Endosulfine in Diabetic Nephropathy

Total Page:16

File Type:pdf, Size:1020Kb

Endosulfine in Diabetic Nephropathy 17 ␣-Endosulfine in Diabetic Nephropathy Jerry Yee, MD, and Balazs Szamosfalvi, MD CONTENTS EFFECTS OF SULFONYLUREAS ON CULTURED MESANGIAL CELLS SULFONYLUREA AGENTS REGULATE MESANGIAL ATP-SENSITIVE K CHANNELS KIDNEY SUR NDOGENOUS IGANDS E KAT P L α NDOSULFINE EGULATION OF -E R KAT P GLOMERULAR EFFECTS OF SULF IN INSULIN-DEFICIENT DIABETES MELLITUS α-ENDOSULFINE EXPRESSION ALTERS MATRIX METABOLISM CONCLUSIONS REFERENCES EFFECTS OF SULFONYLUREAS ON CULTURED MESANGIAL CELLS The sulfonylureas (SULF) have long been utilized as oral agents in the treatment of type 2 diabetes mellitus (1). The primary effect of SULF is the stimulation of insulin secretion following binding to specific SULF receptors (SUR) on pancreatic β-cells. However, SUR have extensive representation in a multitude of extrapancreatic tissues. Therefore, it is not unanticipated that SULF may induce metabolic changes aside from that of insulin secretion. These drugs have been shown to increase glucose uptake and glucose transporter (GLUT) expression in myocytes, adipocytes, and skeletal muscle cells (2–5). Moreover, we have documented significant SULF-induced metabolic effects in cultured rat mesangial cells (MCs), including alterations in mesangial matrix metabolism and MC contractility, independent of their effect on the ambient level of glycemia. The latter effect mimicked that provided by other known MC effectors of contractility, for example, atrial natriuretic peptide and angiotensin II. In short-term (acute) experiments of rat MC, the exposure to a first-generation SULF, tolazamide (1.5 mM), augmented mesangial glucose uptake. This effect was attributed to an elevated rate of cytosol-to-membrane translocation of GLUT1. This direct effect subsequently stimulated MC extracellular matrix (ECM) synthesis, driven by transforming β growth factor (TGF)- 1, which was demonstrated to accumulate in the conditioned From: Contemporary Diabetes: The Diabetic Kidney Edited by: P. Cortes and C. E. Mogensen © Humana Press Inc., Totowa, NJ 305 306 Yee and Szamosfalvi media (6). By contrast, chronic exposure of MC to glibenclamide (10 nM), a more potent, second-generation SULF, did not enhance MC glucose uptake, yet produced an intense inhibition of high glucose concentration-induced ECM accumulation (7). Taken collectively, SULF, in addition to their action as insulin secretagogues, exert important metabolic changes through affecting MC matrix metabolism to the extent that the devel- opment and evolution of diabetic glomerulosclerosis may be altered by them. Furthermore, it is highly probable that the aforementioned effects are mediated via membrane-bound and/or intracellular SUR. SULFONYLUREA AGENTS REGULATE MESANGIAL ATP-SENSITIVE K CHANNELS Several SUR have been identified and cloned from diverse species and tissues (8–10). SUR provide the regulatory subunits of adenosine triphosphate (ATP)-sensitive K channels (KAT P ). Classical KAT P consist of two subunits, a potassium ion pore and a SUR. These structurally unrelated subunits complex as four heterodimers to comprise a single functional KAT P . The ion pore belongs to the Kir6.x subfamily of weak inwardly rectifying K+ channels and is represented as either Kir6.1 or Kir6.2. SUR are members of the cystic fibrosis transmembrane regulator/multidrug resistance protein subfamily of the ATP-binding cassette protein (ABC) superfamily (11,12). The pancreatic β-cell SUR is a high-affinity receptor and is designated SUR1. This SUR is encoded by the gene ABCC8, whereas SUR2, the lower affinity receptor, is encoded by the gene ABCC9. The heterogeneous properties and functional diversity of KAT P are based on differing complexations of Kir6.x and SUR isoforms and cellular distribution. Nearly 90% of KAT P are not localized to the plasmalemma, but to endoplasmic reticulum, mitochondria, and secretory granules (13–16). Consequently, nearly 70% of all SULF binding is cytosolic (17), and this intracellular site of action for KAT P represents an important determinant of SULF action. For example, in β-cells, chronic glibenclamide exposure induces translo- cation of membranous SUR to the cytoplasm, thereby reducing insulin secretion (18). β Consistent with the above, the SULF binding site of the -cell KAT P is on its cytosolic aspect (19). These observations reconcile the greater potency of the more highly lipophilic SULF compounds: they more easily permeate the plasma membrane and have greater affinity for SUR (20,21). Overall, regardless of their