 4 SW No Class, by Nodouble 5 5 1(1) 0 0 $122,750 365 f, 22 SW, 1.68 AEI 6 1 0 0 0 $250 Theatrical, 1982 Nureyev, by Northern Dancer 7.96 AWD 22s, SW, $2,940,036 Totals 28 7(4) 3(1) 3(2) $672,552 Belva, 1998 1,021 f, 85 SW, 2.23 AEI Tree of Knowledge, by Sassafras Unraced Won At 2 9 f, 7 r, 3 w, 1 SW Committed, 1980 Hagley, by Olden Times A race at Hol ($24,100, 6f, AW in 1:10.95, by 2¾, 30s, SW, $333,501 dftg. I Feel Free, Run Charlie Run, Sky Larkin, 10 f, 8 r, 7 w, 3 SW Minstinguette, by Boldnesian Dinosaur Club, Solana Soleil, Buds Pal, Pursuit of Vice Regent, 1967 Northern Dancer, by Nearctic Tao, Swiss Guard, Zairsacat, Pancho and Cisco).
  • Lookin at Lucky (Usa) ______

    LOOKIN AT LUCKY (USA) ________________________________________________________________________________________ RAISE A NATIVE MR PROSPECTOR GOLD DIGGER (USA) (USA) SMART STRIKE (CAN) SMARTEN (USA) CLASSY 'N SMART NO CLASS (CAN) LOOKIN AT LUCKY (CAN) (USA) (2007) DANZIG (USA) A BAY HORSE BELONG TO ME (USA) BELONGING (USA) PRIVATE FEELING CLEVER TRICK (USA) (USA) (1999) REGAL FEELING (USA) SHARP BELLE (USA) LOOKIN AT LUCKY (USA) (c by Smart Strike (CAN)), Champion 2yr old colt in U.S.A. in 2009, Champion 3yr old colt in U.S.A. in 2010, won 9 races at 2 and 3 years in U.S.A. and £2,137,439 including Del Mar Futurity, Del Mar, Gr.1, Izod Haskell Invitational Stakes, Monmouth Park, Gr.1, Norfolk Stakes, Santa Anita, Gr.1, Preakness Stakes, Pimlico, Gr.1, Cashcall Hollywood Futurity, Hollywood Park, Gr.1, Best Pal Stakes, Del Mar, Gr.2, Rebel Stakes, Oaklawn Park, Gr.2 and Indiana Derby, Hoosier Park, Gr.2, placed three times viz second in Grey Goose Breeders' Cup Juvenile, Santa Anita, Gr.1, third in Santa Anita Derby, Santa Anita, Gr.1 and fourth in Breeders’ Cup Classic Stakes, Churchill Downs, Gr.1; sire. 1st Dam. PRIVATE FEELING (USA) (f by Belong To Me (USA)), won 2 races at 3 years in U.S.A. and placed once; dam of three winners including- LOOKIN AT LUCKY (USA) (c. by Smart Strike (CAN)), see above. KENSEI (USA) (c. by Mr Greeley (USA)), won 5 races at 2, 3 and 5 years in U.S.A. and £502,942 including Dwyer Stakes, Belmont Park, Gr.2, Jim Dandy Stakes, Saratoga, Gr.2 and Salvator Mile Stakes, Monmouth Park, Gr.3, placed 6 times viz second in Derby Trial Stakes, Churchill Downs, Gr.3, Duncan F Kenner Stakes, Fair Grounds, L., Majestic Light Stakes, Monmouth Park, L., Santana Mile Stakes, Santa Anita, L., third in Jerome Handicap, Belmont Park, Gr.2 and Woody Stephens Stakes, Belmont Park, Gr.2; sire.
  • SMARTYFLY Barn 12 & 14 Hip No

