Dullahan Stalks Elusive Dirt Score in Haskell

Total Page:16

File Type:pdf, Size:1020Kb

Load more

LEXINGTON HERALD-LEADER | KENTUCKY.COM HORSE RACING FRIDAY, JULY 27, 2012 B3 Dullahan stalks elusive dirt score in Haskell BLUE GRASS WINNER Another has won three. And HASKELL INVITATIONAL on Aug. 18. Before his con- the track surface (at Mon- nections turn toward lusher MISFIRED IN BELMONT When: Sunday, 6:17 p.m. mouth) is more like Churchill grounds, they want to be sure AFTER 3RD IN DERBY than it was at Belmont when Where: Monmouth Park he has every chance to stay 1 it got really loose.” Distance: 1 ⁄8 miles on the course they believe he By Alicia Wincze Hughes Dullahan’s 0-for-5 dirt re- Purse: $1 million (Grade I) can prevail over. [email protected] cord is a contributing reason TV: TVG “I still think on the right Over the past two weeks, dirt track he’ll run big,” Ro- Zayat Stables’ Paynter — PP Horse Jockey Odds the complexion of Sunday’s who doesn’t have a graded- mans said. “He needs to have Grade I Haskell Invitational 1 Nonios Nakatani 7-2 stakes win — was given a big win on dirt for his next has changed drastically, its fi- 2 Dullahan Desormeaux 3-1 favoritism over his more career in the stud barn.” nal image mirroring the ongo- 3 Paynter Bejarano 3-2 accomplished rival. Though Dullahan will also be re- ing upheaval in the 3-year-old Paynter’s front-running abil- 4 Gemologist Castellano 3-1 united with jockey Kent male division. ity is viewed as a tactical 5 Handsome Mike Gutierrez 15-1 Desormeaux for the Haskell. Within days of each other, 6 Stealcase Bridgmohan 8-1 Desormeaux lost the mount Belmont Stakes winner Union advantage over what some perceive as a speed-favoring on the colt for the Belmont af- Rags was sidelined and sub- ter failing a breathalyzer test sequently retired because Monmouth surface, Romans remembers another Bob Baf- in New York one day before of a suspensory injury, and If the Monmouth surface the Preakness Stakes. fellow Grade I winner Bode- fert trainee by the name of does prove a struggle for meister was declared out of Coil coming from last a year Dullahan, Romans is consid- Monmouth Park’s signature ago to catch Romans’ classic- ering wheeling him back in Alicia Wincze Hughes: (859) 231- $1 million race after spiking winning charge Shackleford the Grade I Secretariat Stakes 1676. Blog: horseracing.bloginky. a fever. in the Haskell. on the Arlington Park turf com. In what could be viewed as a tribute to this sophomore class’s depth, their spots were NEW 2012 INFINITI G37x Sedan filled by Belmont runner-up AWD, with Premium Package Paynter and, as of Wednesday morning, Wood Memorial vic- tor Gemologist. 3390 Richmond Rd., Lexingtonton The one constant in all the shifting was, no matter 1 $ who shows up for the 1 ⁄8- mile race, Donegal Racing’s EQUI-PHOTO 269 Dullahan was slated to be Dullahan, the co-second choice in the Haskell, is the only 3-year-old still in training in the U.S. with more than one Grade I per month mo. there to take them on — an 1 ironic role considering the victory. Both of those came over the Polytrack at Keeneland. 18 lease chestnut colt was initially All Wheel Drive, Moonroof, Leather, thought to be switching win over a dirt track. His only one chance for a talent- Bose Audio, Heated Seats, Bluetooth and More 2 or more at this price paths himself. previous two career victories ed 3-year-old to grab prizes Despite being the two came in the Grade I Breeders’ like the Haskell, though, 1) 18 month closed end lease based on 12,000 miles per Grade I winners in the field, Futurity and the Toyota Blue Dullahan’s connections fig- year, security deposit waived, excludes tax & license; $2,439 st Dullahan and Gemologist Grass Stakes over the Poly- ured there was nothing to be total due at signing includes 1 month payment but excludes were made the 3-1 co-second track at Keeneland. lost by taking one more high- tax and license; all manufacturer rebates (if any) assigned to dealer, subject to credit approval. Offers expire 7-31-12. choices in the morning line In the immediate after- profile swing. behind 3-2 favorite Paynter math of Dullahan’s seventh- “You know we’re in a no- on Thursday when a field of place finish as the favorite in lose position,” Jerry Craw- "#$$# six was entered for Sunday’s the Belmont Stakes, trainer ford, managing partner of ' %"&!!" Dale Romans initially sug- Donegal Racing, said. “If he %"$#" Haskell. %""%" The three will break along- gested the third-place finisher wins, I’m a genius and if he ' ##(# in the Kentucky Derby could loses, no one will notice. side each other with Dullahan be headed to the turf for his “The fact is we’ve won two "& ##(#!!" drawing post No. 2, Paynter "$("#$$$ ' post No. 3 and Gemologist — next outing. Since there is Grade I’s and only I’ll Have who is making his first start FARM & COINS & WANTED 070 ACREAGE 524 661 697 GARAGE SALES 784 since running 16th in the LIVESTOCK STAMPS FAYETTE SOUTH TO BUY Kentucky Derby — leaving 10 ACRES, deer & GENERAL A1 CASH, Pay Cash for Coins, Pay Toyota On Nicholasville turkey, water & MAINTENANCE HELP $30for silver dollars. ELIZABETH