DOCSLIB.ORG

Ser1369ala Variant in Sulfonylurea Receptor Gene ABCC8 Is Associated with Antidiabetic Efficacy of Gliclazide in Chinese Type 2 Diabetic Patients

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Ser1369ala Variant in Sulfonylurea Receptor Gene ABCC8 Is Associated with Antidiabetic Efficacy of Gliclazide in Chinese Type 2 Diabetic Patients Clinical Care/Education/Nutrition/Psychosocial Research ORIGINAL ARTICLE Ser1369Ala Variant in Sulfonylurea Receptor Gene ABCC8 Is Associated With Antidiabetic Efficacy of Gliclazide in Chinese Type 2 Diabetic Patients 1 3 YAN FENG, MD, PHD XUEQI LI, MD he epidemic of type 2 diabetes in the 1 4 GUANGYUN MAO, MD, PHD LIRONG SUN, MD last decade in both developed and 1 5 XIAOWEI REN, MD JINQUI YANG, MD, PHD 1 6 developing countries has made it a OUXUN ING MD EIQING A MD T H X , W M , 1 7 major threat to global public health. At GENFU TANG, MD XIAOBIN WANG, MD, SCD 2 1 least 171 million people worldwide had QIANG LI, MD, PHD XIPING XU, MD, PHD diabetes in 2000, and this figure is likely to more than double by 2030 to reach 366 million (1). The majority of diabetes is OBJECTIVE — The purpose of this study was to investigate whether genetic variants could type 2 diabetes. Most of the recent rise in influence the antidiabetic efficacy of gliclazide in type 2 diabetic patients. diabetes prevalence is probably a result of lifestyle and dietary changes, but there is RESEARCH DESIGN AND METHODS — A total of 1,268 type 2 diabetic patients also clear evidence for genetic predisposi- whose diabetes was diagnosed within the past 5 years and who had no recent hypoglycemic tion to this complex disease. During the treatment were enrolled from 23 hospitals in China. All of the patients were treated with last decade, molecular genetic studies of gliclazide for 8 weeks. Fasting and oral glucose tolerance test 2-h plasma glucose, fasting insulin, type 2 diabetes have shown significant and A1C were measured at baseline and after 8 weeks of treatment. We used two independent progress (2). Five genome-wide associa- cohorts to test the associations of 25 single nuclear polymorphisms in 11 candidate genes with the antidiabetic efficacy of gliclazide. A general linear regression model was used to test the tion studies have been published since association with adjustment for important covariates. February 2007, increasing the number of confirmed type 2 diabetes susceptibility loci from three (PPARG, KCNJ11, and RESULTS — After 8 weeks of gliclazide therapy, mean fasting plasma glucose (FPG) was TCF7L2) to 9 (with the addition of reduced from 11.1 mmol/l at baseline to 7.7 mmol/l. In cohort 1, we genotyped all 25 SNPs (n ϭ 661) and found that Ser1369Ala of the ABCC8 gene and rs5210 of the KCNJ11 gene were CDKAL1, CDKN2A/B, IGF2BP2, HHEX/ significantly associated with decreases in FPG (P ϭ 0.002). We further genotyped Ser1369Ala in IDE, FTO, and SLC30A8) (2). In addition, cohort 2 (n ϭ 607) and confirmed the association identified in cohort 1. In the pooled analysis, studies have lent support for the involve- compared with subjects with the Ser/Ser genotype, subjects with the Ala/Ala genotype had a ment of many other genes, such as ABCC8 7.7% greater decrease in FPG (P Ͻ 0.001), an 11.9% greater decrease in 2-h plasma glucose (P ϭ (3–6). In contrast, few studies have inves- 0.003), and a 3.5% greater decrease in A1C (P ϭ 0.06) after 8 weeks of treatment with gliclazide. tigated whether genetic variants may modulate the response to antidiabetic CONCLUSIONS — In two independent cohorts of Chinese type 2 diabetic patients, we agents in type 2 diabetic patients (7–9). found consistent evidence that the Ser1369Ala variant in the ABCC8 gene can influence the Such information can assist clinicians in antidiabetic efficacy of gliclazide. developing individualized treatment plans that will maximize therapeutic effi- Diabetes Care 31:1939–1944, 2008 cacy and minimize side effects. ●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●● Sulfonylurea is a widely used oral hy- From the 1Anhui Biomedical Institute, Anhui Medical University, Hefei, China; the 