DOCSLIB.ORG

A New Human Gene KCNRG Encoding Potassium Channel Regulating Protein Is a Cancer Suppressor Gene Candidate Located in 13Q14.3

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
A New Human Gene KCNRG Encoding Potassium Channel Regulating Protein Is a Cancer Suppressor Gene Candidate Located in 13Q14.3 FEBS Letters 539 (2003) 156^160 FEBS 27082 View metadata, citation and similar papers at core.ac.uk brought to you by CORE A new human gene KCNRG encoding potassium channel regulatingprovided by Elsevier - Publisher Connector protein is a cancer suppressor gene candidate located in 13q14.3 D.V. Ivanova;b, T.V. Tyazhelovaa, L. Lemonnierc, N. Kononenkoc, A.A. Pestovaa, E.A. Nikitind, N. Prevarskayac, R. Skrymac, Y.V. Panchinc;e;f , N.K. Yankovskya, A.V. Baranovaa;b;Ã aVavilov Institute of General Genetics, 3 Gubkina Str., 119991 Moscow, Russia bCenter for Biomedical Genomic and Informatics, Biology Department, George Mason University, 10910 University Blvd., MSN 4E3, Manassas, VA 20110 USA cLaboratoire de Physiologie Cellulaire, INSERM EMI 0228, Ba“timent SN3, USTL, 59655 Villeneuve d’Ascq, France dHematology Research Center of Russia, Novozykovski pr.4a, 125167 Moscow, Russia eInstitute for Information Transmission Problems, 19 Bolshoi Karetny, 101447 Moscow GSP-4, Russia f A. N. Belozersky Institute of Physico-Chemical Biology, Moscow State University, 119899 Moscow, Russia Received 13 January 2003; revised 14 February 2003; accepted 20 February 2003 First published online 10 March 2003 Edited by Maurice Montal tations in any of these genes ([4] and our unpublished data on Abstract We report the primary characterization of a new gene KCNRG mapped at chromosome band 13q14.3. This C13ORF1, and RFP2). These data suggest the existence of a gene includes three exons and has two alternatively spliced iso- di¡erent tumor suppressor gene, located in the area of inter- forms that are expressed in normal tissues and in some tumor est. cell lines. Protein KCNRG has high homology to tetrameriza- In several cell types, enhanced Kþ channel gene expression tion domain of voltage-gated K+ channels. Using the patch- or increased Kþ channel activity has been found to be asso- clamp technique we determined that KCNRG suppresses K+ ciated with cell division [10]. Important role of voltage-gated channel activity in human prostate cell line LNCaP. It is known Kþ channels in mitogenic growth control has been shown for + that selective blockers of K channels suppress lymphocyte and human lymphocytes [11]. A high expression of EAG channels LNCaP cell line proliferation. We suggest that KCNRG is a inhibited by physiological [Ca2þ]i has been demonstrated in candidate for a B-cell chronic lymphocytic leukemia and pros- several human melanoma [12] and somatic cancer cell lines tate cancer tumor suppressor gene. þ ß 2003 Published by Elsevier Science B.V. on behalf of the [13]. In human prostate cancer, LNCaP cells, the K channels 2þ Federation of European Biochemical Societies. controlling proliferation are also inhibited by [Ca ]i [14].It has been suggested that TEA [15^19] and verapamil [20^23] Key words: Tumor suppressor gene; inhibit the cancer cell proliferation by suppressing Kþ channel B-cell chronic lymphocytic leukemia; Prostate cancer; activity. We have previously demonstrated that in the andro- 13q14.3; Kþ channel regulating protein gen-sensitive prostate cancer cell line LNCaP the rate of the mitoses is decreased when voltage-activated Kþ channels are blocked implying that Kþ channels are involved in prostate 1. Introduction cell proliferation [24,25]. Here we report genomic organization and tissue distribu- Deletions in chromosomal band 13q14.3 have been previ- tion of the new human gene KCNRG located between ously associated with several di¡erent tumor types, including D13S1168 and D13S25. KCNRG encodes a soluble protein B-cell chronic lymphocytic leukemia (BCLL) [1] and prostate that shows