ST. $30 for silver dol- from post No. 4. electric -easy con- painting, weed eating, Coins, Wheat & In- #1440, Sat. & Sun. lars, Coins, Wheat nection. G’town. mowing, needed for dian pennies, col- _____________________________________8-? Lots of misc. & Indian pennies, Though Dullahan is the Kentucky’s _____________________________________$42K. 859-224-3080 lections, estates, 5349733 N Lexington farm, JAIRUS DR. #815, collections estates, 5350516 antiques, Case antiques, military, good pay and benefits. Sat. 8-? Big Yard only sophomore male in the Valid US License knives, military, comics, jewelry, Toyota Dealer CONDOS & comics, jewelry, Sale! Corner of baseball cards, 132 required. Please apply _____________________________________ United States still in training Based on 2011 retail sales from TMS. TOWNHOMES - RENT in person thru Friday., baseball cards, Jairus & Saron. watches, records & sterling,antique 5349480 977 Harp Innis Rd. Case knives, an- with more than one Grade guns, Civil War LOUISIANA Ave tique guns, Civil # 2br , 2.5ba, hook- _____________________________________Lexington. 10-2 M-F #133, items & antique HUGE! War items & an- I win, the son of Even the Over 100 Certified ups, no pets, $800 5344468 Moving Sale! _____________________________________+util. 859-223-1481 _____________________________________cars. 285-6012 _____________________________________tique cars. 285-6012 INDUSTRIAL & 5353575 Vintage & New 5353491 Score is still seeking his first 5350481 540 Furniture, rugs, Pre-Owned Vehicles Available! DUPLEXES MANUFACTURING GARAGE SALES _____________________________________ 134 art & more. 8-2 Sat FOR RENT 695 FAYETTE EAST 5353643 312 MONTH /12,000 MILE MONTICELLO Rich Copley writes 1 Blvd. #669, Sat. 8-3 Work! NICH. 3BR, 1.5BA, about pop culture, COMPREHENSIVE WARRANTY $600 mo. EASTLAND Flea Mens, Womens, FROM DATE OF PURCHASE _____________________________________859-885-2502 TAP INTO OUR Market Fri.-Sun. _____________________________________boys & household. 5350672 INCREDIBLE EN- 9-6. Booth Space 5353506 Work! area entertainment ERGY! NiSource _____________________________________Available 252-0024 SARON DR. #4512, and performing arts 37 YEAR /100,000 MILE LIMITED has an opening for 5353538 Sat. 9-2, Cub Ca- Find your dream a Major Account HENRY CLAY det riding mower, Work! in his blog, “Copious POWERTRAIN WARRANTY Representative in Blvd. #820, Sat. _____________________________________car, furniture, etc. FROM ORIGINAL DATE OF PURCHASE Read STK#T55173A home in the Herald Lexington, KY. only 9-? Art, 5349373 Notes,” on LexGo.com. For more infor- DVDs, household SHORESIDE DR. Leader Classifi eds _____________________________________ Careerbuilder 3 mation and to ap- items & more! #393, Sat. & Sun. Read him every day! 1 YEAR UNLIMITED MILE ply, please visit 5349684 7:30-Noon. HUGE SALE! Household Every Sunday ROADSIDE ASSISTANCE HOUSES www.nisource.jobs GARAGE SALES _____________________________________ FROM DATE OF PURCHASE on or before July 696 items & more! 136 31st and reference FAYETTE NORTH 5349509 in the FOR RENT job posting # 3160 POINT QUALITY 910204. EEO. En- GARAGE SALES 2008 Toyota Hartland Beauty BROWNS MILL 698 Herald-Leader ASSURANCE INSPECTION 4777 Pleasant ergized by Diver- RD. #399, Sat. & FAYETTE WEST Grove. 5BR, 4.5BA _____________________________________sity. COROLLA (174 POINT FOR HYBRIDS) Sun. 8-3, Clothes, Classifi eds w/o bsmt. 1st flr 5348026 furniture, exercise PALOMAR COVE mbr, $2400 mo. LAWN & & sports equip- Ln. #3928, Today $ 3CARFAX VEHICLE _____________________________________859-227-9496. 550 ment. Lots of misc. 8-? Moving Sale. , 5352293 GARDEN _____________________________________items. _____________________________________ 12 777 HISTORY REPORTS LEASE OPTION Nice items. Come! 812 CHEVROLET 2000 sq.ft. 3BR, NOW HIRING Mow 5353502 5349421 All prices include factory rebates and discounts, plus tax, tag, title and $599 dealer fee with approved Crew no smoking DAMEL CT. #721, 2.5BA, 2 car gar., 1 _____________________________________ Sat. 9-? Remodel GARAGE SALES Harriett Hendren writes a credit. Image may not reflect actual vehicle. See dealer for complete details. Offer expires 7/31/2012. ac. within 2 mi. of 272-4080 700 07 Trailblazer, 5350680 sale. Low prices. JESSAMINE CO. blk, sunroof, tow Nicholasville. Between Kingston shopping, fashion and beauty Avail. now. pkg., cd player, Where Price Sells Cars! 556 MECHANICAL _____________________________________Rd. & Faulkner. KEENE-WAY DR great car $14,000 859-221-1223 or 5352254 blog called “Fash Food” on _____________________________________859-887-1138. SOUTH , Neigh- _____________________________________859-260-2085 LexGo.com. Enjoy the trends 2100 Lexington Road 5349560 A power train me- GARAGE SALES borhood Sale! Off 5349707 RANCH, 3BR, 1BA, 697 of Route 169 in AUTOS and styles she discovers Liberty Rd. $900. chanic, skilled, FAYETTE SOUTH _____________________________________Nicholasville. Sat 896 888-544-6271 Service _____________________________________859-806-2776.
Recommended publications
  • Pacific Wind Captures the G2 Ruffian at Belmont Park