location, all SUR ligands act intra- cellularly, consequently, candidate endogenous SUR ligands would be anticipated to exert their effects intracellularly as well. Although K were first described in cardiac myocytes, the membrane-bound pancreatic β AT P -cell KAT P , a tetradimer of SUR1/Kir6.2, represents the most extensively studied of these channels, and it is regarded as the “classical” KAT P (22,23). In the functional channel, Kir6.2 confers KAT P inhibition by ATP, whereas SUR increases pore sensitivity to ATP and regulates channel activation by magnesium-bound adenosine diphosphate (MgADP) and closure by SULF (24,25). Finally, SUR respond variably to KAT P channel openers (KCO), for example, diazoxide, cromakalim, or pinacidil. The prevailing axiom defines KAT P as molecular switches that link the cell’s metabolic state to calcium-dependent signaling (26). In the β-cell, SULF and/or elevations of the cytosolic ATP/adenosine diphosphate (ADP) ratio inhibit KAT P leading to a chain of events: channel closure, membrane depolarization, Ca2+ influx, and insulin secretion (25). The opposite series of events are observed with declines in the cytosolic ATP/ADP ratio or after exposure to KCO. Currently, the roles of KAT P are broadening with recent α-Endosulfine in Diabetic Nephropathy 307 evidence reinforcing the diversity of KAT P and the void of knowledge regarding their functions (9,10,27). SUR2 is the more ubiquitous extrapancreatic KAT P subunit, and it is found as two major low-affinity splice variants, SUR2A and SUR2B. These isoforms respectively reconstitute the cardiac-type KAT P (SUR2A/Kir6.2), predominantly found in heart and skeletal muscle, and the more ubiquitous vascular smooth muscle-type KAT P (SUR2B/Kir6.1 or Kir6.2) found in brain, heart, liver, kidney, intestine, bladder, vascular smooth muscle, and uterus (9,10,28–30). KAT P , in these tissues regulate a myriad functions, including cell survival, differentiation, and responses to ischemic injury, neurotransmitter release, and vascular smooth muscle cell contraction. The latter has been extensively studied in coronary vessels where KAT P control arteriolar tone (31,32). Not unexpectedly, pharmacological evaluations have also documented the diversity of KAT P among various tissues, with respect to their SULF affinities and sensitivity to KCO (33). Finally, an intact system of actin filaments is critical to extrapancreatic KAT P activity (34–37). Disruption of filamentous actin reduces the sensitivity of cardiac and smooth muscle KAT P for ATP, SULF, and presumably, for any endogenous SUR ligand(s). In the context of diabetic kidney disease, the dependence of KAT P on normal actin assembly becomes highly relevant because high-glucose concentrations induce MC actin fiber disassembly (38). Finally, the discrete localization and control of protein kinase A (PKA) requires actin cytoskeleton targeting by specific proteins, for example, gravin and Wiskott- Aldrich syndrome protein (WAVE), that dually anchor actin and PKA (39). KIDNEY SUR The SUR2B splice variant is widely expressed in the kidney, including the distal nephron where it presumably mediates, in part, potassium transport (40). However, in the proximal tubule, the combination of Kir6.1 with SUR2A and/or SUR2B forms a taurine-sensitive KAT P (41). SUR2B may also couple to murine ROMK2, a Kir that resides in the cortical ascending limb and cortical collecting duct of the distal nephron (42). We hypothesized that the observed MC effects of SULF agents were mediated by specific MC KAT P channels. Subsequently, using membrane preparations from rat MC, we demonstrated specific [3H]glibenclamide binding to low-affinity SUR (8). A func- tional KAT P was subsequently demonstrated in MC. Cultured cells, following a single exposure to glibenclamide (5 μM), initiated prolonged cycles of oscillatory cytoplas- mic Ca2+ transients that were coupled to the enhancement of MC contractility (8). These observations were in alignment with results of other investigators who demon- strated similar Ca2+ oscillations in MC exposed to angiotensin II. We subsequently cloned two SUR2 cDNAs from rat MC, a 6.7 kbp smooth muscle- type rSUR2B that had been previously described and a unique 4.8 kbp serum-regulatable MC-specific splice variant, mcSUR2B. This variant was homologous, in large part, with the larger splice variant, rSUR2B. Our findings additionally revealed expression of Kir 6.1 but not of Kir6.2 in MC (43). These studies suggest that the KAT P of MC and also of isolated glomeruli are comprised of (rSUR2B/Kir6.1)4 and possibly, (mcSUR2B/Kir6.1)4 (8,43). In