strong homology to the cytoplasmic tetrameriza- cancer [2], indicating importance of this region for suppres- tion domain (T1) of voltage-gated Kþ channels. We suggest sion of a tumor development. The well-known tumor suppres- that such protein might interfere with the normal assembly of sor gene RB1 located at chromosome 13q has been excluded the Kþ channel protein by binding to their tetramerization as potential candidate for these diseases [3], implying the ex- domain causing the suppression of the Kþ channels. We istence of one or more tumor-suppressor genes in this region. also examine the suppressor e¡ect of KCNRG expression on Previously it was demonstrated that the region bordered by the whole-cell potassium currents in human prostate cell line STS markers D13S1168 and D13S25 is frequently deleted in LNCaP by the patch-clamp method. The results of our re- tumor cells form patients with BCLL [4,5]. The indicated area search suggest that KCNRG is a strong candidate for a is immersed in a wider region that is deleted in prostate cancer long-searched BCLL and prostate cancer tumor suppressor samples [6,7]. Four candidate genes belonging to this region, gene in human 13q14.3. namely DLEU1 and DLEU2 [4], RFP2 [8], C13ORF1 [9] were cloned. All candidates have been extensively checked for mu- tations by SSCP analysis and have failed to detect small mu- 2. Materials and methods 2.1. Molecular cloning of a new gene KCNRG To isolate a new gene KCNRG we have performed a BLASTN *Corresponding author. Fax: (1)-703-993 4293. search of the expressed sequence tag (EST) database of GenBank E-mail address: [email protected] (A.V. Baranova). with genomic sequence accession number AF440619 as a bait. We 0014-5793 / 03 / $22.00 ß 2003 Published by Elsevier Science B.V. on behalf of the Federation of European Biochemical Societies. doi:10.1016/S0014-5793(03)00211-4 FEBS 27082 12-3-03 Cyaan Magenta Geel Zwart D.V. Ivanov et al./FEBS Letters 539 (2003) 156^160 157 Fig. 1. A: Position of genes in the BCLL critical region in 13q14.3; B: genomic structure of KCNRG. retrieved two expressed human sequences with the accession numbers priate. Each experiment was repeated several times. Student’s t-test BI770863 and BG537776. Corresponding cloned cDNAs IMAGE: was used for statistical comparison among means, and di¡erences 5207702 and IMAGE: 4690662 were obtained from ATCC USA. with P 6 0.05 were considered signi¢cant. The plasmid cDNAs were isolated and completely sequenced using the following primers: NGf: 5P-GGTAGCCTCTAGTTTGAAGTG- 2.5. Computer analysis 3P; NGr: 5P-GAGGCAGTGGAAGTAAGGTC-3P; NGf871: 5P- Nucleic acid and protein sequences were compared with sequences GAAATGAAGTTGTCTATCCTC-3P; NGr871: 5P-GAGGATAGA- in the GenBank databases using program BLAST. The ‘Search the CAACTTCATTTC-3P; NGr110: 5P-GGAAAGATGTATTGAAGG- Conserved Domain Database using RPS-BLAST’ (http://www.ncbi. TAG-3P and standard M13-rev and M13-forv sequencing primers. nlm.nih.gov/Structure/cdd/wrpsb.cgi) program has been used for search of conservative domains. The sequences of the open reading 2.2. RT-PCR analysis frames of the KCNRG and KCNRG-like genes were aligned, using the A number of human poly(A) RNAs samples (Clontech, Palo Alto, ClustalW program (www2.ebi.ac.uk/ClustalW/). CA, USA) were reverse transcribed to generate ¢rst-strand cDNAs with Advantage RT-for-PCR kit (Clontech, USA). PCR was carried out with these ¢rst-strand cDNAs, corresponding to 5 ng poly(A) 3. Results and discussion RNA, with GenePakTM PCR Universal 100 (IsoGene, Russia) using the following primer pair NGf and NGr110. PCR was performed for 3.1. Molecular cloning of a novel putative tumor suppressor 35 and 39 cycles at 94‡C for 1 min, 58‡C for 1 min and 72‡C for 1 min. gene KCNRG The ampli¢ed fragments were sequenced on both strands. As a con- trol, GAPDH was ampli¢ed using speci¢c primers (Clontech, USA). To identify the candidate for tumor suppressor genes for BCLL