DOCSLIB.ORG

2012Tlorca the Greatwall Kinas

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
2012Tlorca the Greatwall Kinas The Greatwall kinase: a new pathway in the control of the cell cycle. Thierry Lorca, A. Castro To cite this version: Thierry Lorca, A. Castro. The Greatwall kinase: a new pathway in the control of the cell cycle.. Oncogene, Nature Publishing Group, 2012, epub ahead of print. 10.1038/onc.2012.79. hal-00715010 HAL Id: hal-00715010 https://hal.archives-ouvertes.fr/hal-00715010 Submitted on 23 Jun 2021 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Oncogene (2013) 32, 537 --543 & 2013 Macmillan Publishers Limited All rights reserved 0950-9232/13 www.nature.com/onc REVIEW The Greatwall kinase: a new pathway in the control of the cell cycle T Lorca and A Castro New data have recently established that protein phosphorylation during mitosis is the result of a controlled balance between kinase and phosphatase activities and that, as for mitotic kinases, phosphatases are also regulated during cell division. This regulation is at least in part induced by the activation of the Greatwall (Gwl) kinase at mitotic entry. Activated Gwl phosphorylates its substrates cAMP-regulated phospho protein 19 (Arpp19) and a-endosulfine (ENSA), promoting their binding to and the inhibition of PP2A. Interestingly, besides the role of the Gwl-Arpp19/ENSA in the control of mitotic division, new data in yeast support the involvement of this pathway in mRNA stabilization during G0 program initiation, although in this case the phosphatase PP2A appears not to be implicated. Finally, Gwl activity has been shown to be required for DNA checkpoint recovery. These new findings support the view that Gwl, Arpp19 and ENSA could function as the core of a new signalization pathway that, by targeting different final substrates, could participate in a variety of physiological functions. Oncogene (2013) 32, 537--543; doi:10.1038/onc.2012.79; published online 2 April 2012 Keywords: Greatwall; PP2A; cyclin B--Cdc2; mitosis; mRNA; checkpoint INTRODUCTION kinase, including a role in the DNA-damage checkpoint and in the Most of the sequential events of cell division depend on protein post-transcriptional mRNA protection during the initiation of the phosphorylation. These events are controlled by a network of yeast quiescence program. kinases and phosphatases that coordinate protein phosphoryla- tion and dephosphorylation. The regulation of protein kinases during cell cycle has been largely reported, whereas the control of phosphatases has lagged far behind that of the kinases. The ROLE OF THE Gwl KINASE IN THE REGULATION OF MITOTIC identification of the Greatwall (Gwl) kinase has importantly DIVISION contributed to the understanding of the mechanisms controlling A role of Gwl in the regulation of mitotic division was first phosphatase activity during cell cycle. suggested in Drosophila.1 Mutation of this protein in flys promoted The Drosophila gene coding for the Gwl kinase was first improper chromosome condensation and a delay in either G2 or identified in 2004 in Drosophila. In this model Gwl was first the metaphase of larval neuroblasts. Despite the presence of proposed to have a role in the control of mitotic progression,1 undercondensed chromosomes in mutant cells, they were positive a function that was confirmed in subsequent studies in the same for phosphohistone H3 and for the condensing component model.2 However, the most important advance in the character- Barren. Furthermore, 20% of cells never reached a stable ization of the signalization pathway of the Gwl kinase was metaphase and were arrested in prometaphase with an activated performed in Xenopus egg extracts. Biochemical studies performed spindle assembly checkpoint. It was then hypothesized that Gwl in this model allowed the identification of the targets of Gwl was directly involved either in the chromosome condensation or involved in the control of mitotic division,3--6 a mechanism that in the basic cell cycle machinery. Data from a subsequent study was subsequently shown to be conserved in mammalian cells.7--9 supported the second hypothesis. Depletion of Gwl from mitotic Finally, besides its function in the regulation of mitosis, two