this context, the marked inhibition of established high-glucose concentration- fostered ECM accumulation by glibenclamide at 10 nM is a highly relevant observation because the experimental concentrations are within the clinically relevant range for this compound (peak plasma concentration: 50–60 nM after a 5-mg dose) (44). In addition, 308 Yee and Szamosfalvi the KD of 6 nM for glibenclamide, as determined by complexation of SUR2B to Kir6.1 in intact cells, is consonant with this hypothesis (45). Finally, immunoreactivity for rSUR2B and mcSUR2 in primary and cloned MC (16KC2) lines as delineated by a spe- cific antibody directed against the common C-terminal epitope of SUR2A and SUR2B further substantiates this argument (43). Thus, it is plausible that the metabolic actions of low-concentration glibenclamide on MC are mediated through KAT P comprised of SUR2B/Kir6.1. ENDOGENOUS KATP LIGANDS β The central role that pancreatic -cell KAT P (SUR1/Kir6.2)4 plays in regulating insulin secretion and the ubiquitous nature of the SUR2-based KAT P led to a search for endogenous ligand(s) of these channels.
Recommended publications
  • Downloaded the “Top Edge” Version
    bioRxiv preprint doi: https://doi.org/10.1101/855338; this version posted December 6, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. 1 Drosophila models of pathogenic copy-number variant genes show global and 2 non-neuronal defects during development 3 Short title: Non-neuronal defects of fly homologs of CNV genes 4 Tanzeen Yusuff1,4, Matthew Jensen1,4, Sneha Yennawar1,4, Lucilla Pizzo1, Siddharth 5 Karthikeyan1, Dagny J. Gould1, Avik Sarker1, Yurika Matsui1,2, Janani Iyer1, Zhi-Chun Lai1,2, 6 and Santhosh Girirajan1,3* 7 8 1. Department of Biochemistry and Molecular Biology, Pennsylvania State University, 9 University Park, PA 16802 10 2. Department of Biology, Pennsylvania State University, University Park, PA 16802 11 3. Department of Anthropology, Pennsylvania State University, University Park, PA 16802 12 4 contributed equally to work 13 14 *Correspondence: 15 Santhosh Girirajan, MBBS, PhD 16 205A Life Sciences Building 17 Pennsylvania State University 18 University Park, PA 16802 19 E-mail: [email protected] 20 Phone: 814-865-0674 21 1 bioRxiv preprint doi: https://doi.org/10.1101/855338; this version posted December 6, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. 22 ABSTRACT 23 While rare pathogenic copy-number variants (CNVs) are associated with both neuronal and non- 24 neuronal phenotypes, functional studies evaluating these regions have focused on the molecular 25 basis of neuronal defects.
    [Show full text]
  • Multiethnic Genome-Wide Meta-Analysis of Ectopic Fat Depots Identifies Loci Associated with Adipocyte Development and Differentiation
    University of Texas Rio Grande Valley ScholarWorks @ UTRGV School of Medicine Publications and Presentations School of Medicine 2017 Multiethnic genome-wide meta-analysis of ectopic fat depots identifies loci associated with adipocyte development and differentiation Audrey Y. Chu Xuan Deng Virginia A. Fisher Alexander Drong Yang Zhang See next page for additional authors Follow this and additional works at: https://scholarworks.utrgv.edu/som_pub Part of the Genetic Processes Commons, and the Genetic Structures Commons Recommended Citation Chu, A., Deng, X., Fisher, V. et al. Multiethnic genome-wide meta-analysis of ectopic fat depots identifies loci associated with adipocyte development and differentiation. Nat Genet 49, 125–130 (2017). https://doi.org/10.1038/ng.3738 This Article is brought to you for free and open access by the School of Medicine at ScholarWorks @ UTRGV. It has been accepted for inclusion in School of Medicine Publications and Presentations by an authorized administrator of ScholarWorks @ UTRGV. For more information, please contact [email protected], [email protected]. Authors Audrey Y. Chu, Xuan Deng, Virginia A. Fisher, Alexander Drong, Yang Zhang, Mary F. Feitosa, Ching-Ti Liu, Olivia Weeks, Audrey C. Choh, Qing Duan, and Thomas D. Dyer This article is available at ScholarWorks @ UTRGV: https://scholarworks.utrgv.edu/som_pub/118 HHS Public Access Author manuscript Author ManuscriptAuthor Manuscript Author Nat Genet Manuscript Author . Author manuscript; Manuscript Author available in PMC 2017 August 23. Published in final edited form as: Nat Genet. 2017 January ; 49(1): 125–130. doi:10.1038/ng.3738. Multiethnic genome-wide meta-analysis of ectopic fat depots identifies loci associated with adipocyte development and differentiation A full list of authors and affiliations appears at the end of the article.