and prostate cancer locus at 13q14.3, an integrated 2.3. Plasmid construction genomic contig [8] and corresponding transcript map [9] KCNRG cDNA encompassing the entire coding region was synthe- were constructed. The new gene KCNRG was found via sized by PCR ampli¢cation of cDNA insert from clone IMAGE: BLASTN search of the EST database of GenBank seeded 4690662 using two gene-speci¢c primers. A sense primer, containing with a genomic sequence (AF440619). As a result we retrieved a XhoI site at its 5P-end (NgreF: 5P-TATCTCGAGATGAGTAGT- CAGGAACTGGT-3P) and an antisense primer, containing a BamHI two expressed human sequences with the accession numbers site at its 5P-end (NgreR: 5P-TATGGATCCATACCTGTAATCC- BI770863 and BG537776. Corresponding cloned cDNAs IM- CAGCTA-3P) were used. 500 ng of the pEGFP-N1 vector (Clontech, AGE: 5207702 and IMAGE: 4690662 were completely se- USA) and PCR product were digested by XhoI and BamHI. The quenced (mRNAs AY129654 and AY129653) and found to digested vector and the PCR products were gel puri¢ed, ligated to- gether and cloned. The cDNA insert was sequenced to verify its iden- contain two full-length coding sequences corresponding to tity and absence of mutation. di¡erent mRNA isoforms that belongs to the same gene. Sequence alignment of the genomic locus AF440619, which 2.4. Electrophysiological studies consists of 350 000 bases with the KCNRG mRNAs LNCaP cells from the ATCC were grown and prepared for electro- AY129654 and AY129653 revealed genomic structure of physiological experiments as described previously [14,25]. The whole- cell modes of the patch-clamp technique were used. This technique 5460 bp KCNRG. mRNA AY129654 consists of two exons has been described in detail in previous publications [14,25]. (612 nt and 709 nt in size) divided in genome by single intron The extracellular solution contained (in mM): 140 NaCl, 5 KCl, 4139 nt in size, mRNA AY129653 consists of three exons 2 CaCl2, 2 MgCl2, 0.3 Na2HPO4, 0.4 KH2PO4, 4 NaHCO3, 5 glucose (612, 95 and 709 nt in size) divided by two introns (2750 and 10 HEPES (N-2-hydroxyethylpiperazine-NP-2-ethano-sulfonic acid).
Load more

Recommended publications
  • Mouse Kcnrg Conditional Knockout Project (CRISPR/Cas9)
    https://www.alphaknockout.com Mouse Kcnrg Conditional Knockout Project (CRISPR/Cas9) Objective: To create a Kcnrg conditional knockout Mouse model (C57BL/6J) by CRISPR/Cas-mediated genome engineering. Strategy summary: The Kcnrg gene (NCBI Reference Sequence: NM_206974 ; Ensembl: ENSMUSG00000046168 ) is located on Mouse chromosome 14. 2 exons are identified, with the ATG start codon in exon 1 and the TGA stop codon in exon 1 (Transcript: ENSMUST00000225582). Exon 1 will be selected as conditional knockout region (cKO region). Deletion of this region should result in the loss of function of the Mouse Kcnrg gene. To engineer the targeting vector, homologous arms and cKO region will be generated by PCR using BAC clone RP23-460E11 as template. Cas9, gRNA and targeting vector will be co-injected into fertilized eggs for cKO Mouse production. The pups will be genotyped by PCR followed by sequencing analysis. Note: Exon 1 covers 100.0% of the coding region. Start codon is in exon 1, and stop codon is in exon 1. The size of intron 1 for 3'-loxP site insertion: 3545 bp. The size of effective cKO region: ~833 bp. The cKO region does not have any other known gene. Page 1 of 7 https://www.alphaknockout.com Overview of the Targeting Strategy gRNA region Wildtype allele A gRNA region T 5' G 3' 3 1 2 Targeting vector A T G Targeted allele A T G Constitutive KO allele (After Cre recombination) Legends Exon of mouse Trim13 Homology arm Exon of mouse Kcnrg cKO region loxP site Page 2 of 7 https://www.alphaknockout.com Overview of the Dot Plot Window size: 10 bp Forward Reverse Complement Sequence 12 Note: The sequence of homologous arms and cKO region is aligned with itself to determine if there are tandem repeats.