2Division of Endocri- poglycemic agent. Most type 2 diabetic nology, the Second Hospital, Harbin Medical University, Harbin, China; the 3Division of Endocrinology, patients respond well to this agent, but the First Hospital, Harbin Medical University, Harbin, China; 4Tianjin Medical University Metabolic variable efficacy is seen, and primary fail- 5 Hospital, Tianjin, China; the Division of Endocrinology, Tongren Hospital, Capital Medical University, ure to sulfonylurea treatment is seen in a Beijing, China; the 6Division of Endocrinology, the First Hefei People’s Hospital, Hefei, China; and the 7The Mary Ann and J. Milburn Smith Child Health Research Program, Children’s Memorial Hospital and small portion of patients. Secondary fail- Children’s Memorial Research Center, Chicago, Illinois. ure of sulfonylurea monotherapy devel- Corresponding author: Xiping Xu, [email protected]. ops in ϳ34% of patients at 5 years (10). Received 26 November 2007 and accepted 21 June 2008. To explore the underlying genetic factors Published ahead of print at http://care.diabetesjournals.org on 3 July 2008. DOI: 10.2337/dc07-2248. Y.F. and G.M. contributed equally to this study. that may explain individual variable re- Y.F. is currently affiliated with Bridgeport Hospital, Yale University School of Medicine, New Haven, Con- sponse to sulfonylurea, we conducted a necticut. hospital-based pharmacogenetic study. © 2008 by the American Diabetes Association. Readers may use this article as long as the work is properly Our goal was to examine whether type 2 cited, the use is educational and not for profit, and the work is not altered. See http://creativecommons. diabetes candidate gene variants can in- org/licenses/by-nc-nd/3.0/ for details. The costs of publication of this article were defrayed in part by the payment of page charges. This article must therefore be hereby fluence the antidiabetic efficacy of glicla- marked “advertisement” in accordance with 18 U.S.C. Section 1734 solely to indicate this fact. zide, a commonly used sulfonylurea DIABETES CARE, VOLUME 31, NUMBER 10, OCTOBER 2008 1939 Ser1369Ala variant in ABCC8 and gliclazide hypoglycemic agent, in Chinese type 2 di- Data collection and clinical our central laboratory. The insulin secre- abetic patients. laboratory methods tion (HOMA-B) and resistance index of At the first visit (screening), a standard homeostatic model assessment (HOMA- questionnaire was administered to collect IR) were calculated according to fasting RESEARCH DESIGN AND information on medical history and med- glucose and insulin level using the METHODS — We conducted a hospi- ication, diet, exercise, and lifestyle factors HOMA2 calculator (http://www.dtu.ox. tal-based pharmacogenetic study of gli- including smoking and alcohol drinking, ac.uk/homa). clazide in type 2 diabetic patients in household income, educational level, and China between December 2003 and Au- occupation. Height, weight, waist cir- Candidate gene and SNP selection gust 2005. Patients were recruited from cumference, and blood pressure were and genotyping method 23 hospitals located in Harbin of the Hei- measured using a standard protocol. We selected 11 type 2 diabetes candidate Ͼ longjiang province, Beijing, Tianjin, and Overnight ( 10 h) fasting blood samples genes on the basis of the published liter- Hefei and Anqing of the Anhui province were collected to determine FPG, insulin, ature (see Table 2). For each gene, one to following the same study protocol. The A1C, lipid profile, liver and renal func- six nonsynonymous or haplotype-tagging 23 hospitals selected were the major hos- tion, and routine blood cell counts. All SNPs, according to the HapMap data study patients underwent a 75-g oral glu- (http://www.hapmap.org/), were se- pitals in the study regions. These hospi- cose tolerance test (OGTT) unless FPG lected. In our central laboratory, we geno- tals were all government owned but were was Ն13.0 mmol/l, and blood samples typed all 25 selected SNPs for all of the run independently. were collected after2htodetermine subjects in cohort 1, which consisted of Type 2 diabetes was