    [Show full text]
  • Intergenic Disease-Associated Regions Are Abundant in Novel Transcripts N
    Bartonicek et al. Genome Biology (2017) 18:241 DOI 10.1186/s13059-017-1363-3 RESEARCH ARTICLE Open Access Intergenic disease-associated regions are abundant in novel transcripts N. Bartonicek1,3, M. B. Clark1,2, X. C. Quek1,3, J. R. Torpy1,3, A. L. Pritchard4, J. L. V. Maag1,3, B. S. Gloss1,3, J. Crawford5, R. J. Taft5,6, N. K. Hayward4, G. W. Montgomery5, J. S. Mattick1,3, T. R. Mercer1,3,7 and M. E. Dinger1,3* Abstract Background: Genotyping of large populations through genome-wide association studies (GWAS) has successfully identified many genomic variants associated with traits or disease risk. Unexpectedly, a large proportion of GWAS single nucleotide polymorphisms (SNPs) and associated haplotype blocks are in intronic and intergenic regions, hindering their functional evaluation. While some of these risk-susceptibility regions encompass cis-regulatory sites, their transcriptional potential has never been systematically explored. Results: To detect rare tissue-specific expression, we employed the transcript-enrichment method CaptureSeq on 21 human tissues to identify 1775 multi-exonic transcripts from 561 intronic and intergenic haploblocks associated with 392 traits and diseases, covering 73.9 Mb (2.2%) of the human genome. We show that a large proportion (85%) of disease-associated haploblocks express novel multi-exonic non-coding transcripts that are tissue-specific and enriched for GWAS SNPs as well as epigenetic markers of active transcription and enhancer activity. Similarly, we captured transcriptomes from 13 melanomas, targeting nine melanoma-associated haploblocks, and characterized 31 novel melanoma-specific transcripts that include fusion proteins, novel exons and non-coding RNAs, one-third of which showed allelically imbalanced expression.
    [Show full text]
  • ENSA Antibody A
    Revision 1 C 0 2 - t ENSA Antibody a e r o t S Orders: 877-616-CELL (2355) [email protected] Support: 877-678-TECH (8324) 0 7 Web: [email protected] 7 www.cellsignal.com 8 # 3 Trask Lane Danvers Massachusetts 01923 USA For Research Use Only. Not For Use In Diagnostic Procedures. Applications: Reactivity: Sensitivity: MW (kDa): Source: UniProt ID: Entrez-Gene Id: WB H Mk Endogenous 15 Rabbit O43768 2029 Product Usage Information 3. Yu, J. et al. (2004) J Cell Biol 164, 487-92. 4. Voets, E. and Wolthuis, R.M. (2010) Cell Cycle 9, 3591-601. Application Dilution 5. Blake-Hodek, K.A. et al. (2012) Mol Cell Biol 32, 1337-53. 6. Vigneron, S. et al. (2011) Mol Cell Biol 31, 2262-75. Western Blotting 1:1000 7. Lorca, T. and Castro, A. (2012) Oncogene 32, 537-543. Storage Supplied in 10 mM sodium HEPES (pH 7.5), 150 mM NaCl, 100 µg/ml BSA and 50% glycerol. Store at –20°C. Do not aliquot the antibody. Specificity / Sensitivity ENSA Antibody recognizes endogenous levels of total ENSA protein. Species Reactivity: Human, Monkey Species predicted to react based on 100% sequence homology: Mouse, Rat Source / Purification Polyclonal antibodies are produced by immunizing animals with a synthetic peptide corresponding to residues near the carboxy terminus of human ENSA protein. Antibodies are purified by protein A and peptide affinity chromatography. Background Mitotic control is important for normal growth, development, and maintenance of all eukaryotic cells. Research studies have demonstrated that inappropriate control of mitosis can lead to genomic instability and cancer (reviewed in 1,2).