Xenopus egg extracts resulted in a rapid exit of mitosis. This exit additional roles of Gwl have recently been identified: one of them was concomitant with the inactivation of the Cdk1--cyclin B in the DNA-damage checkpoint recovery described in the Xenopus complex by the phosphorylation of the inhibitory residue Tyr 15 of egg extract model,10 and the other, characterized in yeast, in the Cdk1. Moreover, depletion of Gwl from cycling extracts prevented stabilization of specific mRNA transcripts required for the establish- Cdk1--cyclin B activation and mitotic entry, indicating that this 11 ment of the G0 program after nutrient deprivation. These diverse kinase could be required to trigger and to maintain Cdk1--cyclin B functions of Gwl suggest an involvement of this kinase in a activity probably by regulating the MPF amplification loop.3 conserved signalization pathway that would target different Accordingly, the addition of activated Gwl to cycling Xenopus egg downstream substrates to control a diversity of biological extracts promoted Cdc25 partial phosphorylation even in the processes. absence of Cdk1, Plx1 or MAPK activity, suggesting that Gwl would In this review, we discuss in detail the recent results derived be involved in the phosphorylation and activation of Cdc25. from genetic, biochemical and cellular approaches showing a role However, Gwl does not directly phosphorylate Cdc25, raising the of Gwl in the control of mitotic division. Moreover, we overview question of the identity of the kinase responsible for this recent evidences about new functions attributed to the Gwl phosphorylation.12 Centre de Recherche de Biochimie Macromole´culaire, CNRS UMR 5237, Universite´s Montpellier 2 et 1, Montpellier, France. Correspondence: Dr A Castro or Dr T Lorca, Centre de Recherche de Biochimie Macromole´culaire, CNRS UMR 5237, Universite´s Montpellier 2 et 1, IFR 122, 1919 Route de Mende, 34293 Montpellier cedex 5, France. E-mail: [email protected] or [email protected] Received 22 October 2011; revised 1 February 2012; accepted 1 February 2012; published online 2 April 2012 The Greatwall kinase T Lorca and A Castro 538 This interpretation was significantly changed by the results confirmed in an independent study in which immunodepletion of showing that when the inactivation of Cdk1--Cyclin B was PP2A--B55d subcomplex corrected the inability of Gwl-depleted prevented in mitotic egg extracts by the immunodepletion of Xenopus egg extracts to enter into mitosis. These data suggested a the inhibitory kinases Wee1 and Myt1, the subsequent immuno- model in which Gwl, by negatively regulating PP2A--B55d, confers depletion of Gwl from these extracts still promoted mitotic exit.4 the correct oscillatory activity of this phosphatase during mitotic Strikingly, this exit of mitosis was accompanied by a dephos- division in Xenopus egg extracts. PP2A--B55d activity must be low phorylation of most of the substrates of Cdk1--cyclin B despite the at mitotic entry to permit Cdk1--cyclin B substrate phosphoryla- high activity of this kinase. However, this massive dephosphorylation tion, and high at mitotic exit to promote substrate dephos- was not observed when the mitotic egg extracts were submitted phorylation. The activation of Gwl at the G2 --M transition ensures to a codepletion of Gwl and PP2A. These were the first data the inhibition of PP2A--B55d and thus the phosphorylation of suggesting a role of Gwl in the inhibition of PP2A, the phosphatase Cdk1--cyclin B substrates, whereas the inactivation of this kinase that would be responsible for Cdk1--cyclin B substrate dephos- at mitotic exit results in the reactivation of PP2A--B55d and in the phorylation.4,13 subsequent massive dephosphorylation of these substrates The fact that PP2A was involved in Cdk1--cyclin B substrate (Figure 1).16 dephosphorylation was also supported by an additional biochemi- This model has been validated in human cells. Data from cal study in which the activity of PP2A was measured and two different studies showed that in HeLa cells the complete compared in interphase and mitotic Xenopus egg extracts. In this knockdown of MASTL, the human orthologue of Gwl, arrested study, the activity of PP2A was first analysed and