    Pacific Wind Captures the G2 Ruffian at Belmont Park

    PASSPORT Pacific Wind captures the G2 Ruffian at Belmont Park OVERVIEW G2 winner/G1Placed on the DIRT G2 placed on the TURF By leading sire CURLIN Half-Sister to multiple Graded Stakes Winner PACIFIC WIND HIP Curlin x Shag, by Dixieland Band 163 BARN 9 Selling Tuesday, November 5th PAST PERFORMANCES G1Ws G2Ws G1W GSP G2W G2W Pacific Wind put together an unforgettable debut performance winning by 4 ½ lengths (Replay) over a mile on the turf at Santa Anita and was anointed as a TDN ‘Rising Star’ for her efforts. Pacific Wind becomes a ‘Rising Star’ with a 4 ½ length, debut win at Santa Anita. She would earn graded blacktype in her next two races, finishing 3rd in both the G2 Honeymoon and the G3 Senorita, both over the TURF at Santa Anita. Later in her three-year-old season, she was tried on the dirt for the first time over 1 1/16 miles at Santa Anita and responded with a 1 ¾ lengths win (Replay), earning a then career best Beyer of 93, beating future G2W/G1P LA FORCE At four, she was sent east to the barn of Chad Brown, who brought her back in an allowance race at Keeneland over a mile on the dirt where she crushed her foes by 8 ¼ lengths (Replay), beating G1W SAILOR'S VALENTINE. Her (22) Thoro-Graph figure in this race matched the number that G1W SHE'S A JULIE earned when winning this year’s G1 La Troienne. Next out, she was sent off favored in the G2 Ruffian over a mile at Belmont Park, where she won by a length (Replay), defeating G2 winners HIGHWAY STAR, TEQUILITA, FAYPIEN and UNCHAINED MELODY.
  • STRIKE FREE Barn 12 Hip No