diagnosed ac- plasma glucose. Diabetes education was 661 patients from 12 participating hospi- cording to American Diabetes Association also provided to all potentially eligible tals located in northern China. We further criteria (11). To reduce the clinical heter- subjects during the screening visit. The genotyped one significant nonsynony- ogeneity of type 2 diabetes, this study was education included a brief introduction mous SNP (rs757110) identified in co- limited to Han Chinese subjects with on- on type 2 diabetes, with a particular focus hort 1 for all subjects in cohort 2, which set of type 2 diabetes after the age of 35 on diet and physical exercise. In addition, consisted of 607 patients from the re- years who also met all of the following a handbook with more detailed informa- maining 11 participating hospitals lo- criteria: 1) diabetes diagnosed within the tion was given to the subjects for them to cated in southern China. The reasons for past 5 years and no antidiabetes treatment read. the two-phase genotyping were twofold: within the past 2 months, 2)BMIϽ28 All study patients returned for fol- reduce the genotyping cost and minimize kg/m2, and 3) fasting plasma glucose low-up every 2 weeks. A follow-up ques- the multiple testing problem, which (FPG) between 7.8 and 15.0 mmol/l. We tionnaire was administered to monitor could inflate type I error. excluded patients with any acute or patients’ medications, diet, exercise, and DNA was extracted from leukocytes chronic diabetes complications, unstable side effects of gliclazide. Specifically, the in peripheral blood using standard tech- angina, myocardial infarction or heart research staff documented whether the niques. Genotyping was performed by failure, chronic gastrointestinal disease or subjects complied with the treatment and TaqMan genotyping assays that were de- abnormal liver function, renal insuffi- followed the instruction for diet (with a signed and manufactured by Applied Bio- ciency, or clinical problems potentially grade of very good, fair, and poor) and systems (Foster City, CA).
Load more

Recommended publications
  • Alternating Hypoglycemia and Hyperglycemia in a Toddler with a Homozygous P.R1419H ABCC8 Mutation: an Unusual Clinical Picture
    J Pediatr Endocr Met 2015; 28(3-4): 345–351 Patient report Open Access Shira Harel, Ana S.A. Cohen, Khalid Hussain, Sarah E. Flanagan, Kamilla Schlade-Bartusiak, Millan Patel, Jaques Courtade, Jenny B.W. Li, Clara Van Karnebeek, Harley Kurata, Sian Ellard, Jean-Pierre Chanoine and William T. Gibson* Alternating hypoglycemia and hyperglycemia in a toddler with a homozygous p.R1419H ABCC8 mutation: an unusual clinical picture Abstract Results: A 16-month-old girl of consanguineous descent manifested hypoglycemia. She had dysregulation of Background: Inheritance of two pathogenic ABCC8 alleles insulin secretion, with postprandial hyperglycemia fol- typically causes severe congenital hyperinsulinism. We lowed by hypoglycemia. Microarray revealed homozygo- describe a girl and her father, both homozygous for the sity for the regions encompassing KCNJ11 and ABCC8. Her same ABCC8 mutation, who presented with unusual father had developed diabetes at 28 years of age. Sequenc- phenotypes. ing of ABCC8 identified a homozygous missense mutation, Methods: Single nucleotide polymorphism microarray p.R1419H, in both individuals. Functional studies showed and Sanger sequencing were performed. Western blot, absence of working KATP channels. rubidium efflux, and patch clamp recordings interrogated Conclusion: This is the first description of a homozygous the expression and activity of the mutant protein. p.R1419H mutation. Our findings highlight that homozy- gous loss-of-function mutations of ABCC8 do not neces- sarily translate into early-onset severe hyperinsulinemia. *Corresponding author: William T. Gibson, Child and Family Research Institute, Department of Medical Genetics, British Keywords: ABCC8; diabetes; hyperglycemia; hyperinsu- Columbia Children’s Hospital, 950 West 28th Avenue, Vancouver, linism; hypoglycemia. BC, V5Z 4H4, Canada, Phone: +1-604-875-2000 ext.