shown to be high these cells in G2. Partial knockdown of MASTL enabled mitotic in interphase egg extracts and low in mitotic extracts. PP2A entry, although Cdk1--cyclin B substrates were rapidly dephos- phosphatase is a complex of a catalytic C-subunit, a non-catalytic phorylated, leading to mitotic exit despite the complete absence scaffolding A subunit and a third variable B-subunit that acts as a of chromosome congression. Premature Cdk1--cyclin B substrate substrate specifier. These B subunits have been classified into four dephosphorylation resulted in severe cytokinesis defects, such types: B (B55), B0 (B56), B00 (PR72) and B000 (PR93), and some of as the formation of DNA bridges or of mutinucleate cells.7,9
Load more

Recommended publications
  • Downloaded the “Top Edge” Version
    bioRxiv preprint doi: https://doi.org/10.1101/855338; this version posted December 6, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. 1 Drosophila models of pathogenic copy-number variant genes show global and 2 non-neuronal defects during development 3 Short title: Non-neuronal defects of fly homologs of CNV genes 4 Tanzeen Yusuff1,4, Matthew Jensen1,4, Sneha Yennawar1,4, Lucilla Pizzo1, Siddharth 5 Karthikeyan1, Dagny J. Gould1, Avik Sarker1, Yurika Matsui1,2, Janani Iyer1, Zhi-Chun Lai1,2, 6 and Santhosh Girirajan1,3* 7 8 1. Department of Biochemistry and Molecular Biology, Pennsylvania State University, 9 University Park, PA 16802 10 2. Department of Biology, Pennsylvania State University, University Park, PA 16802 11 3. Department of Anthropology, Pennsylvania State University, University Park, PA 16802 12 4 contributed equally to work 13 14 *Correspondence: 15 Santhosh Girirajan, MBBS, PhD 16 205A Life Sciences Building 17 Pennsylvania State University 18 University Park, PA 16802 19 E-mail: [email protected] 20 Phone: 814-865-0674 21 1 bioRxiv preprint doi: https://doi.org/10.1101/855338; this version posted December 6, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. 22 ABSTRACT 23 While rare pathogenic copy-number variants (CNVs) are associated with both neuronal and non- 24 neuronal phenotypes, functional studies evaluating these regions have focused on the molecular 25 basis of neuronal defects.
    [Show full text]
  • Multiethnic Genome-Wide Meta-Analysis of Ectopic Fat Depots Identifies Loci Associated with Adipocyte Development and Differentiation
    University of Texas Rio Grande Valley ScholarWorks @ UTRGV School of Medicine Publications and Presentations School of Medicine 2017 Multiethnic genome-wide meta-analysis of ectopic fat depots identifies loci associated with adipocyte development and differentiation Audrey Y. Chu Xuan Deng Virginia A. Fisher Alexander Drong Yang Zhang See next page for additional authors Follow this and additional works at: https://scholarworks.utrgv.edu/som_pub Part of the Genetic Processes Commons, and the Genetic Structures Commons Recommended Citation Chu, A., Deng, X., Fisher, V. et al. Multiethnic genome-wide meta-analysis of ectopic fat depots identifies loci associated with adipocyte development and differentiation. Nat Genet 49, 125–130 (2017). https://doi.org/10.1038/ng.3738 This Article is brought to you for free and open access by the School of Medicine at ScholarWorks @ UTRGV. It has been accepted for inclusion in School of Medicine Publications and Presentations by an authorized administrator of ScholarWorks @ UTRGV. For more information, please contact [email protected], [email protected]. Authors Audrey Y. Chu, Xuan Deng, Virginia A. Fisher, Alexander Drong, Yang Zhang, Mary F. Feitosa, Ching-Ti Liu, Olivia Weeks, Audrey C. Choh, Qing Duan, and Thomas D. Dyer This article is available at ScholarWorks @ UTRGV: https://scholarworks.utrgv.edu/som_pub/118 HHS Public Access Author manuscript Author ManuscriptAuthor Manuscript Author Nat Genet Manuscript Author . Author manuscript; Manuscript Author available in PMC 2017 August 23. Published in final edited form as: Nat Genet. 2017 January ; 49(1): 125–130. doi:10.1038/ng.3738. Multiethnic genome-wide meta-analysis of ectopic fat depots identifies loci associated with adipocyte development and differentiation A full list of authors and affiliations appears at the end of the article.