    STRIKE FREE Barn 12 Hip No

    Consigned by Bluewater Sales LLC, Agent V Hip No. STRIKE FREE Barn 460 Dark Bay or Brown Mare; foaled 2013 12 Raise a Native Mr. Prospector ...................... Gold Digger Smart Strike .......................... Smarten Classy 'n Smart .................... No Class STRIKE FREE Harlan Menifee ................................ Anne Campbell Wow Me Free ........................ (2004) With Approval Double Wow ........................ Triple Wow By SMART STRIKE (1992). Black-type winner of $337,376, Philip H. Iselin H. [G1] , etc. Leading sire twice, sire of 19 crops of racing age, 1596 foals, 1292 starters, 136 black-type winners, 14 champions, 964 winners of 3196 races and earning $154,050,388. Sire of dams of 111 black-type winners, including champions Mine That Bird, Inglorious, Eye of the Leopard, Stacked Deck, Moonlit Promise, Desert Power, Smart D N A, Cowboy Son, and of Strong Return, Dullahan, Shared Account, First Dude, Dixie Strike. 1st dam WOW ME FREE , by Menifee. 5 wins, 2 to 4, $204,202, in N.A./U.S., Next Move H. [G3] (AQU, $63,840), Ladies H. [L] (AQU, $48,630), 3rd Shuvee H. [G2] (BEL, $15,000), Wide Country S. (LRL, $5,500). (Total: $215,739). Dam of 7 other registered foals, 6 of racing age, 6 to race, 2 winners-- Treasury Bill (c. by Lemon Drop Kid). 5 wins, 3 to 9, $318,707, 2nd San Vi - cente S. [G2] (SA, $30,000), Buddy Diliberto Memorial S. (FG, $10,000), 3rd Came Home S. (BHP, $8,622). Moon Launch (g. by Malibu Moon). Winner at 3 and 4, 2020, $46,417. 2nd dam DOUBLE WOW, by With Approval.
  • Fashionably Late

    Fashionably Late

    drf.com/breeding DAILY RACING FORM Sunday, February 9, 2014 PAGE 11 fashionably late JOHN P. SPARKMAN As the stud career of the late, great Storm Cat began to wind down in the early 2000s, the Kentucky breeding indus- try needed a successor as the designated young sire of sires. The obvious choice seemed to be Unbridled’s Song, who had begun his stud career brilliantly, with Breeders’ Cup Distaff winner Unbridled Elaine, Grade 1 winner Songandaprayer, and multiple Grade 2 winner Even the Score in his first crop and Grade 1 winner Buddha in his second. As recently as the middle of last year, however, the investment the breeding industry made in sons of Unbridled’s Song looked like an expensive wager gone very wrong, since Even the Score, the sire of Dullahan and Take the Points, was his only son to have sired a Grade 1 winner. That lackluster record began to improve dramatically in the last half of the year, as Unbridled’s Song’s sons First Defence, Benoit & AssociAtes Dunkirk, and Rockport Harbor all added Fashion Plate wins the Las Virgenes Stakes on Feb. 1, becoming the first Grade 1 Grade 1 winners to their stud records. winner for Unbridled’s Song’s son Old Fashioned. After last Saturday’s Grade 1 Las Virgenes Stakes at Santa Anita, another Honest Man, both by Unbridled’s Song, with similar disdain in the 1 1/8-mile, name can be added to that list, a name that were only a few months away from their Grade 2 Remsen Stakes at Aqueduct a could turn out to be the most promising maiden victories.
  • Graydar Oxbow

    Graydar Oxbow

    GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition.
  • SYMPATHETIC Barn 45 & 46 Hip No. 1224

