Verfahren Zur Bestimmung Von Stress

Total Page:16

File Type:pdf, Size:1020Kb

Verfahren Zur Bestimmung Von Stress (19) *DE102009043485A120110331* (10) DE 10 2009 043 485 A1 2011.03.31 (12) Offenlegungsschrift (21) Aktenzeichen: 10 2009 043 485.2 (51) Int Cl.8: C12Q 1/68 (2006.01) (22) Anmeldetag: 30.09.2009 (43) Offenlegungstag: 31.03.2011 (71) Anmelder: (72) Erfinder: Henkel AG & Co. KGaA, 40589 Düsseldorf, DE Weiß, Thomas, Dr., 40591 Düsseldorf, DE; Ghosh, Robin, Dr., 40215 Düsseldorf, DE; Briese, Melanie, 40597 Düsseldorf, DE; Özka, Yasmin, 40225 Düsseldorf, DE Die folgenden Angaben sind den vom Anmelder eingereichten Unterlagen entnommen (54) Bezeichnung: Verfahren zur Bestimmung von Stress (57) Zusammenfassung: Die Erfindung betrifft ein Verfah- ren zur Bestimmung von Stress, insbesondere chronischem Stress, durch die Analyse von biologischem Material aus Haarfollikeln. DE 10 2009 043 485 A1 2011.03.31 Beschreibung [0001] Die Erfindung betrifft ein Verfahren zur Bestimmung von Stress, insbesondere chronischem Stress, durch die Analyse von biologischem Material aus Haarfollikeln. [0002] Chronischer Stress kann zahlreiche Gesundheitsstörungen hervorrufen, wobei die Ausprägung man- nigfaltig ist: Migräne, Asthma, Tinnitus, Allergien, Burnout, Depressionen, Herz-Kreislauf-Erkrankungen, Stö- rungen des Immunsystems, des Bewegungsapparats und der Fortpflanzungsfunktionen, Magen-Darm-Erkran- kungen, Hauterkrankungen oder Schmerz- und Schlafstörungen sind nur einige von vielen möglichen Erkran- kungen, bei denen Stress ein wichtiger Einflussfaktor sein kann. [0003] Nicht selten treten derartige Funktionsstörungen unmerklich ein, da tägliche Belastungen als ”normal” angesehen werden und dabei keine ungewohnte psychische Belastung erlebt wird. Manche Menschen reagie- ren dagegen eher psychisch sensibel, ohne dass Körperfunktionen beeinträchtigt sind. Ob stressbezogene Erkrankungen auftreten, hängt letztendlich von dem individuellen Zusammenspiel sehr vieler und äußerst un- terschiedlicher genetischer, biologischer und psychischer Faktoren ab, in deren Folge sich bestimmte Funkti- onsveränderungen des Gehirns ergeben können, welche dann psychische und körperliche Störungen hervor- rufen können. [0004] Die psychische Komponente von Stress wird von jedem Menschen subjektiv wahrgenommen. Das bedeutet, ein Mensch kann sich beispielsweise wohltuend belastet fühlen, obwohl der Körper bereits Signale ernster körperlicher Beschwerden aussendet. Man kann sich daher nicht alleine auf die subjektive Einschät- zung verlassen, wenn es um die Frage geht, ob man (zukünftigen) Belastungen gewachsen ist. [0005] Häufig sind praktizierende Mediziner bei der Diagnose stress-bedingter Erkrankungen allerdings allei- ne auf die subjektiven Angaben ihrer Patienten angewiesen. Eine differentielle Diagnostik zur Bestimmung der Beteiligung und/oder des Anteils von Stress als möglicher Auslöser einer organischen Erkrankung wie bei Herz-Kreislauf-Erkrankungen, Hauterkrankungen etc. ist derzeit nicht möglich. Dies macht eine zielgerichtete medikamentöse oder psychotherapeutische Behandlung häufig schwierig. Des Weiteren besteht die Gefahr, die körperliche Folge-Erkrankung, aus Unkenntnis über die Ursache, rein symptombezogen, palliativ zu be- handeln, da aufgrund der mangelnden differentiellen Diagnostik kein kurativer Ansatz gewählt werden kann. [0006] In