    [Show full text]
  • Genome-Wide Identification, Characterization and Phylogenetic Analysis of ATP-Binding Cassette (ABC) Transporter Genes in Common Carp (Cyprinus Carpio)
    RESEARCH ARTICLE Genome-Wide Identification, Characterization and Phylogenetic Analysis of ATP-Binding Cassette (ABC) Transporter Genes in Common Carp (Cyprinus carpio) Xiang Liu1,2☯, Shangqi Li1☯, Wenzhu Peng1, Shuaisheng Feng1, Jianxin Feng3, Shahid Mahboob4,5, Khalid A. Al-Ghanim4, Peng Xu1,6* 1 CAFS Key Laboratory of Aquatic Genomics and Beijing Key Laboratory of Fishery Biotechnology, Centre for Applied Aquatic Genomics, Chinese Academy of Fishery Sciences, Beijing, China, 2 Department of Aquaculture, College of Animal Sciences, Shanxi Agriculture University, Taigu, Shanxi, China, 3 Henan Academy of Fishery Sciences, Zhengzhou, China, 4 Department of Zoology, College of Science, King Saud University, Riyadh, Saudi Arabia, 5 Department of Zoology, GC University, Faisalabad, Pakistan, 6 College of Ocean & Earth Science, Xiamen University, Xiamen, China ☯ These authors contributed equally to this work. * [email protected] OPEN ACCESS Citation: Liu X, Li S, Peng W, Feng S, Feng J, Mahboob S, et al. (2016) Genome-Wide Identification, Characterization and Phylogenetic Abstract Analysis of ATP-Binding Cassette (ABC) Transporter Genes in Common Carp (Cyprinus carpio). PLoS The ATP-binding cassette (ABC) gene family is considered to be one of the largest gene ONE 11(4): e0153246. doi:10.1371/journal. families in all forms of prokaryotic and eukaryotic life. Although the ABC transporter genes pone.0153246 have been annotated in some species, detailed information about the ABC superfamily and Editor: Anthony M. George, University of Technology the evolutionary characterization of ABC genes in common carp (Cyprinus carpio) are still Sydney, AUSTRALIA unclear. In this research, we identified 61 ABC transporter genes in the common carp Received: January 12, 2016 genome.
    [Show full text]
  • Downloaded the “Top Edge” Version
    bioRxiv preprint doi: https://doi.org/10.1101/855338; this version posted December 6, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. 1 Drosophila models of pathogenic copy-number variant genes show global and 2 non-neuronal defects during development 3 Short title: Non-neuronal defects of fly homologs of CNV genes 4 Tanzeen Yusuff1,4, Matthew Jensen1,4, Sneha Yennawar1,4, Lucilla Pizzo1, Siddharth 5 Karthikeyan1, Dagny J. Gould1, Avik Sarker1, Yurika Matsui1,2, Janani Iyer1, Zhi-Chun Lai1,2, 6 and Santhosh Girirajan1,3* 7 8 1. Department of Biochemistry and Molecular Biology, Pennsylvania State University, 9 University Park, PA 16802 10 2. Department of Biology, Pennsylvania State University, University Park, PA 16802 11 3. Department of Anthropology, Pennsylvania State University, University Park, PA 16802 12 4 contributed equally to work 13 14 *Correspondence: 15 Santhosh Girirajan, MBBS, PhD 16 205A Life Sciences Building 17 Pennsylvania State University 18 University Park, PA 16802 19 E-mail: [email protected] 20 Phone: 814-865-0674 21 1 bioRxiv preprint doi: https://doi.org/10.1101/855338; this version posted December 6, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. 22 ABSTRACT 23 While rare pathogenic copy-number variants (CNVs) are associated with both neuronal and non- 24 neuronal phenotypes, functional studies evaluating these regions have focused on the molecular 25 basis of neuronal defects.