    SYMPATHETIC Barn 45 & 46 Hip No. 1224

    Consigned by Lane's End, Agent Barn SYMPATHETIC Hip No. 45 & 46 Dark Bay or Brown Mare; foaled 2014 1224 Raise a Native Mr. Prospector ...................... Gold Digger Smart Strike .......................... Smarten Classy 'n Smart .................... No Class SYMPATHETIC Vice Regent Deputy Minister .................... Mint Copy Initiation ................................ (2005) Mt. Livermore Proposal ................................ Lady of Choice By SMART STRIKE (1992). Black-type winner of $337,376, Philip H. Iselin H. [G1] , etc. Leading sire twice, sire of 19 crops of racing age, 1596 foals, 1292 starters, 136 black-type winners, 14 champions, 964 winners of 3196 races and earning $154,050,388. Sire of dams of 111 black-type winners, including champions Mine That Bird, Inglorious, Eye of the Leopard, Stacked Deck, Moonlit Promise, Desert Power, Smart D N A, Cowboy Son, and of Strong Return, Dullahan, Shared Account, First Dude, Dixie Strike. 1st dam INITIATION , by Deputy Minister. Winner at 2, $75,000, in Canada, Glorious Song S. [L] (WO, $75,000); winner at 2, $44,438, in N.A./U.S. (Total: $121,463). Dam of 6 other registered foals, 5 of racing age, 5 to race, 5 winners, incl.-- Forward Thinker (g. by Indian Charlie). 6 wins, 3 to 5, $190,706, 3rd Al - phabet Soup H.-R (PRX, $11,000), Leemat S.-R (PID, $8,250). Elysian (f. by Smart Strike). 3 wins at 3 and 5, $104,497. Brice (g. by Flatter). Winner at 3, 2020, $24,140. Sanguine. (f. by Quality Road). Winner at 4, 2020, $23,125. 2nd dam Proposal , by Mt. Livermore. 2 wins to 4, $115,021, 2nd Dearly Precious S.
  • LIZ HUNTER Barn 37 Hip No

    LIZ HUNTER Barn 37 Hip No

    Consigned by James M. Herbener Jr., Agent IV Hip No. LIZ HUNTER Barn 879 Bay Mare; foaled 2006 37 Raise a Native Mr. Prospector .................. Gold Digger Smart Strike ...................... Smarten Classy 'n Smart ................ No Class LIZ HUNTER Exclusive Native Affirmed ............................ Won't Tell You Daisyago .......................... (1999) Northern Dancer Ladyago ............................ Queen of Song By SMART STRIKE (1992). Black-type winner of $337,376, Philip H. Iselin H. [G1] , etc. Leading sire twice, sire of 18 crops of racing age, 1592 foals, 1245 starters, 125 black-type winners, 12 champions, 911 winners of 2921 races and earning $141,503,289. Sire of dams of 78 black-type winners, including champions Mine That Bird, Inglorious, Eye of the Leopard, Stacked Deck, Desert Power, Smart D N A, Cowboy Son, and of Strong Return, Dullahan, Shared Account, First Dude, Dixie Strike, Stryker Phd. 1st dam Daisyago , by Affirmed. 3 wins at 2 and 3, $262,589, 2nd Hopemont S. [L] (KEE, $22,360), 3rd Miesque S. [G3] . Dam of 8 other registered foals, 8 of racing age, 7 to race, 6 winners, including-- Victory Nor Defeat (c. by Unbridled's Song). 2 wins at 3, $91,852, 3rd Super Derby [G2] (LAD, $40,000), Cherokee Run S. (GP, $7,050). Cheonjaeilu (c. by City Zip). Winner at 3, 2017 in Republic of Korea. 2nd dam LADYAGO , by Northern Dancer. 6 wins, 2 to 4, $116,439, Audubon Oaks (ELP, $18,090), 2nd American Beauty S. (RD, $5,640), etc. Half-sister to Pri - vate Song [G2] , Easy Song , Wise Words , Aspiring Diva . Dam of-- Daisyago (f.
  • Scorewithcater