diesem Sinne ist es wichtig, den Einfluss von Stress, insbesondere von chronischem Stress frühzei- tig und quantitativ messbar beschreiben zu können, um anhand der zugrunde liegenden molekularen Mecha- nismen für jeden Patienten eine individuelle Therapieform wählen zu können. [0007] Es liegen im Stand der Technik nur wenige Instrumente vor, mit denen Stress, insbesondere chroni- scher Stress frühzeitig objektiv erkannt werden kann. Erste Ansätze hierzu wurden von einem Forschungs- team an der Universität Trier entwickelt. Das Diagnosesystem neuropatternTM misst neben der Bestimmung psychometrischer Parameter (über einen Fragebogen) den Cortisolgehalt im Speichel. Hierbei werden jeweils spezifische Muster an psychischen, biologischen und symptomatischen Veränderungen erfasst, die stressbe- zogene Störungen kennzeichnen. [0008] Nachteilig an der Auswertung von Parametern der Hypophysen-Hirnanhangsdrüsen-Nebennieren- Achse (HPA), wie dem Cortisol, ist die stark individualisierte Ausprägung. Beispielsweise kann neuropatternTM nicht bei allen Betroffenen Einsatz finden; Personen, die regelmäßig Psychopharmaka einnehmen, mit Corti- sol behandelt werden oder Frauen während der Schwangerschaft und der Stillzeit können nicht mit diesem Diagnosewerkzeug analysiert werden. [0009] Es wurde auch gefunden, dass Personen, die mit chronischem Stress belastet waren, in akuten Stress- Situationen einige der üblichen physiologischen Reaktionen, Anstieg der Herzrate und des Cortisolspiegels, nicht zeigten. Mit der Bestimmung des Cortisolgehaltes im Speichel können somit Personen, die unter chroni- schem Stress leiden, gar nicht erkannt werden. [0010] Aufgabe der vorliegenden Erfindung ist es daher, ein einfaches, schnelles und verlässliches Testsys- tem bereitzustellen, welches die Nachteile des Standes der Technik vermeidet und Stress, insbesondere chro- nischer Stress frühzeitig objektiv, frühzeitig sowie quantitativ messen kann. 2/63 DE 10 2009 043 485 A1 2011.03.31 [0011] Diese Aufgabe wird gelöst durch ein Verfahren zur Diagnose von Stress, insbesondere chronischem Stress bei einem Lebewesen, bevorzugt einem Säugetier, insbesondere einem Menschen, das die folgenden Schritte umfasst: a) Bereitstellung einer Probe aus einem oder mehreren Haarfollikeln eines Lebewesens, bevorzugt einem Säugetier, insbesondere einem Menschen, b) Bestimmung der Expression mindestens eines Markers für Stress, insbesondere chronischen Stress ausgewählt aus der Liste gemäß Anhang 1, c) ggf. Bestimmung der Expression und/oder Konzentration eines oder mehrerer weiterer Marker für Stress, insbesondere chronischen Stress, in der gleichen oder einer weiteren Probe d) Korrelieren der Ergebnisse aus b) und ggf. c) mit der Diagnose von Stress, insbesondere chronischem Stress. [0012] Vorteilhafterweise können durch frühes Erkennen und detailliertes Beschreiben des Faktors Stress bei Erkrankungen und anschließende individualisierte Behandlungen die wirtschaftlichen Einbussen verhindert und vor allem das Wohlbefinden der betroffenen Personen nachhaltig verbessert werden. [0013] Überraschenderweise wurde gefunden, dass es möglich ist, durch die Analyse von biologischem Ma- terial aus Haarfollikeln im Hinblick auf ein oder mehrere Marker für chronischen Stress, eine objektive Methode zur Bestimmung von Stress, insbesondere von chronischem Stress. [0014] Gemäß einer besonders