    [Show full text]
  • ENSA (NM 207042) Human Tagged ORF Clone Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC220441 ENSA (NM_207042) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: ENSA (NM_207042) Human Tagged ORF Clone Tag: Myc-DDK Symbol: ENSA Synonyms: ARPP-19e Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC220441 representing NM_207042 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCCCAGAAACAAGAAGAAGAGAACCCTGCGGAGGAGACCGGCGAGGAGAAGCAGGACACGCAGGAGA AAGAAGGTATTCTGCCTGAGAGAGCTGAAGAGGCAAAGCTAAAGGCCAAATACCCAAGCCTAGGACAAAA GCCTGGAGGCTCCGACTTCCTCATGAAGAGACTCCAGAAAGGGGATTATAAATCATTACATTGGAGTGTG CTTCTCTGTGCGGATGAAATGCAAAAGTACTTTGACTCAGGAGACTACAACATGGCCAAAGCCAAGATGA AGAATAAGCAGCTGCCAAGTGCAGGACCAGACAAGAACCTGGTGACTGGTGATCACATCCCCACCCCACA GGATCTGCCCCAGAGAAAGTCCTCGCTCGTCACCAGCAAGCTTGCGGGTGGCCAAGTTGAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC220441 representing NM_207042 Red=Cloning site Green=Tags(s) MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGDYKSLHWSV LLCADEMQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE myc-FLAG tag Chromatograms: https://cdn.origene.com/chromatograms/mg3846_g05.zip Restriction Sites: SgfI-MluI This product is
    [Show full text]
  • Genetics of Lipedema: New Perspectives on Genetic Research and Molecular Diagnoses S
    European Review for Medical and Pharmacological Sciences 2019; 23: 5581-5594 Genetics of lipedema: new perspectives on genetic research and molecular diagnoses S. PAOLACCI1, V. PRECONE2, F. ACQUAVIVA3, P. CHIURAZZI4,5, E. FULCHERI6,7, M. PINELLI3,8, F. BUFFELLI9,10, S. MICHELINI11, K.L. HERBST12, V. UNFER13, M. BERTELLI2; GENEOB PROJECT 1MAGI’S LAB, Rovereto (TN), Italy 2MAGI EUREGIO, Bolzano, Italy 3Department of Translational Medicine, Section of Pediatrics, Federico II University, Naples, Italy 4Istituto di Medicina Genomica, Fondazione A. Gemelli, Università Cattolica del Sacro Cuore, Rome, Italy 5UOC Genetica Medica, Fondazione Policlinico Universitario “A. Gemelli” IRCCS, Rome, Italy 6Fetal and Perinatal Pathology Unit, IRCCS Istituto Giannina Gaslini, Genoa, Italy 7Department of Integrated Surgical and Diagnostic Sciences, University of Genoa, Genoa, Italy 8Telethon Institute of Genetics and Medicine (TIGEM), Pozzuoli, Italy 9Fetal and Perinatal Pathology Unit, IRCCS Istituto Giannina Gaslini, Genoa, Italy 10Department of Neuroscience, Rehabilitation, Ophthalmology, Genetics and Maternal-Infantile Sciences, University of Genoa, Genoa, Italy 11Department of Vascular Rehabilitation, San Giovanni Battista Hospital, Rome, Italy 12Department of Medicine, University of Arizona, Tucson, AZ, USA 13Department of Developmental and Social Psychology, Faculty of Medicine and Psychology, Sapienza University of Rome, Rome, Italy Abstract. – OBJECTIVE: The aim of this quali- Introduction tative review is to provide an update on the cur- rent understanding of the genetic determinants of lipedema and to develop a genetic test to dif- Lipedema is an underdiagnosed chronic debil- ferentiate lipedema from other diagnoses. itating disease characterized by bruising and pain MATERIALS AND METHODS: An electronic and excess of subcutaneous adipose tissue of the search was conducted in MEDLINE, PubMed, and legs and/or arms in women during or after times Scopus for articles published in English up to of hormone change, especially in puberty1.