    Scorewithcater

    SCOREWITHCARTER:Layout 1 11/28/12 9:16 AM Page 1 ©Coady SCOREWITHCATER Even the Score—Runaway Cater, by Runaway Groom Grade 2-Placed & Grade 3-Placed Stakes Winner Of $332,754 Winner of the $100,000 Borderland Derby in 2009, defeating that year’s Kentucky Derby (G1) winner MINE THAT BIRD. Second in the $300,000 CANADIAN DERBY (G3) at 1 3/8 miles. Third in the $300,000 SWAPS STAKES (G2) at Hollywood Park, to SANTA ANITA HANDICAP (G1) winner MISREMEMBERED, &the$900,000 SUNLAND DERBY, to G2-placed KELLY LEAK, defeating MINE THAT BIRD. By multiple G2 winner EVEN THE SCORE ($751,629), sire of champions SIR VON & VANESSA WINS, 2012 PACIFIC CLASSIC STAKES (G1) winner DULLAHAN ($1,714,091) & multiple G1 winner TAKE THE POINTS ($834,435). Out of Runaway Cater, a Runaway Groom half-sister to stakes winner DIXIELAND JAZZ from the family of G1-placed Perfeccionista & multiple G3 winner SHAM’S PRINCESS. 2013 FEE: $2,000-LIVE FOAL (payable when foal stands and nurses) Property of R. M. Master Racing Stables Standing at R. M. MASTER RACING STABLES 47275 Lakeview Drive, Big Bear City, California 92314 (818) 404-3282 e-mail: [email protected] or website: www.rmmasterracingstables.com 114 California Thoroughbred 2013 Stallion Directory www.ctba.com StatPg11-27-2012 351pm ACCL NeedToCompare-Fee-Address-Email-BClogo-SIreLogo-TO-ConformtionCOLORPage:CS705901.qxd 11/27/12 7:04 AM Page93 SCOREWITHCATER 2 0 06 C he s tn u t - H eight 16.2 - Dosage Profile: 7-4-7-0-0; DI: 4.14; CD: +1.00 Mr.
  • Race and (Stakes)

    Race and (Stakes)

    Entered Stud in 2014 ANIMAL KINGDOM 1 Dosage (2-0-6-0-0); DI: 1.67; CD: 0.50 ch, 2008 height 16.2 ⁄2 See gray pages—Nasrullah RACE AND (STAKES) RECORD Blushing Groom, 1974 Red God, by Nasrullah Age Starts 1st 2nd 3rd Earned 10s, SW, $407,153 Candy Stripes, 1982 512 f, 92 SW, 3.96 AEI Runaway Bride, by Wild Risk 2 2 1 1 0 $33,800 6s, wnr, $47,357 3 5 2(2) 2(1) 0 $1,904,900 1,001 f, 61 SW, 1.72 AEI Bubble Company, 1977 Lyphard, by Northern Dancer 12s, wnr, $27,027 4 2 1 1(1) 0 $388,800 Leroidesanimaux, ch, 2000 13s, SW, $1,658,377 10 f, 8 r, 6 w, 3 SW Prodice, by Prominer 5 in NA, Eng, UAE 3 1(1) 1(1) 0 $6,060,000 422 f, 18 SW, 1.75 AEI Totals 12 5(3) 5(3) 0 $8,387,500 Ahonoora, 1975 Lorenzaccio, by Klairon 6.99 AWD 20s, SW, $183,477 Won At 2 in North America Dissemble, 1989 467 f, 45 SW, 2.20 AEI Helen Nichols, by Martial Unraced A maiden special weight race at Kee ($47,000, 9f, AW 10 f, 8 r, 6 w, 3 SW Kerali, 1984 High Line, by High Hat in 1:49.01, by 3¼). 4s, wnr, $5,212 At 3 in North America 10 f, 8 r, 7 w, 3 SW Sookera, by Roberto Champion 3yo colt Surumu, 1974 Literat, by Birkhahn Won Kentucky Derby Presented by Yum! Brands (gr.
  • Kentucky Derby Presented by Yum! Brands Grade 1 - Thoroughbred for THREE YEAR OLDS with an ENTRY FEE of $25,000 EACH and a STARTING FEE of $25,000 EACH

    Kentucky Derby Presented by Yum! Brands Grade 1 - Thoroughbred for THREE YEAR OLDS with an ENTRY FEE of $25,000 EACH and a STARTING FEE of $25,000 EACH