bevorzugten Ausführungsform des Verfahrens wurde in Schritt a) verwendete Probe durch die Anwendung einer nicht-invasiven Methode gewonnen. Geeignet sind in diesem Zusammen- hang alle nicht-invasiven Methoden. Darunter sind solche Methoden zu verstehen, die nicht die Anwesenheit eines Arztes/Chirugen oder ärztlichen Fachpersonals erfordern. [0015] Als bevorzugte Ausführungsformen bieten sich, um eine möglichst einfache und für den Patienten we- nig beeinflussende Probenentnahme zu gewährleisten, insbesondere die folgenden nicht-invasiven Methoden an, bevorzugt die Entnahme des Haarfollikels durch Zupfen von Kopfhaaren (analog der Methode, wie sie in DE 10 2005 011 957 und EP1859272 beschrieben ist, auf diese Anmeldungen wird hiermit im vollen Umfang Bezug genommen) oder der Abriss von obersten Hautschichten mittels der „Tape-Stripping” Methode, wie sie in der EP1112077 beschrieben ist, auf diese Anmeldung wird hiermit ebenfalls im vollen Umfang Bezug ge- nommen. Bei dieser Methode wird auf Unterarm oder sonstige behaarten Stellen ein Klebeband geeigneter Stärke und Klebekraft aufgebracht, mit dem die Haarfollikel aus der Haut gezogen werden können. [0016] Besonders bevorzugt ist das o. g. Zupfen des Haarfollikels. Bei der nicht invasiven Isolierung von Haar- follikeln werden dem Patienten Haare durch Zupfen entnommen. Derart isoliert der Fachmann den Grossteil des Haarfollikels, wobei die dermale Papille, das Steuerzentrum des Haarwuchses in der Kopfhaut verbleibt und dadurch den Haarwuchs wieder neu initiieren kann. Das derart gewonnene Gewebe wird im Folgenden fachgerecht verwahrt und für die Analysen aufgearbeitet. [0017] Nach einer alternativen Ausführungsform können auch die Abrisse von der Haut, welche Hautzellen enthalten, auf entsprechende Marker untersucht werden. [0018] Gemäß einer anderen besonders bevorzugten Ausführungsform erfolgt die Bereitstellung einer Probe, enthaltend ein oder mehrere Haarfollikel von einem Lebewesen, bevorzugt einem Säugetier, insbesondere einem Menschen, durch Aufbringung eines Klebestreifens auf die Haut und anschließendem Abziehen des Klebestreifens von der Haut (der bereit weiter oben beschriebenen Tape-Stripping-Methode). [0019] Beispielsweise können auch die „Endprodukte” von Enthaarungsprozeduren, d. h. die Klebestreifen nach der Epilation verwendet werden. Bei solchen Enthaarungsverfahren werden analog dem Tape-Stripping die Haarfollikel durch einen mit Wachs-, Klebstoffen (ggf. auch synthetischen Klebstoffen) oder Honig bestri- chenen Träger, beispielsweise Kunststoff-, Stoffstreifen oder Mullbinden etc., auf die Haut aufgebracht, ange- drückt bzw. glatt gestrichen, und anschließend die Haarfollikel, häufig mit einem Ruck gegen die Wuchsrich- tung epiliert. [0020] Gemäß einer bevorzugten Ausführungsform des Verfahrens erfolgt die Bereitstellung der Probe aus einem oder mehreren Haarfollikeln gemäß Schritt a) aus 2 bis 50 Haarfollikeln, bevorzugt 3
Recommended publications
  • A Cell Line P53 Mutation Type UM