    [Show full text]
  • Genomics Analysis of Potassium Channel Genes in Songbirds Reveals
    Lovell et al. BMC Genomics 2013, 14:470 http://www.biomedcentral.com/1471-2164/14/470 RESEARCH ARTICLE Open Access Genomics analysis of potassium channel genes in songbirds reveals molecular specializations of brain circuits for the maintenance and production of learned vocalizations Peter V Lovell, Julia B Carleton and Claudio V Mello* Abstract Background: A fundamental question in molecular neurobiology is how genes that determine basic neuronal properties shape the functional organization of brain circuits underlying complex learned behaviors. Given the growing availability of complete vertebrate genomes, comparative genomics represents a promising approach to address this question. Here we used genomics and molecular approaches to study how ion channel genes influence the properties of the brain circuitry that regulates birdsong, a learned vocal behavior with important similarities to human speech acquisition. We focused on potassium (K-)Channels, which are major determinants of neuronal cell excitability. Starting with the human gene set of K-Channels, we used cross-species mRNA/protein alignments, and syntenic analysis to define the full complement of orthologs, paralogs, allelic variants, as well as novel loci not previously predicted in the genome of zebra finch (Taeniopygia guttata). We also compared protein coding domains in chicken and zebra finch orthologs to identify genes under positive selective pressure, and those that contained lineage-specific insertions/deletions in functional domains. Finally, we conducted comprehensive in situ hybridizations to determine the extent of brain expression, and identify K-Channel gene enrichments in nuclei of the avian song system. Results: We identified 107 K-Channel finch genes, including 6 novel genes common to non-mammalian vertebrate lineages.
    [Show full text]
  • A Genome-Wide Association Study for Harness Racing Success in the Norwegian- Swedish Coldblooded Trotter Reveals Genes for Learning and Energy Metabolism Brandon D
    Velie et al. BMC Genetics (2018) 19:80 https://doi.org/10.1186/s12863-018-0670-3 RESEARCHARTICLE Open Access A genome-wide association study for harness racing success in the Norwegian- Swedish coldblooded trotter reveals genes for learning and energy metabolism Brandon D. Velie1* , Kim Jäderkvist Fegraeus1, Marina Solé1, Maria K. Rosengren1, Knut H. Røed2, Carl-Fredrik Ihler3, Eric Strand3 and Gabriella Lindgren1,4 Abstract Background: Although harness racing is of high economic importance to the global equine industry, significant genomic resources have yet to be applied to mapping harness racing success. To identify genomic regions associated with harness racing success, the current study performs genome-wide association analyses with three racing performance traits in the Norwegian-Swedish Coldblooded Trotter using the 670 K Axiom Equine Genotyping Array. Results: Following quality control, 613 horses and 359,635 SNPs were retained for further analysis. After strict Bonferroni correction, nine genome-wide significant SNPs were identified for career earnings. No genome-wide significant SNPs were identified for number of gallops or best km time. However, four suggestive genome-wide significant SNPs were identified for number of gallops, while 19 were identified for best km time. Multiple genes related to intelligence, energy metabolism, and immune function were identified as potential candidate genes for harness racing success. Conclusions: Apart from the physiological requirements needed for a harness racing horse to be successful, the results of the current study also advocate learning ability and memory as important elements for harness racing success. Further exploration into the mental capacity required for a horse to achieve racing success is likely warranted.
    [Show full text]
  • The Effects of DLEU1 Gene Expression in Burkitt Lymphoma (BL): Potential Mechanism of Chemoimmunotherapy Resistance in BL
    www.impactjournals.com/oncotarget/ Oncotarget, 2017, Vol. 8, (No. 17), pp: 27839-27853 Research Paper The effects of DLEU1 gene expression in Burkitt lymphoma (BL): potential mechanism of chemoimmunotherapy resistance in BL Sanghoon Lee1,2,*, Wen Luo1,*, Tishi Shah1, Changhong Yin1, Timmy O’Connell1,3, Tae-Hoon Chung4, Sherrie L. Perkins5, Rodney R. Miles5, Janet Ayello1, Erin Morris1, Lauren Harrison1, Carmella van de Ven1, Mitchell S. Cairo1,2,3,6,7 1Departments of Pediatrics, New York Medical College, Valhalla, New York, USA 2Departments of Cell Biology and Anatomy, New York Medical College, Valhalla, New York, USA 3Departments of Microbiology and Immunology, New York Medical College, Valhalla, New York, USA 4Cancer Science Institute of Singapore, National University of Singapore, Singapore 5Department of Pathology and ARUP Laboratories, University of Utah, Salt Lake City, Utah, USA 6Departments of Pathology, New York Medical College, Valhalla, New York, USA 7Departments of Medicine, New York Medical College, Valhalla, New York, USA *First and primary co-authors Correspondence to: Mitchell S. Cairo, email: [email protected] Keywords: DLEU1, tumor suppressor, chemoimmunotherapy, genome editing, B-NHL Received: November 17, 2016 Accepted: February 12, 2017 Published: February 24, 2017 Copyright: Lee et al. This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC-BY), which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. ABSTRACT Following a multivariant analysis we demonstrated that children and adolescents with Burkitt lymphoma (BL) and a 13q14.3 deletion have a significant decrease in event free survival (EFS) despite identical short intensive multi-agent chemotherapy.