    [Show full text]
  • Multiethnic Genome-Wide Meta-Analysis of Ectopic Fat Depots Identifies Loci Associated with Adipocyte Development and Differentiation
    University of Texas Rio Grande Valley ScholarWorks @ UTRGV School of Medicine Publications and Presentations School of Medicine 2017 Multiethnic genome-wide meta-analysis of ectopic fat depots identifies loci associated with adipocyte development and differentiation Audrey Y. Chu Xuan Deng Virginia A. Fisher Alexander Drong Yang Zhang See next page for additional authors Follow this and additional works at: https://scholarworks.utrgv.edu/som_pub Part of the Genetic Processes Commons, and the Genetic Structures Commons Recommended Citation Chu, A., Deng, X., Fisher, V. et al. Multiethnic genome-wide meta-analysis of ectopic fat depots identifies loci associated with adipocyte development and differentiation. Nat Genet 49, 125–130 (2017). https://doi.org/10.1038/ng.3738 This Article is brought to you for free and open access by the School of Medicine at ScholarWorks @ UTRGV. It has been accepted for inclusion in School of Medicine Publications and Presentations by an authorized administrator of ScholarWorks @ UTRGV. For more information, please contact [email protected], [email protected]. Authors Audrey Y. Chu, Xuan Deng, Virginia A. Fisher, Alexander Drong, Yang Zhang, Mary F. Feitosa, Ching-Ti Liu, Olivia Weeks, Audrey C. Choh, Qing Duan, and Thomas D. Dyer This article is available at ScholarWorks @ UTRGV: https://scholarworks.utrgv.edu/som_pub/118 HHS Public Access Author manuscript Author ManuscriptAuthor Manuscript Author Nat Genet Manuscript Author . Author manuscript; Manuscript Author available in PMC 2017 August 23. Published in final edited form as: Nat Genet. 2017 January ; 49(1): 125–130. doi:10.1038/ng.3738. Multiethnic genome-wide meta-analysis of ectopic fat depots identifies loci associated with adipocyte development and differentiation A full list of authors and affiliations appears at the end of the article.
    [Show full text]
  • Intergenic Disease-Associated Regions Are Abundant in Novel Transcripts N
    Bartonicek et al. Genome Biology (2017) 18:241 DOI 10.1186/s13059-017-1363-3 RESEARCH ARTICLE Open Access Intergenic disease-associated regions are abundant in novel transcripts N. Bartonicek1,3, M. B. Clark1,2, X. C. Quek1,3, J. R. Torpy1,3, A. L. Pritchard4, J. L. V. Maag1,3, B. S. Gloss1,3, J. Crawford5, R. J. Taft5,6, N. K. Hayward4, G. W. Montgomery5, J. S. Mattick1,3, T. R. Mercer1,3,7 and M. E. Dinger1,3* Abstract Background: Genotyping of large populations through genome-wide association studies (GWAS) has successfully identified many genomic variants associated with traits or disease risk. Unexpectedly, a large proportion of GWAS single nucleotide polymorphisms (SNPs) and associated haplotype blocks are in intronic and intergenic regions, hindering their functional evaluation. While some of these risk-susceptibility regions encompass cis-regulatory sites, their transcriptional potential has never been systematically explored. Results: To detect rare tissue-specific expression, we employed the transcript-enrichment method CaptureSeq on 21 human tissues to identify 1775 multi-exonic transcripts from 561 intronic and intergenic haploblocks associated with 392 traits and diseases, covering 73.9 Mb (2.2%) of the human genome. We show that a large proportion (85%) of disease-associated haploblocks express novel multi-exonic non-coding transcripts that are tissue-specific and enriched for GWAS SNPs as well as epigenetic markers of active transcription and enhancer activity. Similarly, we captured transcriptomes from 13 melanomas, targeting nine melanoma-associated haploblocks, and characterized 31 novel melanoma-specific transcripts that include fusion proteins, novel exons and non-coding RNAs, one-third of which showed allelically imbalanced expression.