    SMARTYFLY Barn 12 & 14 Hip No

    Property of Sam-Son Farm (Broodmare Dispersal) Hip No. SMARTYFLY Barn 438 Bay Mare; foaled 2010 12 & 14 Raise a Native Mr. Prospector ...................... Gold Digger Smart Strike .......................... Smarten Classy 'n Smart .................... No Class SMARTYFLY Nureyev Theatrical (IRE) ...................... Tree of Knowledge (IRE) Scarlet Butterfly .................... (2003) Red Ransom Hummingbird Red ................ Dancing With Wings By SMART STRIKE (1992). Black-type winner of $337,376, Philip H. Iselin H. [G1] , etc. Leading sire twice, sire of 19 crops of racing age, 1596 foals, 1292 starters, 136 black-type winners, 14 champions, 964 winners of 3201 races and earning $154,323,551. Sire of dams of 114 black-type winners, including champions Mine That Bird, Inglorious, Eye of the Leopard, Stacked Deck, Moonlit Promise, Desert Power, Smart D N A, Cowboy Son, and of Strong Return, Dullahan, Shared Account, First Dude, Dixie Strike. 1st dam Scarlet Butterfly , by Theatrical (IRE). 3 wins at 3 and 4, $183,014, in Canada; winner at 3, $71,710, in N.A./U.S., 2nd Bayou Breeders' Cup H. [G3] (FG, $30,000). (Total: $241,017). Half-sister to Red Strike (8 wins, Total: $324,719, 2nd J. Kenneth Self Shelby County Boys and Girls Club S. [L] (IND, $20,021), 3rd Woodchopper S. (FG, $6,000)), Strike Red (3 wins, Total: $138,029, 3rd Zadracarta S.-R (WO, $10,000)). Dam of 6 registered foals, 6 of racing age, 5 to race, 5 winners-- SMARTYFLY (f. by Smart Strike). Black-type winner, see record. Moon Rainbow (f. by Smart Strike). 3 wins at 3, $215,760, in Canada, 2nd Carotene S.-R (WO, $30,000), 3rd Ontario Matron S.
  • Headline News

    Headline News

    MISWAKI DIES HEADLINE p. 4 NEWS For information about TDN, DELIVERED EACH NIGHT BY FAX AND FREE BY E-MAIL TO SUBSCRIBERS OF call 732-747-8060. www.thoroughbreddailynews.com SATURDAY, DEC. 18, 2004 ECLIPSE BATTLE IN FUTURITY SOARING FREE AT THE SOVEREIGN AWARDS With divisional honors hanging in the balance, eight Soaring Free (Smart Strike) was the star of a big juveniles will go postward in today’s GI Hollywood show for Sam-Son Farms at the Sovereign Awards Futurity at Hollywood Park. Unbeaten Declan’s Moon Friday night at the Wyndham Bristol Place Hotel in (Malibu Moon), the 7-5 morning-line favorite, jumped Toronto, Ontario. The Sam-Son homebred’s outstand- from a debut win at Del Mar July ing campaign, highlighted by victory in the GI Atto Mile, 31 to wins in the Sept. 8 GII Del earned him titles of Horse of the Year and Champion Mar Futurity and Nov. 20 GIII Turf Horse. Also represented by Champion Three-Year- Hollywood Prevue. He’ll be mak- Old Filly Eye of the Sphynx ing his two-turn bow this after- (Smart Strike), Sam-Son was noon as he takes on Breeders’ honored with awards for both Cup Juvenile winner Wilco (Awe- Outstanding Breeder and Out- some Again) and GI Champagne Declan’s Moon Benoit standing Owner. It was the S. winner Proud Accolade (Yes fifth straight Sovereign Award It’s True). Since springing a 28-1 upset in the Juvenile, in the Breeder category for Wilco has joined the barn of Craig Dollase. Dollase perennial powerhouse Sam- reported yesterday that the chestnut colt suffered a Son, and their eighth overall quarter crack in his left front foot, although he is still Smart Strike Owner award.
  • Fashionably Late