    [Show full text]
  • Coon Thesis 2010.Pdf
    A search for KCNRG mutations in multiple myeloma cell lines A thesis submitted in partial fulfillment of the requirements for the degree of Master of Science at George Mason University By Stephanie Coon Bachelor of Science George Mason University, 2002 Director: Dr. Ancha Baranova, Associate Professor Department of Molecular and Microbiology Fall Semester 2010 George Mason University Fairfax, VA Copyright: 2010 Stephanie Coon All Rights Reserved ii DEDICATION I would like to express a sincere thanks to my advisors, professors, family, friends and co-workers. I appreciate all of your patience, support and guidance. iii ACKNOWLEDGEMENTS I would like to thank Aybike Birerdinc who collaborated on cell line DNA preparation and sequence analysis, Masoomeh Sikaroodi, who performed automated sequencing, and all of my colleagues who have gracefully shared their time and experiences. I would like to thank my committee members for their contributions, and Dr. Baranova, my dissertation adviser, who challenges her students in a way that inspires understanding and innovative ideas. iv TABLE OF CONTENTS Page List of Tables .................................................................................................................... vi List of Figures .................................................................................................................. vii Abstract ........................................................................................................................... viii Chapter 1: Background and Significance .........................................................................
    [Show full text]
  • Agricultural University of Athens
    ΓΕΩΠΟΝΙΚΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΑΘΗΝΩΝ ΣΧΟΛΗ ΕΠΙΣΤΗΜΩΝ ΤΩΝ ΖΩΩΝ ΤΜΗΜΑ ΕΠΙΣΤΗΜΗΣ ΖΩΙΚΗΣ ΠΑΡΑΓΩΓΗΣ ΕΡΓΑΣΤΗΡΙΟ ΓΕΝΙΚΗΣ ΚΑΙ ΕΙΔΙΚΗΣ ΖΩΟΤΕΧΝΙΑΣ ΔΙΔΑΚΤΟΡΙΚΗ ΔΙΑΤΡΙΒΗ Εντοπισμός γονιδιωματικών περιοχών και δικτύων γονιδίων που επηρεάζουν παραγωγικές και αναπαραγωγικές ιδιότητες σε πληθυσμούς κρεοπαραγωγικών ορνιθίων ΕΙΡΗΝΗ Κ. ΤΑΡΣΑΝΗ ΕΠΙΒΛΕΠΩΝ ΚΑΘΗΓΗΤΗΣ: ΑΝΤΩΝΙΟΣ ΚΟΜΙΝΑΚΗΣ ΑΘΗΝΑ 2020 ΔΙΔΑΚΤΟΡΙΚΗ ΔΙΑΤΡΙΒΗ Εντοπισμός γονιδιωματικών περιοχών και δικτύων γονιδίων που επηρεάζουν παραγωγικές και αναπαραγωγικές ιδιότητες σε πληθυσμούς κρεοπαραγωγικών ορνιθίων Genome-wide association analysis and gene network analysis for (re)production traits in commercial broilers ΕΙΡΗΝΗ Κ. ΤΑΡΣΑΝΗ ΕΠΙΒΛΕΠΩΝ ΚΑΘΗΓΗΤΗΣ: ΑΝΤΩΝΙΟΣ ΚΟΜΙΝΑΚΗΣ Τριμελής Επιτροπή: Aντώνιος Κομινάκης (Αν. Καθ. ΓΠΑ) Ανδρέας Κράνης (Eρευν. B, Παν. Εδιμβούργου) Αριάδνη Χάγερ (Επ. Καθ. ΓΠΑ) Επταμελής εξεταστική επιτροπή: Aντώνιος Κομινάκης (Αν. Καθ. ΓΠΑ) Ανδρέας Κράνης (Eρευν. B, Παν. Εδιμβούργου) Αριάδνη Χάγερ (Επ. Καθ. ΓΠΑ) Πηνελόπη Μπεμπέλη (Καθ. ΓΠΑ) Δημήτριος Βλαχάκης (Επ. Καθ. ΓΠΑ) Ευάγγελος Ζωίδης (Επ.