    [Show full text]
  • Transcriptional and Post-Transcriptional Regulation of ATP-Binding Cassette Transporter Expression
    Transcriptional and Post-transcriptional Regulation of ATP-binding Cassette Transporter Expression by Aparna Chhibber DISSERTATION Submitted in partial satisfaction of the requirements for the degree of DOCTOR OF PHILOSOPHY in Pharmaceutical Sciences and Pbarmacogenomies in the Copyright 2014 by Aparna Chhibber ii Acknowledgements First and foremost, I would like to thank my advisor, Dr. Deanna Kroetz. More than just a research advisor, Deanna has clearly made it a priority to guide her students to become better scientists, and I am grateful for the countless hours she has spent editing papers, developing presentations, discussing research, and so much more. I would not have made it this far without her support and guidance. My thesis committee has provided valuable advice through the years. Dr. Nadav Ahituv in particular has been a source of support from my first year in the graduate program as my academic advisor, qualifying exam committee chair, and finally thesis committee member. Dr. Kathy Giacomini graciously stepped in as a member of my thesis committee in my 3rd year, and Dr. Steven Brenner provided valuable input as thesis committee member in my 2nd year. My labmates over the past five years have been incredible colleagues and friends. Dr. Svetlana Markova first welcomed me into the lab and taught me numerous laboratory techniques, and has always been willing to act as a sounding board. Michael Martin has been my partner-in-crime in the lab from the beginning, and has made my days in lab fly by. Dr. Yingmei Lui has made the lab run smoothly, and has always been willing to jump in to help me at a moment’s notice.
    [Show full text]
  • CFTR Modulators: Shedding Light on Precision Medicine for Cystic Fibrosis
    fphar-07-00275 September 1, 2016 Time: 16:39 # 1 REVIEW published: 05 September 2016 doi: 10.3389/fphar.2016.00275 CFTR Modulators: Shedding Light on Precision Medicine for Cystic Fibrosis Miquéias Lopes-Pacheco* Institute of Biophysics Carlos Chagas Filho, Federal University of Rio de Janeiro, Rio de Janeiro, Brazil Cystic fibrosis (CF) is the most common life-threatening monogenic disease afflicting Caucasian people. It affects the respiratory, gastrointestinal, glandular and reproductive systems. The major cause of morbidity and mortality in CF is the respiratory disorder caused by a vicious cycle of obstruction of the airways, inflammation and infection that leads to epithelial damage, tissue remodeling and end-stage lung disease. Over the past decades, life expectancy of CF patients has increased due to early diagnosis and improved treatments; however, these patients still present limited quality of life. Many attempts have been made to rescue CF transmembrane conductance regulator (CFTR) expression, function and stability, thereby overcoming the molecular basis of CF. Edited by: Gene and protein variances caused by CFTR mutants lead to different CF phenotypes, Frederic Becq, University of Poitiers, France which then require different treatments to quell the patients’ debilitating symptoms. In Reviewed by: order to seek better approaches to treat CF patients and maximize therapeutic effects, Valerie Chappe, CFTR mutants have been stratified into six groups (although several of these mutations Dalhousie University, Canada Paola Vergani, present pleiotropic defects). The research with CFTR modulators (read-through agents, University College London, UK correctors, potentiators, stabilizers and amplifiers) has achieved remarkable progress, *Correspondence: and these drugs are translating into pharmaceuticals and personalized treatments for Miquéias Lopes-Pacheco CF patients.
    [Show full text]
  • ENSA Antibody A
    Revision 1 C 0 2 - t ENSA Antibody a e r o t S Orders: 877-616-CELL (2355) [email protected] Support: 877-678-TECH (8324) 0 7 Web: [email protected] 7 www.cellsignal.com 8 # 3 Trask Lane Danvers Massachusetts 01923 USA For Research Use Only. Not For Use In Diagnostic Procedures. Applications: Reactivity: Sensitivity: MW (kDa): Source: UniProt ID: Entrez-Gene Id: WB H Mk Endogenous 15 Rabbit O43768 2029 Product Usage Information 3. Yu, J. et al. (2004) J Cell Biol 164, 487-92. 4. Voets, E. and Wolthuis, R.M. (2010) Cell Cycle 9, 3591-601. Application Dilution 5. Blake-Hodek, K.A. et al. (2012) Mol Cell Biol 32, 1337-53. 6. Vigneron, S. et al. (2011) Mol Cell Biol 31, 2262-75. Western Blotting 1:1000 7. Lorca, T. and Castro, A. (2012) Oncogene 32, 537-543. Storage Supplied in 10 mM sodium HEPES (pH 7.5), 150 mM NaCl, 100 µg/ml BSA and 50% glycerol. Store at –20°C. Do not aliquot the antibody. Specificity / Sensitivity ENSA Antibody recognizes endogenous levels of total ENSA protein. Species Reactivity: Human, Monkey Species predicted to react based on 100% sequence homology: Mouse, Rat Source / Purification Polyclonal antibodies are produced by immunizing animals with a synthetic peptide corresponding to residues near the carboxy terminus of human ENSA protein. Antibodies are purified by protein A and peptide affinity chromatography. Background Mitotic control is important for normal growth, development, and maintenance of all eukaryotic cells. Research studies have demonstrated that inappropriate control of mitosis can lead to genomic instability and cancer (reviewed in 1,2).