    A Cell line p53 mutation Type UM-SCC 1 wt UM-SCC5 Exon 5, 157 GTC --> TTC Missense mutation by transversion (Valine --> Phenylalanine UM-SCC6 wt UM-SCC9 wt UM-SCC11A wt UM-SCC11B Exon 7, 242 TGC --> TCC Missense mutation by transversion (Cysteine --> Serine) UM-SCC22A Exon 6, 220 TAT --> TGT Missense mutation by transition (Tyrosine --> Cysteine) UM-SCC22B Exon 6, 220 TAT --> TGT Missense mutation by transition (Tyrosine --> Cysteine) UM-SCC38 Exon 5, 132 AAG --> AAT Missense mutation by transversion (Lysine --> Asparagine) UM-SCC46 Exon 8, 278 CCT --> CGT Missense mutation by transversion (Proline --> Alanine) B 1 Supplementary Methods Cell Lines and Cell Culture A panel of ten established HNSCC cell lines from the University of Michigan series (UM-SCC) was obtained from Dr. T. E. Carey at the University of Michigan, Ann Arbor, MI. The UM-SCC cell lines were derived from eight patients with SCC of the upper aerodigestive tract (supplemental Table 1). Patient age at tumor diagnosis ranged from 37 to 72 years. The cell lines selected were obtained from patients with stage I-IV tumors, distributed among oral, pharyngeal and laryngeal sites. All the patients had aggressive disease, with early recurrence and death within two years of therapy. Cell lines established from single isolates of a patient specimen are designated by a numeric designation, and where isolates from two time points or anatomical sites were obtained, the designation includes an alphabetical suffix (i.e., "A" or "B"). The cell lines were maintained in Eagle's minimal essential media supplemented with 10% fetal bovine serum and penicillin/streptomycin.
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Supplement 1 Microarray Studies
    EASE Categories Significantly Enriched in vs MG vs vs MGC4-2 Pt1-C vs C4-2 Pt1-C UP-Regulated Genes MG System Gene Category EASE Global MGRWV Pt1-N RWV Pt1-N Score FDR GO Molecular Extracellular matrix cellular construction 0.0008 0 110 genes up- Function Interpro EGF-like domain 0.0009 0 regulated GO Molecular Oxidoreductase activity\ acting on single dono 0.0015 0 Function GO Molecular Calcium ion binding 0.0018 0 Function Interpro Laminin-G domain 0.0025 0 GO Biological Process Cell Adhesion 0.0045 0 Interpro Collagen Triple helix repeat 0.0047 0 KEGG pathway Complement and coagulation cascades 0.0053 0 KEGG pathway Immune System – Homo sapiens 0.0053 0 Interpro Fibrillar collagen C-terminal domain 0.0062 0 Interpro Calcium-binding EGF-like domain 0.0077 0 GO Molecular Cell adhesion molecule activity 0.0105 0 Function EASE Categories Significantly Enriched in Down-Regulated Genes System Gene Category EASE Global Score FDR GO Biological Process Copper ion homeostasis 2.5E-09 0 Interpro Metallothionein 6.1E-08 0 Interpro Vertebrate metallothionein, Family 1 6.1E-08 0 GO Biological Process Transition metal ion homeostasis 8.5E-08 0 GO Biological Process Heavy metal sensitivity/resistance 1.9E-07 0 GO Biological Process Di-, tri-valent inorganic cation homeostasis 6.3E-07 0 GO Biological Process Metal ion homeostasis 6.3E-07 0 GO Biological Process Cation homeostasis 2.1E-06 0 GO Biological Process Cell ion homeostasis 2.1E-06 0 GO Biological Process Ion homeostasis 2.1E-06 0 GO Molecular Helicase activity 2.3E-06 0 Function GO Biological
    [Show full text]
  • Gain-Of-Function Genetic Alterations of G9a Drive Oncogenesis