Καθ. ΓΠΑ) Γεώργιος Θεοδώρου (Επ.Καθ. ΓΠΑ) 2 Εντοπισμός γονιδιωματικών περιοχών και δικτύων γονιδίων που επηρεάζουν παραγωγικές και αναπαραγωγικές ιδιότητες σε πληθυσμούς κρεοπαραγωγικών ορνιθίων Περίληψη Σκοπός της παρούσας διδακτορικής διατριβής ήταν ο εντοπισμός γενετικών δεικτών και υποψηφίων γονιδίων που εμπλέκονται στο γενετικό έλεγχο δύο τυπικών πολυγονιδιακών ιδιοτήτων σε κρεοπαραγωγικά ορνίθια. Μία ιδιότητα σχετίζεται με την ανάπτυξη (σωματικό βάρος στις 35 ημέρες, ΣΒ) και η άλλη με την αναπαραγωγική
    [Show full text]
  • High-Resolution Genomic Copy Number Profiling of Glioblastoma Multiforme by Single Nucleotide Polymorphism DNA Microarray
    Published OnlineFirst May 12, 2009; DOI: 10.1158/1541-7786.MCR-08-0270 Published Online First on May 12, 2009 High-Resolution Genomic Copy Number Profiling of Glioblastoma Multiforme by Single Nucleotide Polymorphism DNA Microarray Dong Yin,1 Seishi Ogawa,3 Norihiko Kawamata,1 Patrizia Tunici,2 Gaetano Finocchiaro,4 Marica Eoli,4 Christian Ruckert,6 Thien Huynh,1 Gentao Liu,2 Motohiro Kato,3 Masashi Sanada,3 Anna Jauch,5 Martin Dugas,6 Keith L. Black,2 and H. Phillip Koeffler1 1Division of Hematology/Oncology and 2Maxine Dunitz Neurosurgical Institute, Cedars-Sinai Medical Center, University of California at Los Angeles School of Medicine, Los Angeles, California; 3Regeneration Medicine of Hematopoiesis, University of Tokyo, School of Medicine, Tokyo, Japan; 4National Neurological Institute “C Besta,” Milan, Italy; 5Institute of Human Genetics, University Hospital Heidelberg, Germany; and 6Department of Medical Informatics and Biomathematics, University of Munster, Munster, Germany Abstract growth factor receptor/platelet-derived growth factor receptor Glioblastoma multiforme (GBM) is an extremely malignant α. Deletion of chromosome 6q26-27 often occurred (16 of 55 brain tumor. To identify new genomic alterations in GBM, samples). The minimum common deleted region included genomic DNA of tumor tissue/explants from 55 individuals PARK2, PACRG, QKI,and PDE10A genes. Further reverse and 6 GBM cell lines were examined using single nucleotide transcription Q-PCR studies showed that PARK2 expression polymorphism DNA microarray (SNP-Chip). Further gene was decreased in another collection of GBMs at a expression analysis relied on an additional 56 GBM samples. frequency of 61% (34 of 56) of samples. The 1p36.23 region SNP-Chip results were validated using several techniques, was deleted in 35% (19 of 55) of samples.