    [Show full text]
  • ENSA (NM 207042) Human Tagged ORF Clone Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC220441 ENSA (NM_207042) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: ENSA (NM_207042) Human Tagged ORF Clone Tag: Myc-DDK Symbol: ENSA Synonyms: ARPP-19e Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC220441 representing NM_207042 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCCCAGAAACAAGAAGAAGAGAACCCTGCGGAGGAGACCGGCGAGGAGAAGCAGGACACGCAGGAGA AAGAAGGTATTCTGCCTGAGAGAGCTGAAGAGGCAAAGCTAAAGGCCAAATACCCAAGCCTAGGACAAAA GCCTGGAGGCTCCGACTTCCTCATGAAGAGACTCCAGAAAGGGGATTATAAATCATTACATTGGAGTGTG CTTCTCTGTGCGGATGAAATGCAAAAGTACTTTGACTCAGGAGACTACAACATGGCCAAAGCCAAGATGA AGAATAAGCAGCTGCCAAGTGCAGGACCAGACAAGAACCTGGTGACTGGTGATCACATCCCCACCCCACA GGATCTGCCCCAGAGAAAGTCCTCGCTCGTCACCAGCAAGCTTGCGGGTGGCCAAGTTGAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC220441 representing NM_207042 Red=Cloning site Green=Tags(s) MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGDYKSLHWSV LLCADEMQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE myc-FLAG tag Chromatograms: https://cdn.origene.com/chromatograms/mg3846_g05.zip Restriction Sites: SgfI-MluI This product is
    [Show full text]
  • Interindividual Differences in the Expression of ATP-Binding
    Supplemental material to this article can be found at: http://dmd.aspetjournals.org/content/suppl/2018/02/02/dmd.117.079061.DC1 1521-009X/46/5/628–635$35.00 https://doi.org/10.1124/dmd.117.079061 DRUG METABOLISM AND DISPOSITION Drug Metab Dispos 46:628–635, May 2018 Copyright ª 2018 by The American Society for Pharmacology and Experimental Therapeutics Special Section on Transporters in Drug Disposition and Pharmacokinetic Prediction Interindividual Differences in the Expression of ATP-Binding Cassette and Solute Carrier Family Transporters in Human Skin: DNA Methylation Regulates Transcriptional Activity of the Human ABCC3 Gene s Tomoki Takechi, Takeshi Hirota, Tatsuya Sakai, Natsumi Maeda, Daisuke Kobayashi, and Ichiro Ieiri Downloaded from Department of Clinical Pharmacokinetics, Graduate School of Pharmaceutical Sciences, Kyushu University, Fukuoka, Japan (T.T., T.H., T.S., N.M., I.I.); Drug Development Research Laboratories, Kyoto R&D Center, Maruho Co., Ltd., Kyoto, Japan (T.T.); and Department of Clinical Pharmacy and Pharmaceutical Care, Graduate School of Pharmaceutical Sciences, Kyushu University, Fukuoka, Japan (D.K.) Received October 19, 2017; accepted January 30, 2018 dmd.aspetjournals.org ABSTRACT The identification of drug transporters expressed in human skin and levels. ABCC3 expression levels negatively correlated with the methylation interindividual differences in gene expression is important for understanding status of the CpG island (CGI) located approximately 10 kilobase pairs the role of drug transporters in human skin. In the present study, we upstream of ABCC3 (Rs: 20.323, P < 0.05). The reporter gene assay revealed evaluated the expression of ATP-binding cassette (ABC) and solute carrier a significant increase in transcriptional activity in the presence of CGI.