    [Show full text]
  • Intergenic Disease-Associated Regions Are Abundant in Novel Transcripts N
    Bartonicek et al. Genome Biology (2017) 18:241 DOI 10.1186/s13059-017-1363-3 RESEARCH ARTICLE Open Access Intergenic disease-associated regions are abundant in novel transcripts N. Bartonicek1,3, M. B. Clark1,2, X. C. Quek1,3, J. R. Torpy1,3, A. L. Pritchard4, J. L. V. Maag1,3, B. S. Gloss1,3, J. Crawford5, R. J. Taft5,6, N. K. Hayward4, G. W. Montgomery5, J. S. Mattick1,3, T. R. Mercer1,3,7 and M. E. Dinger1,3* Abstract Background: Genotyping of large populations through genome-wide association studies (GWAS) has successfully identified many genomic variants associated with traits or disease risk. Unexpectedly, a large proportion of GWAS single nucleotide polymorphisms (SNPs) and associated haplotype blocks are in intronic and intergenic regions, hindering their functional evaluation. While some of these risk-susceptibility regions encompass cis-regulatory sites, their transcriptional potential has never been systematically explored. Results: To detect rare tissue-specific expression, we employed the transcript-enrichment method CaptureSeq on 21 human tissues to identify 1775 multi-exonic transcripts from 561 intronic and intergenic haploblocks associated with 392 traits and diseases, covering 73.9 Mb (2.2%) of the human genome. We show that a large proportion (85%) of disease-associated haploblocks express novel multi-exonic non-coding transcripts that are tissue-specific and enriched for GWAS SNPs as well as epigenetic markers of active transcription and enhancer activity. Similarly, we captured transcriptomes from 13 melanomas, targeting nine melanoma-associated haploblocks, and characterized 31 novel melanoma-specific transcripts that include fusion proteins, novel exons and non-coding RNAs, one-third of which showed allelically imbalanced expression.
    [Show full text]
  • ENSA Antibody A
    Revision 1 C 0 2 - t ENSA Antibody a e r o t S Orders: 877-616-CELL (2355) [email protected] Support: 877-678-TECH (8324) 0 7 Web: [email protected] 7 www.cellsignal.com 8 # 3 Trask Lane Danvers Massachusetts 01923 USA For Research Use Only. Not For Use In Diagnostic Procedures. Applications: Reactivity: Sensitivity: MW (kDa): Source: UniProt ID: Entrez-Gene Id: WB H Mk Endogenous 15 Rabbit O43768 2029 Product Usage Information 3. Yu, J. et al. (2004) J Cell Biol 164, 487-92. 4. Voets, E. and Wolthuis, R.M. (2010) Cell Cycle 9, 3591-601. Application Dilution 5. Blake-Hodek, K.A. et al. (2012) Mol Cell Biol 32, 1337-53. 6. Vigneron, S. et al. (2011) Mol Cell Biol 31, 2262-75. Western Blotting 1:1000 7. Lorca, T. and Castro, A. (2012) Oncogene 32, 537-543. Storage Supplied in 10 mM sodium HEPES (pH 7.5), 150 mM NaCl, 100 µg/ml BSA and 50% glycerol. Store at –20°C. Do not aliquot the antibody. Specificity / Sensitivity ENSA Antibody recognizes endogenous levels of total ENSA protein. Species Reactivity: Human, Monkey Species predicted to react based on 100% sequence homology: Mouse, Rat Source / Purification Polyclonal antibodies are produced by immunizing animals with a synthetic peptide corresponding to residues near the carboxy terminus of human ENSA protein. Antibodies are purified by protein A and peptide affinity chromatography. Background Mitotic control is important for normal growth, development, and maintenance of all eukaryotic cells. Research studies have demonstrated that inappropriate control of mitosis can lead to genomic instability and cancer (reviewed in 1,2).