    [Show full text]
  • Tepzz 8Z6z54a T
    (19) TZZ ZZ_T (11) EP 2 806 054 A1 (12) EUROPEAN PATENT APPLICATION (43) Date of publication: (51) Int Cl.: 26.11.2014 Bulletin 2014/48 C40B 40/06 (2006.01) C12Q 1/68 (2006.01) C40B 30/04 (2006.01) C07H 21/00 (2006.01) (21) Application number: 14175049.7 (22) Date of filing: 28.05.2009 (84) Designated Contracting States: (74) Representative: Irvine, Jonquil Claire AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HGF Limited HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL 140 London Wall PT RO SE SI SK TR London EC2Y 5DN (GB) (30) Priority: 28.05.2008 US 56827 P Remarks: •Thecomplete document including Reference Tables (62) Document number(s) of the earlier application(s) in and the Sequence Listing can be downloaded from accordance with Art. 76 EPC: the EPO website 09753364.0 / 2 291 553 •This application was filed on 30-06-2014 as a divisional application to the application mentioned (71) Applicant: Genomedx Biosciences Inc. under INID code 62. Vancouver, British Columbia V6J 1J8 (CA) •Claims filed after the date of filing of the application/ after the date of receipt of the divisional application (72) Inventor: Davicioni, Elai R.68(4) EPC). Vancouver British Columbia V6J 1J8 (CA) (54) Systems and methods for expression- based discrimination of distinct clinical disease states in prostate cancer (57) A system for expression-based discrimination of distinct clinical disease states in prostate cancer is provided that is based on the identification of sets of gene transcripts, which are characterized in that changes in expression of each gene transcript within a set of gene transcripts can be correlated with recurrent or non- recur- rent prostate cancer.
    [Show full text]
  • Predict AID Targeting in Non-Ig Genes Multiple Transcription Factor
    Downloaded from http://www.jimmunol.org/ by guest on September 26, 2021 is online at: average * The Journal of Immunology published online 20 March 2013 from submission to initial decision 4 weeks from acceptance to publication Multiple Transcription Factor Binding Sites Predict AID Targeting in Non-Ig Genes Jamie L. Duke, Man Liu, Gur Yaari, Ashraf M. Khalil, Mary M. Tomayko, Mark J. Shlomchik, David G. Schatz and Steven H. Kleinstein J Immunol http://www.jimmunol.org/content/early/2013/03/20/jimmun ol.1202547 Submit online. Every submission reviewed by practicing scientists ? is published twice each month by http://jimmunol.org/subscription Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts http://www.jimmunol.org/content/suppl/2013/03/20/jimmunol.120254 7.DC1 Information about subscribing to The JI No Triage! Fast Publication! Rapid Reviews! 30 days* Why • • • Material Permissions Email Alerts Subscription Supplementary The Journal of Immunology The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2013 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. This information is current as of September 26, 2021. Published March 20, 2013, doi:10.4049/jimmunol.1202547 The Journal of Immunology Multiple Transcription Factor Binding Sites Predict AID Targeting in Non-Ig Genes Jamie L. Duke,* Man Liu,†,1 Gur Yaari,‡ Ashraf M. Khalil,x Mary M. Tomayko,{ Mark J. Shlomchik,†,x David G.
    [Show full text]
  • KCNRG (NM 173605) Human Mass Spec Standard – PH307143 | Origene
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for PH307143 KCNRG (NM_173605) Human Mass Spec Standard Product data: Product Type: Mass Spec Standards Description: KCNRG MS Standard C13 and N15-labeled recombinant protein (NP_775876) Species: Human Expression Host: HEK293 Expression cDNA Clone RC207143 or AA Sequence: Predicted MW: 31 kDa Protein Sequence: >RC207143 protein sequence Red=Cloning site Green=Tags(s) MSSQELVTLNVGGKIFTTRFSTIKQFPASRLARMLDGRDQEFKMVGGQIFVDRDGDLFSFILDFLRTHQL LLPTEFSDYLRLQREALFYELRSLVDLLNPYLLQPRPALVEVHFLSRNTQAFFRVFGSCSKTIEMLTGRI TVFTEQPSAPTWNGNFFPPQMTLLPLPPQRPSYHDLVFQCGSDSTTDNQTGVRYVSIKPDNRKLANGTNV LGLLIDTLLKEGFHLVSTRTVSSEDKTECYSFERIKSPEVLITNETPKPETIIIPEQSQIKK myc-FLAG tag Tag: C-Myc/DDK Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining Concentration: 50 ug/ml as determined by BCA Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. RefSeq: NP_775876 RefSeq Size: 1527 RefSeq ORF: 816 Synonyms: DLTET Locus ID: 283518 UniProt ID: Q8N5I3 Cytogenetics: 13q14.2 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 KCNRG (NM_173605) Human Mass Spec Standard – PH307143 Summary: This gene encodes a protein which regulates the activity of voltage-gated potassium channels. This gene is on chromosome 13 and overlaps the gene for tripartite motif containing 13 on the same strand. Multiple transcript variants encoding different isoforms have been found for this gene.