    Published OnlineFirst April 8, 2020; DOI: 10.1158/2159-8290.CD-19-0532 RESEARCH ARTICLE Gain-of-Function Genetic Alterations of G9a Drive Oncogenesis Shinichiro Kato 1 , Qing Yu Weng 1 , Megan L. Insco 2 , 3 , 4 , Kevin Y. Chen 2 , 3 , 4 , Sathya Muralidhar 5 , Joanna Pozniak 5 , Joey Mark S. Diaz5 , Yotam Drier 6 , 7 , 8 , Nhu Nguyen 1 , Jennifer A. Lo 1 , Ellen van Rooijen 2 , 3 , Lajos V. Kemeny 1 , Yao Zhan1 , Yang Feng 1 , Whitney Silkworth 1 , C. Thomas Powell 1 , Brian B. Liau 9 , Yan Xiong 10 , Jian Jin 10 , Julia Newton-Bishop5 , Leonard I. Zon 2 , 3 , Bradley E. Bernstein 6 , 7 , 8 , and David E. Fisher 1 . Downloaded from cancerdiscovery.aacrjournals.org on September 25, 2021. © 2020 American Association for Cancer Research. Published OnlineFirst April 8, 2020; DOI: 10.1158/2159-8290.CD-19-0532 ABSTRACT Epigenetic regulators, when genomically altered, may become driver oncogenes that mediate otherwise unexplained pro-oncogenic changes lacking a clear genetic stimulus, such as activation of the WNT/β -catenin pathway in melanoma. This study identifi es previ- ously unrecognized recurrent activating mutations in the G9a histone methyltransferase gene, as well as G9a genomic copy gains in approximately 26% of human melanomas, which collectively drive tumor growth and an immunologically sterile microenvironment beyond melanoma. Furthermore, the WNT pathway is identifi ed as a key tumorigenic target of G9a gain-of-function, via suppression of the WNT antagonist DKK1. Importantly, genetic or pharmacologic suppression of mutated or amplifi ed G9a using multiple in vitro and in vivo models demonstrates that G9a is a druggable target for therapeutic intervention in melanoma and other cancers harboring G9a genomic aberrations.
    [Show full text]
  • Tumor Suppressors in Chronic Lymphocytic Leukemia: from Lost Partners to Active Targets
    cancers Review Tumor Suppressors in Chronic Lymphocytic Leukemia: From Lost Partners to Active Targets 1, 1, 2 1 Giacomo Andreani y , Giovanna Carrà y , Marcello Francesco Lingua , Beatrice Maffeo , 3 2, 1, , Mara Brancaccio , Riccardo Taulli y and Alessandro Morotti * y 1 Department of Clinical and Biological Sciences, University of Torino, 10043 Orbassano, Italy; [email protected] (G.A.); [email protected] (G.C.); beatrice.maff[email protected] (B.M.) 2 Department of Oncology, University of Torino, 10043 Orbassano, Italy; [email protected] (M.F.L.); [email protected] (R.T.) 3 Department of Molecular Biotechnology and Health Sciences, University of Torino, 10126 Turin, Italy; [email protected] * Correspondence: [email protected]; Tel.: +39-011-9026305 These authors equally contributed to the work. y Received: 21 January 2020; Accepted: 4 March 2020; Published: 9 March 2020 Abstract: Tumor suppressors play an important role in cancer pathogenesis and in the modulation of resistance to treatments. Loss of function of the proteins encoded by tumor suppressors, through genomic inactivation of the gene, disable all the controls that balance growth, survival, and apoptosis, promoting cancer transformation. Parallel to genetic impairments, tumor suppressor products may also be functionally inactivated in the absence of mutations/deletions upon post-transcriptional and post-translational modifications. Because restoring tumor suppressor functions remains the most effective and selective approach to induce apoptosis in cancer, the dissection of mechanisms of tumor suppressor inactivation is advisable in order to further augment targeted strategies. This review will summarize the role of tumor suppressors in chronic lymphocytic leukemia and attempt to describe how tumor suppressors can represent new hopes in our arsenal against chronic lymphocytic leukemia (CLL).