    [Show full text]
  • ENSA (NM 207042) Human Tagged ORF Clone Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC220441 ENSA (NM_207042) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: ENSA (NM_207042) Human Tagged ORF Clone Tag: Myc-DDK Symbol: ENSA Synonyms: ARPP-19e Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC220441 representing NM_207042 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCCCAGAAACAAGAAGAAGAGAACCCTGCGGAGGAGACCGGCGAGGAGAAGCAGGACACGCAGGAGA AAGAAGGTATTCTGCCTGAGAGAGCTGAAGAGGCAAAGCTAAAGGCCAAATACCCAAGCCTAGGACAAAA GCCTGGAGGCTCCGACTTCCTCATGAAGAGACTCCAGAAAGGGGATTATAAATCATTACATTGGAGTGTG CTTCTCTGTGCGGATGAAATGCAAAAGTACTTTGACTCAGGAGACTACAACATGGCCAAAGCCAAGATGA AGAATAAGCAGCTGCCAAGTGCAGGACCAGACAAGAACCTGGTGACTGGTGATCACATCCCCACCCCACA GGATCTGCCCCAGAGAAAGTCCTCGCTCGTCACCAGCAAGCTTGCGGGTGGCCAAGTTGAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC220441 representing NM_207042 Red=Cloning site Green=Tags(s) MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGDYKSLHWSV LLCADEMQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE myc-FLAG tag Chromatograms: https://cdn.origene.com/chromatograms/mg3846_g05.zip Restriction Sites: SgfI-MluI This product is
    [Show full text]
  • Genetics of Lipedema: New Perspectives on Genetic Research and Molecular Diagnoses S
    European Review for Medical and Pharmacological Sciences 2019; 23: 5581-5594 Genetics of lipedema: new perspectives on genetic research and molecular diagnoses S. PAOLACCI1, V. PRECONE2, F. ACQUAVIVA3, P. CHIURAZZI4,5, E. FULCHERI6,7, M. PINELLI3,8, F. BUFFELLI9,10, S. MICHELINI11, K.L. HERBST12, V. UNFER13, M. BERTELLI2; GENEOB PROJECT 1MAGI’S LAB, Rovereto (TN), Italy 2MAGI EUREGIO, Bolzano, Italy 3Department of Translational Medicine, Section of Pediatrics, Federico II University, Naples, Italy 4Istituto di Medicina Genomica, Fondazione A. Gemelli, Università Cattolica del Sacro Cuore, Rome, Italy 5UOC Genetica Medica, Fondazione Policlinico Universitario “A. Gemelli” IRCCS, Rome, Italy 6Fetal and Perinatal Pathology Unit, IRCCS Istituto Giannina Gaslini, Genoa, Italy 7Department of Integrated Surgical and Diagnostic Sciences, University of Genoa, Genoa, Italy 8Telethon Institute of Genetics and Medicine (TIGEM), Pozzuoli, Italy 9Fetal and Perinatal Pathology Unit, IRCCS Istituto Giannina Gaslini, Genoa, Italy 10Department of Neuroscience, Rehabilitation, Ophthalmology, Genetics and Maternal-Infantile Sciences, University of Genoa, Genoa, Italy 11Department of Vascular Rehabilitation, San Giovanni Battista Hospital, Rome, Italy 12Department of Medicine, University of Arizona, Tucson, AZ, USA 13Department of Developmental and Social Psychology, Faculty of Medicine and Psychology, Sapienza University of Rome, Rome, Italy Abstract. – OBJECTIVE: The aim of this quali- Introduction tative review is to provide an update on the cur- rent understanding of the genetic determinants of lipedema and to develop a genetic test to dif- Lipedema is an underdiagnosed chronic debil- ferentiate lipedema from other diagnoses. itating disease characterized by bruising and pain MATERIALS AND METHODS: An electronic and excess of subcutaneous adipose tissue of the search was conducted in MEDLINE, PubMed, and legs and/or arms in women during or after times Scopus for articles published in English up to of hormone change, especially in puberty1.