    CHURCHILL DOWNS - May 5, 2012 - Race 11 STAKES Kentucky Derby Presented by Yum! Brands Grade 1 - Thoroughbred FOR THREE YEAR OLDS WITH AN ENTRY FEE OF $25,000 EACH AND A STARTING FEE OF $25,000 EACH. One And One Fourth Miles On The Dirt Track Record: (Secretariat - 1:59.40 - May 5, 1973) Purse: $2,000,000 Guaranteed Available Money: $2,219,600 Value of Race: $2,219,600 1st $1,459,600, 2nd $400,000, 3rd $200,000, 4th $100,000, 5th $60,000 Video Race Replay Weather: Cloudy Track: Fast Off at: 6:31 Start: Good for all except 16 Last Raced Pgm Horse Name (Jockey) Wgt M/E PP 1/4 1/2 3/4 1m Str Fin Odds Comments 7Apr12 6SA1 19 I'll Have Another (Gutierrez, Mario) 126 LA 19 6Head 72 1/2 61 41/2 22 11 1/2 15.30 4 wide 1/4 pl 14Apr12 11OP1 6 Bodemeister (Smith, Mike) 126 LA 6 1Head 11 11 13 13 2Neck 4.20* fast pace, gamely 14Apr12 11KEE1 5 Dullahan (Desormeaux, Kent) 126 LA 5 111/2 11Head 131 1/2 71/2 51 33/4 12.10 broke in, bmpd, 7w 1/4 24Mar12 10TP1 13 Went the Day Well (Velazquez, John) 126 LA b 13 171/2 171 151/2 141 1/2 9Head 41/2 30.60 bumped, 7w 1/4 pl 7Apr12 6SA2 8 Creative Cause (Rosario, Joel) 126 L 8 10Head 101/2 111/2 52 1/2 31/2 54 11.90 in close 7/8, 8w 1/4 7Apr12 6SA6 20 Liaison (Garcia, Martin) 126 LA b 20 91/2 8Head 71 6Head 6Head 61/2 56.20 4 wide, tired 31Mar12 11GP3 4 Union Rags (Leparoux, Julien) 126 LA 4 181 1/2 181/2 171 161 1/2 132 1/2 73/4 5.10 squeezed, took up 1Apr12 10FG3 7 Rousing Sermon (Lezcano, Jose) 126 LA b 7 14Head 14Head 9Head 91 81 1/2 82 40.70 waited, blocked 14Apr12 11KEE2 14 Hansen (Dominguez, Ramon) 126
  • Epiphaneia Breaks Through Dullahan Dies Suddenly

    Epiphaneia Breaks Through Dullahan Dies Suddenly

    MONDAY, OCTOBER 21, 2013 732-747-8060 $ TDN Home Page Click Here EPIPHANEIA BREAKS THROUGH FTKOCT BEGINS THREE-DAY STAND On paper, this year=s G1 Kikuka Sho at Kyoto Spurred by a reduction in supply and a healthy appeared relatively weak, lacking a previous Group 1 increase in demand, the 2013 yearling sales season has winner and following on the heels of a pair of stellar turned out strong numbers renewals dominated by Japanese Triple Crown winner so far, and Fasig-Tipton Orfevre (Jpn) (Stay Gold {Jpn}) in 2011, and four-time hopes the momentum Group 1 winner Gold Ship (Jpn) (Stay Gold {Jpn}) last continues heading into year. However, by the race=s end, Epiphaneia (Jpn) today=s October Fall Yearling (Symboli Kris S.) gave the Kyoto faithful something to Sale in Kentucky. The three- cheer about as he effortlessly ran away with the day sale begins this morning country=s third and final colts= Classic. The Carrot Farm and runs through silkbearer, who kicked off his career with three straight Wednesday, with sessions victories last year and won his prep for this in the starting daily at 10:00 a.m. G2 Kobe Shimbun Hai Sept. 22, could be considered A total of 1,134 horses, unlucky not to have won a Group 1 prior to yesterday. Boyd Browning, Jr. including four added horses, In fact, he came up just a length short of sweeping the L. Marquardt have been catalogued. Triple Crown, having finished second, beaten a half- AWe=re certainly in the length, in both the G1 Japanese 2000 Guineas and the midst of a recovery and have supply and demand G1 Japanese Derby.
  • Dullahan A+ Based on the Cross of Even the Score/Mr