    [Show full text]
  • ENSA/ARPP19-PP2A Is Targeted by Camp/PKA and Cgmp/PKG in Anucleate Human Platelets
    cells Article The Cell Cycle Checkpoint System MAST(L)- ENSA/ARPP19-PP2A is Targeted by cAMP/PKA and cGMP/PKG in Anucleate Human Platelets Elena J. Kumm 1, Oliver Pagel 2, Stepan Gambaryan 1,3, Ulrich Walter 1 , René P. Zahedi 2,4, Albert Smolenski 5 and Kerstin Jurk 1,* 1 Center for Thrombosis and Hemostasis (CTH), University Medical Center of the Johannes Gutenberg-University Mainz, 55131 Mainz, Germany; [email protected] (E.J.K.); [email protected] (S.G.); [email protected] (U.W.) 2 Leibniz-Institut für Analytische Wissenschaften—ISAS—e.V., 44227 Dortmund, Germany; [email protected] (O.P.); [email protected] (R.P.Z.) 3 Sechenov Institute of Evolutionary Physiology and Biochemistry, Russian Academy of Sciences, St. Petersburg 194223, Russia 4 Proteomics Centre, Lady Davis Institute, Jewish General Hospital, Montréal, QC H3T1E2, Canada 5 UCD Conway Institute, UCD School of Medicine and Medical Science, University College Dublin, D04 V1W8 Dublin, Ireland; [email protected] * Correspondence: [email protected]; Tel.: +49-6131-17-8278 Received: 23 January 2020; Accepted: 14 February 2020; Published: 18 February 2020 Abstract: The cell cycle is controlled by microtubule-associated serine/threonine kinase-like (MASTL), which phosphorylates the cAMP-regulated phosphoproteins 19 (ARPP19) at S62 and 19e/α-endosulfine (ENSA) at S67and converts them into protein phosphatase 2A (PP2A) inhibitors. Based on initial proteomic data, we hypothesized that the MASTL-ENSA/ARPP19-PP2A pathway, unknown until now in platelets, is regulated and functional in these anucleate cells. We detected ENSA, ARPP19 and various PP2A subunits (including seven different PP2A B-subunits) in proteomic studies of human platelets.
    [Show full text]
  • Renoprotective Effect of Combined Inhibition of Angiotensin-Converting Enzyme and Histone Deacetylase
    BASIC RESEARCH www.jasn.org Renoprotective Effect of Combined Inhibition of Angiotensin-Converting Enzyme and Histone Deacetylase † ‡ Yifei Zhong,* Edward Y. Chen, § Ruijie Liu,*¶ Peter Y. Chuang,* Sandeep K. Mallipattu,* ‡ ‡ † | ‡ Christopher M. Tan, § Neil R. Clark, § Yueyi Deng, Paul E. Klotman, Avi Ma’ayan, § and ‡ John Cijiang He* ¶ *Department of Medicine, Mount Sinai School of Medicine, New York, New York; †Department of Nephrology, Longhua Hospital, Shanghai University of Traditional Chinese Medicine, Shanghai, China; ‡Department of Pharmacology and Systems Therapeutics and §Systems Biology Center New York, Mount Sinai School of Medicine, New York, New York; |Baylor College of Medicine, Houston, Texas; and ¶Renal Section, James J. Peters Veterans Affairs Medical Center, New York, New York ABSTRACT The Connectivity Map database contains microarray signatures of gene expression derived from approximately 6000 experiments that examined the effects of approximately 1300 single drugs on several human cancer cell lines. We used these data to prioritize pairs of drugs expected to reverse the changes in gene expression observed in the kidneys of a mouse model of HIV-associated nephropathy (Tg26 mice). We predicted that the combination of an angiotensin-converting enzyme (ACE) inhibitor and a histone deacetylase inhibitor would maximally reverse the disease-associated expression of genes in the kidneys of these mice. Testing the combination of these inhibitors in Tg26 mice revealed an additive renoprotective effect, as suggested by reduction of proteinuria, improvement of renal function, and attenuation of kidney injury. Furthermore, we observed the predicted treatment-associated changes in the expression of selected genes and pathway components. In summary, these data suggest that the combination of an ACE inhibitor and a histone deacetylase inhibitor could have therapeutic potential for various kidney diseases.