    [Show full text]
  • ENSA/ARPP19-PP2A Is Targeted by Camp/PKA and Cgmp/PKG in Anucleate Human Platelets
    cells Article The Cell Cycle Checkpoint System MAST(L)- ENSA/ARPP19-PP2A is Targeted by cAMP/PKA and cGMP/PKG in Anucleate Human Platelets Elena J. Kumm 1, Oliver Pagel 2, Stepan Gambaryan 1,3, Ulrich Walter 1 , René P. Zahedi 2,4, Albert Smolenski 5 and Kerstin Jurk 1,* 1 Center for Thrombosis and Hemostasis (CTH), University Medical Center of the Johannes Gutenberg-University Mainz, 55131 Mainz, Germany; [email protected] (E.J.K.); [email protected] (S.G.); [email protected] (U.W.) 2 Leibniz-Institut für Analytische Wissenschaften—ISAS—e.V., 44227 Dortmund, Germany; [email protected] (O.P.); [email protected] (R.P.Z.) 3 Sechenov Institute of Evolutionary Physiology and Biochemistry, Russian Academy of Sciences, St. Petersburg 194223, Russia 4 Proteomics Centre, Lady Davis Institute, Jewish General Hospital, Montréal, QC H3T1E2, Canada 5 UCD Conway Institute, UCD School of Medicine and Medical Science, University College Dublin, D04 V1W8 Dublin, Ireland; [email protected] * Correspondence: [email protected]; Tel.: +49-6131-17-8278 Received: 23 January 2020; Accepted: 14 February 2020; Published: 18 February 2020 Abstract: The cell cycle is controlled by microtubule-associated serine/threonine kinase-like (MASTL), which phosphorylates the cAMP-regulated phosphoproteins 19 (ARPP19) at S62 and 19e/α-endosulfine (ENSA) at S67and converts them into protein phosphatase 2A (PP2A) inhibitors. Based on initial proteomic data, we hypothesized that the MASTL-ENSA/ARPP19-PP2A pathway, unknown until now in platelets, is regulated and functional in these anucleate cells. We detected ENSA, ARPP19 and various PP2A subunits (including seven different PP2A B-subunits) in proteomic studies of human platelets.
    [Show full text]
  • Renoprotective Effect of Combined Inhibition of Angiotensin-Converting Enzyme and Histone Deacetylase
    BASIC RESEARCH www.jasn.org Renoprotective Effect of Combined Inhibition of Angiotensin-Converting Enzyme and Histone Deacetylase † ‡ Yifei Zhong,* Edward Y. Chen, § Ruijie Liu,*¶ Peter Y. Chuang,* Sandeep K. Mallipattu,* ‡ ‡ † | ‡ Christopher M. Tan, § Neil R. Clark, § Yueyi Deng, Paul E. Klotman, Avi Ma’ayan, § and ‡ John Cijiang He* ¶ *Department of Medicine, Mount Sinai School of Medicine, New York, New York; †Department of Nephrology, Longhua Hospital, Shanghai University of Traditional Chinese Medicine, Shanghai, China; ‡Department of Pharmacology and Systems Therapeutics and §Systems Biology Center New York, Mount Sinai School of Medicine, New York, New York; |Baylor College of Medicine, Houston, Texas; and ¶Renal Section, James J. Peters Veterans Affairs Medical Center, New York, New York ABSTRACT The Connectivity Map database contains microarray signatures of gene expression derived from approximately 6000 experiments that examined the effects of approximately 1300 single drugs on several human cancer cell lines. We used these data to prioritize pairs of drugs expected to reverse the changes in gene expression observed in the kidneys of a mouse model of HIV-associated nephropathy (Tg26 mice). We predicted that the combination of an angiotensin-converting enzyme (ACE) inhibitor and a histone deacetylase inhibitor would maximally reverse the disease-associated expression of genes in the kidneys of these mice. Testing the combination of these inhibitors in Tg26 mice revealed an additive renoprotective effect, as suggested by reduction of proteinuria, improvement of renal function, and attenuation of kidney injury. Furthermore, we observed the predicted treatment-associated changes in the expression of selected genes and pathway components. In summary, these data suggest that the combination of an ACE inhibitor and a histone deacetylase inhibitor could have therapeutic potential for various kidney diseases.
    [Show full text]
  • Datasheet Blank Template
    SAN TA C RUZ BI OTEC HNOL OG Y, INC . ENSA (T-14): sc-161563 BACKGROUND PRODUCT ATP-dependent potassium K(ATP) channels regulate the polarity of the cell Each vial contains 200 µg IgG in 1.0 ml of PBS with < 0.1% sodium azide membrane, which affects cell metabolism and Insulin secretion. When ATP and 0.1% gelatin. levels rise in response to an increased rate of glucose metabolism, the K(ATP) Blocking peptide available for competition studies, sc-161563 P, (100 µg channels close, which stimulates the cells to secrete Insulin. K(ATP) chan nels pep tide in 0.5 ml PBS containing < 0.1% sodium azide and 0.2% BSA). are composed of two structurally unrelated subunits; a Kir6.0 subfamily component and a sulfonylurea receptor (SUR) component. ENSA ( -endo - α APPLICATIONS sulfine), also known as ARPP-19e, is a 121 amino acid endogenous liga nd for SUR. ENSA inhibits the binding of sulfonylurea to the SUR compo nent of the ENSA (T-14) is recommended for detection of ENSA of mouse, rat and K(ATP) channel, thereby reducing channel activity and stimulating the secre - human origin by Western Blotting (starting dilution 1:200, dilution range tion of Insulin. ENSA is localized to the cytoplasm and widely expressed in 1:100-1:1000), immunofluorescence (starting dilution 1:50, dilution range tissues, with high expression in brain and muscle and low expression in 1:50-1:500) and solid phase ELISA (starting dilution 1:30, dilution range pancreas. ENSA is phosphorylated by PKA and exists as two isoforms, 1:30-1:3000).