    Dullahan A+ Based on the Cross of Even the Score/Mr

    06/07/12 16:36:48 EDT Dullahan A+ Based on the cross of Even the Score/Mr. Prospector and his sons and grandsons Variant = 5.94 Breeder: Phil Needham, Judy Needham & Bena Halecky (KY) Mr. Prospector, 70 b Fappiano, 77 b Killaloe, 70 b Unbridled, 87 b *Le Fabuleux, 61 ch Gana Facil, 81 ch Charedi, 76 dk b/ Unbridled's Song, 93 gr/ro =Fortino II (FR), 59 gr Caro (IRE), 67 gr =Chambord, 55 ch Trolley Song, 83 gr/ro Lucky Mel, 54 ch Lucky Spell, 71 b Incantation, 65 dk b/ Even the Score, 98 gr/ro Red God, 54 ch Blushing Groom (FR), 74 ch Runaway Bride (GB), 62 b Rahy, 85 ch Halo, 69 dk b/ Glorious Song, 76 b Ballade, 72 dk b/ Ashtabula, 91 ch Raise a Native, 61 ch Native Royalty, 67 b Queen Nasra, 52 b Now Your Teapottin, 83 ch Speak John, 58 b Sweet Bernice, 73 ch Dullahan La Eva, 66 b Chestnut Colt Native Dancer, 50 gr Foaled Feb 08, 2009 Raise a Native, 61 ch in Kentucky Raise You, 46 ch Mr. Prospector, 70 b Nashua, 52 b Gold Digger, 62 b Sequence, 46 dk b Smart Strike, 92 b Cyane, 59 b Smarten, 76 dk b/ Smartaire, 62 dk b/ Classy 'n Smart, 81 b Nodouble, 65 ch No Class, 74 b Classy Quillo, 69 dk b/ Mining My Own, 01 ch Nearctic, 54 br Northern Dancer, 61 b Natalma, 57 b Vice Regent, 67 ch *Menetrier, 44 br Victoria Regina, 58 ch Victoriana, 52 b Aspenelle, 90 ch Bold Ruler, 54 dk b Dynastic, 68 dk b/ Track Medal, 50 br Little to Do, 80 ch Restless Native, 60 gr Tribal to Do, 74 ch Marge's Request, 69 dk b/ Note on terminology in this report: Direct Cross refers to Dosage Profile: 8 8 10 0 0 Inbreeding: Mr.
  • I'll Have Another Bodemeister Dullahan Went

    I'll Have Another Bodemeister Dullahan Went

    Daily Racing Form 2012 Derby. Churchill Downs. 1 1/4 Miles. Dirt. Thoroughbred Ch. c. 3 (Apr) OBSAPR11 $35,000 Life 5 3 1 0 $634,000 101 D.Fst 2 2 0 0 $570,000 96 I'll Have Another Sire: Flower Alley (Distorted Humor) $7,500 Wet(403) 1 0 0 0 $1,000 40 Own: Reddam Racing LLC 2012 2 2 0 0 $570,000 101 Dam:Arch's Gal Edith (Arch) Synth 2 1 1 0 $63,000 84 Br: Harvey Clarke (Ky) 2011 3 1 1 0 $64,000 84 Turf(314) 0 0 0 0 $0 - Tr: O'Neill Doug F(7 1 1 0 .14) 2012:(554 94 .17) Cd 0 0 0 0 $0 - Dst(326*) 0 0 0 0 $0 - 7ß12= 6SA fst 1° :47 1:11 1:35¦1:47© SADerby-G1 95 3 2§ô 2§ô 3§ 3ô 1ó Gutierrez Mario L122 4.10 93= 08 IllHveAnothr122ó CrtivCus122ô Bluskisnrinbows122¨õ Bid 3wd 1/8,gamely 9 4á12= 6SA fst 1 :23 :46¨ 1:10§1:40© RBLewis-G2 96 4 2¦ô 2¦ô 2Ç 1§ 1§ö Gutierrez Mario L118 43.30 97= 03 IllHvAnothr118§ö EmpirWy118§ö ìGroovinSolo118¦õ Stalked,bid,led,clear 8 5æ11= 9Sar slyø 7f :21© :45 1:11§1:26 Hopeful-G1 40 8 9 9¬ö 10¦¥ 6¦© 6¦® Leparoux J R L120 11.90 58= 19 CurrencySwp120ö Trinnibrg120¨ö BigBluNtion120©ô 5w7/16,3w3/8,rail 5/16 10 7Ý11= 8Dmr fst 6ôf ú :22§ :45 1:09§1:15¨ BestPal-G2 84 1 2 1Ç 1Ç 1¦ 2¦ö Rosario J L119 6.80 94= 06 CrtvCs119¦ö IllHvAnothr119¨õ MghtyMonsoon119©õ Inside duel,2nd best 6 3Û11= 2Hol fst 5ôf ú :22¦ :45© :57©1:03© Md Sp Wt 55k 83 7 1 1¦ 1¦ 1¦ 1ö Rosario J L118 4.80 92= 17 IllHvAnothr118ö ScorpionWrrior118©õ Tumml118ó Angled in, held gamely 7 TRAINER: +180Days(27 .11 $1.35) WonLastStart(121 .21 $2.19) Dirt(333 .17 $1.88) Routes(354 .16 $2.03) Stakes(134 .12 $2.62) B.