    [Show full text]
  • Datasheet Blank Template
    SAN TA C RUZ BI OTEC HNOL OG Y, INC . ENSA (T-14): sc-161563 BACKGROUND PRODUCT ATP-dependent potassium K(ATP) channels regulate the polarity of the cell Each vial contains 200 µg IgG in 1.0 ml of PBS with < 0.1% sodium azide membrane, which affects cell metabolism and Insulin secretion. When ATP and 0.1% gelatin. levels rise in response to an increased rate of glucose metabolism, the K(ATP) Blocking peptide available for competition studies, sc-161563 P, (100 µg channels close, which stimulates the cells to secrete Insulin. K(ATP) chan nels pep tide in 0.5 ml PBS containing < 0.1% sodium azide and 0.2% BSA). are composed of two structurally unrelated subunits; a Kir6.0 subfamily component and a sulfonylurea receptor (SUR) component. ENSA ( -endo - α APPLICATIONS sulfine), also known as ARPP-19e, is a 121 amino acid endogenous liga nd for SUR. ENSA inhibits the binding of sulfonylurea to the SUR compo nent of the ENSA (T-14) is recommended for detection of ENSA of mouse, rat and K(ATP) channel, thereby reducing channel activity and stimulating the secre - human origin by Western Blotting (starting dilution 1:200, dilution range tion of Insulin. ENSA is localized to the cytoplasm and widely expressed in 1:100-1:1000), immunofluorescence (starting dilution 1:50, dilution range tissues, with high expression in brain and muscle and low expression in 1:50-1:500) and solid phase ELISA (starting dilution 1:30, dilution range pancreas. ENSA is phosphorylated by PKA and exists as two isoforms, 1:30-1:3000).
    [Show full text]
  • Agricultural University of Athens
    ΓΕΩΠΟΝΙΚΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΑΘΗΝΩΝ ΣΧΟΛΗ ΕΠΙΣΤΗΜΩΝ ΤΩΝ ΖΩΩΝ ΤΜΗΜΑ ΕΠΙΣΤΗΜΗΣ ΖΩΙΚΗΣ ΠΑΡΑΓΩΓΗΣ ΕΡΓΑΣΤΗΡΙΟ ΓΕΝΙΚΗΣ ΚΑΙ ΕΙΔΙΚΗΣ ΖΩΟΤΕΧΝΙΑΣ ΔΙΔΑΚΤΟΡΙΚΗ ΔΙΑΤΡΙΒΗ Εντοπισμός γονιδιωματικών περιοχών και δικτύων γονιδίων που επηρεάζουν παραγωγικές και αναπαραγωγικές ιδιότητες σε πληθυσμούς κρεοπαραγωγικών ορνιθίων ΕΙΡΗΝΗ Κ. ΤΑΡΣΑΝΗ ΕΠΙΒΛΕΠΩΝ ΚΑΘΗΓΗΤΗΣ: ΑΝΤΩΝΙΟΣ ΚΟΜΙΝΑΚΗΣ ΑΘΗΝΑ 2020 ΔΙΔΑΚΤΟΡΙΚΗ ΔΙΑΤΡΙΒΗ Εντοπισμός γονιδιωματικών περιοχών και δικτύων γονιδίων που επηρεάζουν παραγωγικές και αναπαραγωγικές ιδιότητες σε πληθυσμούς κρεοπαραγωγικών ορνιθίων Genome-wide association analysis and gene network analysis for (re)production traits in commercial broilers ΕΙΡΗΝΗ Κ. ΤΑΡΣΑΝΗ ΕΠΙΒΛΕΠΩΝ ΚΑΘΗΓΗΤΗΣ: ΑΝΤΩΝΙΟΣ ΚΟΜΙΝΑΚΗΣ Τριμελής Επιτροπή: Aντώνιος Κομινάκης (Αν. Καθ. ΓΠΑ) Ανδρέας Κράνης (Eρευν. B, Παν. Εδιμβούργου) Αριάδνη Χάγερ (Επ. Καθ. ΓΠΑ) Επταμελής εξεταστική επιτροπή: Aντώνιος Κομινάκης (Αν. Καθ. ΓΠΑ) Ανδρέας Κράνης (Eρευν. B, Παν. Εδιμβούργου) Αριάδνη Χάγερ (Επ. Καθ. ΓΠΑ) Πηνελόπη Μπεμπέλη (Καθ. ΓΠΑ) Δημήτριος Βλαχάκης (Επ. Καθ. ΓΠΑ) Ευάγγελος Ζωίδης (Επ.Καθ. ΓΠΑ) Γεώργιος Θεοδώρου (Επ.Καθ. ΓΠΑ) 2 Εντοπισμός γονιδιωματικών περιοχών και δικτύων γονιδίων που επηρεάζουν παραγωγικές και αναπαραγωγικές ιδιότητες σε πληθυσμούς κρεοπαραγωγικών ορνιθίων Περίληψη Σκοπός της παρούσας διδακτορικής διατριβής ήταν ο εντοπισμός γενετικών δεικτών και υποψηφίων γονιδίων που εμπλέκονται στο γενετικό έλεγχο δύο τυπικών πολυγονιδιακών ιδιοτήτων σε κρεοπαραγωγικά ορνίθια. Μία ιδιότητα σχετίζεται με την ανάπτυξη (σωματικό βάρος στις 35 ημέρες, ΣΒ) και η άλλη με την αναπαραγωγική
    [Show full text]
  • Identification of Nuclear and Cytoplasmic Mrna Targets for the Shuttling Protein SF2/ASF