    [Show full text]
  • Agricultural University of Athens
    ΓΕΩΠΟΝΙΚΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΑΘΗΝΩΝ ΣΧΟΛΗ ΕΠΙΣΤΗΜΩΝ ΤΩΝ ΖΩΩΝ ΤΜΗΜΑ ΕΠΙΣΤΗΜΗΣ ΖΩΙΚΗΣ ΠΑΡΑΓΩΓΗΣ ΕΡΓΑΣΤΗΡΙΟ ΓΕΝΙΚΗΣ ΚΑΙ ΕΙΔΙΚΗΣ ΖΩΟΤΕΧΝΙΑΣ ΔΙΔΑΚΤΟΡΙΚΗ ΔΙΑΤΡΙΒΗ Εντοπισμός γονιδιωματικών περιοχών και δικτύων γονιδίων που επηρεάζουν παραγωγικές και αναπαραγωγικές ιδιότητες σε πληθυσμούς κρεοπαραγωγικών ορνιθίων ΕΙΡΗΝΗ Κ. ΤΑΡΣΑΝΗ ΕΠΙΒΛΕΠΩΝ ΚΑΘΗΓΗΤΗΣ: ΑΝΤΩΝΙΟΣ ΚΟΜΙΝΑΚΗΣ ΑΘΗΝΑ 2020 ΔΙΔΑΚΤΟΡΙΚΗ ΔΙΑΤΡΙΒΗ Εντοπισμός γονιδιωματικών περιοχών και δικτύων γονιδίων που επηρεάζουν παραγωγικές και αναπαραγωγικές ιδιότητες σε πληθυσμούς κρεοπαραγωγικών ορνιθίων Genome-wide association analysis and gene network analysis for (re)production traits in commercial broilers ΕΙΡΗΝΗ Κ. ΤΑΡΣΑΝΗ ΕΠΙΒΛΕΠΩΝ ΚΑΘΗΓΗΤΗΣ: ΑΝΤΩΝΙΟΣ ΚΟΜΙΝΑΚΗΣ Τριμελής Επιτροπή: Aντώνιος Κομινάκης (Αν. Καθ. ΓΠΑ) Ανδρέας Κράνης (Eρευν. B, Παν. Εδιμβούργου) Αριάδνη Χάγερ (Επ. Καθ. ΓΠΑ) Επταμελής εξεταστική επιτροπή: Aντώνιος Κομινάκης (Αν. Καθ. ΓΠΑ) Ανδρέας Κράνης (Eρευν. B, Παν. Εδιμβούργου) Αριάδνη Χάγερ (Επ. Καθ. ΓΠΑ) Πηνελόπη Μπεμπέλη (Καθ. ΓΠΑ) Δημήτριος Βλαχάκης (Επ. Καθ. ΓΠΑ) Ευάγγελος Ζωίδης (Επ.Καθ. ΓΠΑ) Γεώργιος Θεοδώρου (Επ.Καθ. ΓΠΑ) 2 Εντοπισμός γονιδιωματικών περιοχών και δικτύων γονιδίων που επηρεάζουν παραγωγικές και αναπαραγωγικές ιδιότητες σε πληθυσμούς κρεοπαραγωγικών ορνιθίων Περίληψη Σκοπός της παρούσας διδακτορικής διατριβής ήταν ο εντοπισμός γενετικών δεικτών και υποψηφίων γονιδίων που εμπλέκονται στο γενετικό έλεγχο δύο τυπικών πολυγονιδιακών ιδιοτήτων σε κρεοπαραγωγικά ορνίθια. Μία ιδιότητα σχετίζεται με την ανάπτυξη (σωματικό βάρος στις 35 ημέρες, ΣΒ) και η άλλη με την αναπαραγωγική
    [Show full text]
  • Identification of Nuclear and Cytoplasmic Mrna Targets for the Shuttling Protein SF2/ASF
    Identification of Nuclear and Cytoplasmic mRNA Targets for the Shuttling Protein SF2/ASF Jeremy R. Sanford1,2¤*, Pedro Coutinho1, Jamie A. Hackett1, Xin Wang2, William Ranahan2, Javier F. Caceres1* 1 MRC Human Genetics Unit, Western General Hospital, Edinburgh, United Kingdom, 2 Department of Biochemistry and Molecular Biology, Indiana University School of Medicine, Indianapolis, Indiana, United States of America Abstract The serine and arginine-rich protein family (SR proteins) are highly conserved regulators of pre-mRNA splicing. SF2/ASF, a prototype member of the SR protein family, is a multifunctional RNA binding protein with roles in pre-mRNA splicing, mRNA export and mRNA translation. These observations suggest the intriguing hypothesis that SF2/ASF may couple splicing and translation of specific mRNA targets in vivo. Unfortunately the paucity of endogenous mRNA targets for SF2/ASF has hindered testing of this hypothesis. Here, we identify endogenous mRNAs