    [Show full text]
  • Whole-Exome Sequencing Identifies Novel Mutations in ABC Transporter
    Liu et al. BMC Pregnancy and Childbirth (2021) 21:110 https://doi.org/10.1186/s12884-021-03595-x RESEARCH ARTICLE Open Access Whole-exome sequencing identifies novel mutations in ABC transporter genes associated with intrahepatic cholestasis of pregnancy disease: a case-control study Xianxian Liu1,2†, Hua Lai1,3†, Siming Xin1,3, Zengming Li1, Xiaoming Zeng1,3, Liju Nie1,3, Zhengyi Liang1,3, Meiling Wu1,3, Jiusheng Zheng1,3* and Yang Zou1,2* Abstract Background: Intrahepatic cholestasis of pregnancy (ICP) can cause premature delivery and stillbirth. Previous studies have reported that mutations in ABC transporter genes strongly influence the transport of bile salts. However, to date, their effects are still largely elusive. Methods: A whole-exome sequencing (WES) approach was used to detect novel variants. Rare novel exonic variants (minor allele frequencies: MAF < 1%) were analyzed. Three web-available tools, namely, SIFT, Mutation Taster and FATHMM, were used to predict protein damage. Protein structure modeling and comparisons between reference and modified protein structures were performed by SWISS-MODEL and Chimera 1.14rc, respectively. Results: We detected a total of 2953 mutations in 44 ABC family transporter genes. When the MAF of loci was controlled in all databases at less than 0.01, 320 mutations were reserved for further analysis. Among these mutations, 42 were novel. We classified these loci into four groups (the damaging, probably damaging, possibly damaging, and neutral groups) according to the prediction results, of which 7 novel possible pathogenic mutations were identified that were located in known functional genes, including ABCB4 (Trp708Ter, Gly527Glu and Lys386Glu), ABCB11 (Gln1194Ter, Gln605Pro and Leu589Met) and ABCC2 (Ser1342Tyr), in the damaging group.
    [Show full text]
  • 1. Introduction
    PROTEIN INTERACTIONS AND DISEASE PHENOTYPES IN THE ABC TRANSPORTER SUPERFAMILY LIBUSHA KELLY1,2,3,!, RACHEL KARCHIN2, 3 AND ANDREJ SALI2, 3 1Program in Biological and Medical Informatics, 2Departments of Biopharmaceutical Sciences and Pharmaceutical Chemistry, and 3California Institute for Quantitative Biomedical Research, University of California at San Francisco QB3 at Mission Bay, Office 503B, 1700 4th Street, San Francisco, CA 94158, USA. ABC transporter proteins couple the energy of ATP binding and hydrolysis to substrate transport across a membrane. In humans, clinical studies have implicated mutations in 19 of the 48 known ABC transporters in diseases such as cystic fibrosis and adrenoleukodystrophy. Although divergent in sequence space, the overall topology of these proteins, consisting of two transmembrane domains and two ATP-binding cassettes, is likely to be conserved across diverse organisms. We examine known intra-transporter domain interfaces using crystallographic structures of isolated and complexed domains in ABC transporter proteins and find that the nucleotide binding domain interfaces are better conserved than interfaces at the transmembrane domains. We then apply this analysis to identify known disease-associated point and deletion mutants for which disruption of domain-domain interfaces might indicate the mechanism of disease. Finally, we suggest a possible interaction site based on conservation of sequence and disease-association of point mutants. 1. Introduction ATP-binding cassette (ABC) transporters are membrane-spanning proteins that transport a wide variety of small molecule substrates and ions across cell membranes. Examples include the multidrug transporter P-gp, associated with drug resistance phenotypes in cancer therapy [1], and the cystic fibrosis transmembrane conductance regulator (CFTR) that transports chloride ions [2].
    [Show full text]