    Identification of Nuclear and Cytoplasmic mRNA Targets for the Shuttling Protein SF2/ASF Jeremy R. Sanford1,2¤*, Pedro Coutinho1, Jamie A. Hackett1, Xin Wang2, William Ranahan2, Javier F. Caceres1* 1 MRC Human Genetics Unit, Western General Hospital, Edinburgh, United Kingdom, 2 Department of Biochemistry and Molecular Biology, Indiana University School of Medicine, Indianapolis, Indiana, United States of America Abstract The serine and arginine-rich protein family (SR proteins) are highly conserved regulators of pre-mRNA splicing. SF2/ASF, a prototype member of the SR protein family, is a multifunctional RNA binding protein with roles in pre-mRNA splicing, mRNA export and mRNA translation. These observations suggest the intriguing hypothesis that SF2/ASF may couple splicing and translation of specific mRNA targets in vivo. Unfortunately the paucity of endogenous mRNA targets for SF2/ASF has hindered testing of this hypothesis. Here, we identify endogenous mRNAs directly cross-linked to SF2/ASF in different sub- cellular compartments. Cross-Linking Immunoprecipitation (CLIP) captures the in situ specificity of protein-RNA interaction and allows for the simultaneous identification of endogenous RNA targets as well as the locations of binding sites within the RNA transcript. Using the CLIP method we identified 326 binding sites for SF2/ASF in RNA transcripts from 180 protein coding genes. A purine-rich consensus motif was identified in binding sites located within exon sequences but not introns. Furthermore, 72 binding sites were occupied by SF2/ASF in different sub-cellular fractions suggesting that these binding sites may influence the splicing or translational control of endogenous mRNA targets. We demonstrate that ectopic expression of SF2/ASF regulates the splicing and polysome association of transcripts derived from the SFRS1, PABC1, NETO2 and ENSA genes.
    [Show full text]
  • Ser1369ala Variant in Sulfonylurea Receptor Gene ABCC8 Is Associated with Antidiabetic Efficacy of Gliclazide in Chinese Type 2 Diabetic Patients
    Clinical Care/Education/Nutrition/Psychosocial Research ORIGINAL ARTICLE Ser1369Ala Variant in Sulfonylurea Receptor Gene ABCC8 Is Associated With Antidiabetic Efficacy of Gliclazide in Chinese Type 2 Diabetic Patients 1 3 YAN FENG, MD, PHD XUEQI LI, MD he epidemic of type 2 diabetes in the 1 4 GUANGYUN MAO, MD, PHD LIRONG SUN, MD last decade in both developed and 1 5 XIAOWEI REN, MD JINQUI YANG, MD, PHD 1 6 developing countries has made it a OUXUN ING MD EIQING A MD T H X , W M , 1 7 major threat to global public health. At GENFU TANG, MD XIAOBIN WANG, MD, SCD 2 1 least 171 million people worldwide had QIANG LI, MD, PHD XIPING XU, MD, PHD diabetes in 2000, and this figure is likely to more than double by 2030 to reach 366 million (1). The majority of diabetes is OBJECTIVE — The purpose of this study was to investigate whether genetic variants could type 2 diabetes. Most of the recent rise in influence the antidiabetic efficacy of gliclazide in type 2 diabetic patients. diabetes prevalence is probably a result of lifestyle and dietary changes, but there is RESEARCH DESIGN AND METHODS — A total of 1,268 type 2 diabetic patients also clear evidence for genetic predisposi- whose diabetes was diagnosed within the past 5 years and who had no recent hypoglycemic tion to this complex disease. During the treatment were enrolled from 23 hospitals in China. All of the patients were treated with last decade, molecular genetic studies of gliclazide for 8 weeks. Fasting and oral glucose tolerance test 2-h plasma glucose, fasting insulin, type 2 diabetes have shown significant and A1C were measured at baseline and after 8 weeks of treatment.
    [Show full text]