directly cross-linked to SF2/ASF in different sub- cellular compartments. Cross-Linking Immunoprecipitation (CLIP) captures the in situ specificity of protein-RNA interaction and allows for the simultaneous identification of endogenous RNA targets as well as the locations of binding sites within the RNA transcript. Using the CLIP method we identified 326 binding sites for SF2/ASF in RNA transcripts from 180 protein coding genes. A purine-rich consensus motif was identified in binding sites located within exon sequences but not introns. Furthermore, 72 binding sites were occupied by SF2/ASF in different sub-cellular fractions suggesting that these binding sites may influence the splicing or translational control of endogenous mRNA targets. We demonstrate that ectopic expression of SF2/ASF regulates the splicing and polysome association of transcripts derived from the SFRS1, PABC1, NETO2 and ENSA genes.
    [Show full text]
  • Ser1369ala Variant in Sulfonylurea Receptor Gene ABCC8 Is Associated with Antidiabetic Efficacy of Gliclazide in Chinese Type 2 Diabetic Patients
    Clinical Care/Education/Nutrition/Psychosocial Research ORIGINAL ARTICLE Ser1369Ala Variant in Sulfonylurea Receptor Gene ABCC8 Is Associated With Antidiabetic Efficacy of Gliclazide in Chinese Type 2 Diabetic Patients 1 3 YAN FENG, MD, PHD XUEQI LI, MD he epidemic of type 2 diabetes in the 1 4 GUANGYUN MAO, MD, PHD LIRONG SUN, MD last decade in both developed and 1 5 XIAOWEI REN, MD JINQUI YANG, MD, PHD 1 6 developing countries has made it a OUXUN ING MD EIQING A MD T H X , W M , 1 7 major threat to global public health. At GENFU TANG, MD XIAOBIN WANG, MD, SCD 2 1 least 171 million people worldwide had QIANG LI, MD, PHD XIPING XU, MD, PHD diabetes in 2000, and this figure is likely to more than double by 2030 to reach 366 million (1). The majority of diabetes is OBJECTIVE — The purpose of this study was to investigate whether genetic variants could type 2 diabetes. Most of the recent rise in influence the antidiabetic efficacy of gliclazide in type 2 diabetic patients. diabetes prevalence is probably a result of lifestyle and dietary changes, but there is RESEARCH DESIGN AND METHODS — A total of 1,268 type 2 diabetic patients also clear evidence for genetic predisposi- whose diabetes was diagnosed within the past 5 years and who had no recent hypoglycemic tion to this complex disease. During the treatment were enrolled from 23 hospitals in China. All of the patients were treated with last decade, molecular genetic studies of gliclazide for 8 weeks. Fasting and oral glucose tolerance test 2-h plasma glucose, fasting insulin, type 2 diabetes have shown significant and A1C were measured at baseline and after 8 weeks of treatment.
    [Show full text]