    Fashionably Late

    drf.com/breeding DAILY RACING FORM Sunday, February 9, 2014 PAGE 11 fashionably late JOHN P. SPARKMAN As the stud career of the late, great Storm Cat began to wind down in the early 2000s, the Kentucky breeding indus- try needed a successor as the designated young sire of sires. The obvious choice seemed to be Unbridled’s Song, who had begun his stud career brilliantly, with Breeders’ Cup Distaff winner Unbridled Elaine, Grade 1 winner Songandaprayer, and multiple Grade 2 winner Even the Score in his first crop and Grade 1 winner Buddha in his second. As recently as the middle of last year, however, the investment the breeding industry made in sons of Unbridled’s Song looked like an expensive wager gone very wrong, since Even the Score, the sire of Dullahan and Take the Points, was his only son to have sired a Grade 1 winner. That lackluster record began to improve dramatically in the last half of the year, as Unbridled’s Song’s sons First Defence, Benoit & AssociAtes Dunkirk, and Rockport Harbor all added Fashion Plate wins the Las Virgenes Stakes on Feb. 1, becoming the first Grade 1 Grade 1 winners to their stud records. winner for Unbridled’s Song’s son Old Fashioned. After last Saturday’s Grade 1 Las Virgenes Stakes at Santa Anita, another Honest Man, both by Unbridled’s Song, with similar disdain in the 1 1/8-mile, name can be added to that list, a name that were only a few months away from their Grade 2 Remsen Stakes at Aqueduct a could turn out to be the most promising maiden victories.
  • Graydar Oxbow

    Graydar Oxbow

    GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition.
  • TIME to GET EVEN:Layout 1 11/26/13 8:30 AM Page 1

    TIME to GET EVEN:Layout 1 11/26/13 8:30 AM Page 1

    TIME TO GET EVEN:Layout 1 11/26/13 8:30 AM Page 1 TIME TO GET EVEN Stephen Got Even—Tomisue’s Pleasure, by Seeking the Gold Sire of Multiple Stakes-Placed Winner Time For Angie ($80,414) Winner of the LAZARO BARRERA STAKES (G3) at Hollywood Park, defeating GRADE 2 winner PRINCIPLE SECRET & BREEDERS’ CUP TURF SPRINT winner DESERT CODE. By STEPHEN GOT EVEN ($1,019,200), a GRADE 1-winning son of A.P. INDY & sire of 3 champions, including STEVIE WONDERBOY ($1,058,940) who won the BREEDERS’ CUP JUVENILE (G1), as well as the HOLLYWOOD GOLD CUP (G1) winner FIRST DUDE ($1,442,140) & GRADE 1 winner I WANT REVENGE. Out of a SEEKING THE GOLD daughter of the GRADE 2-placed graded stakes winner SUMMER MATINEE from the female family of the GRADE 1-placed stakes winners WEEKEND SQUALL & SPACELINK. 2014 FEE: $2,000-LIVE FOAL (payable September 1st of year bred) Property of Terry C. Lovingier Standing at LOVACRES RANCH Inquiries to Terry Lovingier 35490 Hwy. 79, Warner Springs, California 92086 (562) 547-9848/FAX (562) 988-0094 e-mail: [email protected] or website: www.lovacres.com 170 California Thoroughbred 2014 Stallion Directory www.ctba.com TimeToGetEven cs404705ORIGJockeyClubPageSent11-8-2013-NoChangeLoretta11-27-2013-1143am :Layout 1 12/2/13 10:19 AM Page1 TIME TO GET EVEN 2004 Dark Bay or Brown - Dosage Profile: 7-5-14-0-0; DI: 2.71; CD: +0.73 Boldnesian Bold Reasoning RACE AND (STAKES) RECORD Reason to Earn Seattle Slew Age Starts 1st 2nd 3rd Earnings Poker 1050 foals, 114 SWs 2 unraced My Charmer Fair Charmer A.P.