    [Show full text]
  • Caenorhabditis Elegans As a Model to Determine the Molecular Effects of Plausible Environmental Risk Factors of Breast Cancer
    CAENORHABDITIS ELEGANS AS A MODEL TO DETERMINE THE MOLECULAR EFFECTS OF PLAUSIBLE ENVIRONMENTAL RISK FACTORS OF BREAST CANCER by Elizabeth Romano A Dissertation Submitted to the Graduate Faculty of George Mason University in Partial Fulfillment of The Requirements for the Degree of Doctor of Philosophy Environmental Science and Public Policy Committee: ___________________________________ Dr. Ancha Baranova, Dissertation Director ___________________________________ Dr. Aybike Birerdinc, Committee Member ___________________________________ Dr. Cara Frankenfeld, Committee Member ___________________________________ Dr. E. Christien Parsons, Committee Member ___________________________________ Dr. Albert P. Torzilli, Graduate Program Director ___________________________________ Dr. A. Alonso Aguirre, Department Chairperson ___________________________________ Dr. Donna Fox, Associate Dean, Student Affairs & Special Programs, College of Science ___________________________________ Dr. Peggy Agouris, Dean, College of Science Date: ______________________________ Fall 2017 George Mason University Fairfax, VA CAENORHABDITIS ELEGANS AS A MODEL TO DETERMINE THE MOLECULAR EFFECTS OF PLAUSIBLE ENVIRONMENTAL RISK FACTORS OF BREAST CANCER A Dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy at George Mason University by Elizabeth Romano Master of Science George Mason University, 2010 Bachelor of Science George Mason University, 2008 Director: Ancha Baranova, Professor School of Systems Biology Fall Semester 2017 George Mason University Fairfax, VA Copyright 2017 Elizabeth Romano All Rights Reserved iii DEDICATION This is dedicated to family. For my dog who kept me (mostly) active when I just wanted to sit and work. For my husband who surprised me with treats when I was crunched for time and pushed me to “get it done.” For my mother who always watched my children when I needed to buckle down and provided a listening ear for my frustrations.
    [Show full text]
  • Viewer; GNF, a Range of Developmental and Physiological Pathways [1–3]
    Clusters of Internally Primed Transcripts Reveal Novel Long Noncoding RNAs Masaaki Furuno1[, Ken C. Pang2,3[, Noriko Ninomiya4, Shiro Fukuda4, Martin C. Frith2,4, Carol Bult1, Chikatoshi Kai4, Jun Kawai4,5, Piero Carninci4,5, Yoshihide Hayashizaki4,5, John S. Mattick2, Harukazu Suzuki4* 1 Mouse Genome Informatics Consortium, The Jackson Laboratory, Bar Harbor, Maine, United States of America, 2 Australian Research Council Special Research Centre for Functional and Applied Genomics, Institute for Molecular Bioscience, University of Queensland, Brisbane, Australia, 3 T Cell laboratory, Ludwig Institute for Cancer Research, Austin Health, Heidelberg, Victoria, Australia, 4 Genome Exploration Research Group (Genome Network Project Core Group), RIKEN Genomic Sciences Center, RIKEN Yokohama Institute, Yokohama, Japan, 5 Genome Science Laboratory, Discovery Research Institute, RIKEN Wako Institute, Wako, Japan Non-protein-coding RNAs (ncRNAs) are increasingly being recognized as having important regulatory roles. Although much recent attention has focused on tiny 22- to 25-nucleotide microRNAs, several functional ncRNAs are orders of magnitude larger in size. Examples of such macro ncRNAs include Xist and Air, which in mouse are 18 and 108 kilobases (Kb), respectively. We surveyed the 102,801 FANTOM3 mouse cDNA clones and found that Air and Xist were present not as single, full-length transcripts but as a cluster of multiple, shorter cDNAs, which were unspliced, had little coding potential, and were most likely primed from internal adenine-rich regions within longer parental transcripts. We therefore conducted a genome-wide search for regional clusters of such cDNAs to find novel macro ncRNA candidates. Sixty-six regions were identified, each of which mapped outside known protein-coding loci and which had a mean length of 92 Kb.
    [Show full text]