    [Show full text]
  • Anti-UBXN11 Monoclonal Antibody, Clone 2C20 (DCABH-13904) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use
    Anti-UBXN11 monoclonal antibody, clone 2C20 (DCABH-13904) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description This gene encodes a protein with a divergent C-terminal UBX domain. The homologous protein in the rat interacts with members of the Rnd subfamily of Rho GTPases at the cell periphery through its C-terminal region. It also interacts with several heterotrimeric G proteins through their G-alpha subunits and promotes Rho GTPase activation. It is proposed to serve a bidirectional role in the promotion and inhibition of Rho activity through upstream signaling pathways. The 3 coding sequence of this gene contains a polymoprhic region of 24 nt tandem repeats. Several transcripts containing between 1.5 and five repeat units have been reported. Multiple transcript variants encoding different isoforms have been found for this gene. Immunogen UBXN11 (NP_663320.1, 311 a.a. ~ 409 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Isotype IgG2a Source/Host Mouse Species Reactivity Human Clone 2C20 Conjugate Unconjugated Applications Western Blot (Recombinant protein); Immunofluorescence; Sandwich ELISA (Recombinant protein); ELISA Sequence Similarities QGEVIDIRGPIRDTLQNCCPLPARIQEIVVETPTLAAERERSQESPNTPAPPLSMLRIKSENGEQA FLLMMQPDNTIGDVRALLAQARVMDASAFEIFS Size 1 ea Buffer In 1x PBS, pH 7.4 Preservative None Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]
    [Show full text]
  • (BPA) Exposure Biomarkers in Ovarian Cancer
    Journal of Clinical Medicine Article Identification of Potential Bisphenol A (BPA) Exposure Biomarkers in Ovarian Cancer Aeman Zahra 1, Qiduo Dong 1, Marcia Hall 1,2 , Jeyarooban Jeyaneethi 1, Elisabete Silva 1, Emmanouil Karteris 1,* and Cristina Sisu 1,* 1 Biosciences, College of Health, Medicine and Life Sciences, Brunel University London, Uxbridge UB8 3PH, UK; [email protected] (A.Z.); [email protected] (Q.D.); [email protected] (M.H.); [email protected] (J.J.); [email protected] (E.S.) 2 Mount Vernon Cancer Centre, Northwood HA6 2RN, UK * Correspondence: [email protected] (E.K.); [email protected] (C.S.) Abstract: Endocrine-disrupting chemicals (EDCs) can exert multiple deleterious effects and have been implicated in carcinogenesis. The xenoestrogen Bisphenol A (BPA) that is found in various consumer products has been involved in the dysregulation of numerous signalling pathways. In this paper, we present the analysis of a set of 94 genes that have been shown to be dysregulated in presence of BPA in ovarian cancer cell lines since we hypothesised that these genes might be of biomarker potential. This study sought to identify biomarkers of disease and biomarkers of disease- associated exposure. In silico analyses took place using gene expression data extracted from The Cancer Genome Atlas (TCGA) and the Genotype-Tissue Expression (GTEx) databases. Differential expression was further validated at protein level using immunohistochemistry on an ovarian cancer tissue microarray. We found that 14 out of 94 genes are solely dysregulated in the presence of BPA, while the remaining 80 genes are already dysregulated (p-value < 0.05) in their expression pattern Citation: Zahra, A.; Dong, Q.; Hall, as a consequence of the disease.
    [Show full text]
  • Clinically Annotated Breast, Ovarian and Pancreatic Cancer
    www.nature.com/scientificreports OPEN MetaGxData: Clinically Annotated Breast, Ovarian and Pancreatic Cancer Datasets and their Use in Received: 19 November 2018 Accepted: 31 May 2019 Generating a Multi-Cancer Gene Published: xx xx xxxx Signature Deena M. A. Gendoo 1, Michael Zon2,4, Vandana Sandhu2, Venkata S. K. Manem2,3,5, Natchar Ratanasirigulchai2, Gregory M. Chen2, Levi Waldron 6 & Benjamin Haibe- Kains2,3,7,8,9 A wealth of transcriptomic and clinical data on solid tumours are under-utilized due to unharmonized data storage and format. We have developed the MetaGxData package compendium, which includes manually-curated and standardized clinical, pathological, survival, and treatment metadata across breast, ovarian, and pancreatic cancer data. MetaGxData is the largest compendium of curated transcriptomic data for these cancer types to date, spanning 86 datasets and encompassing 15,249 samples. Open access to standardized metadata across cancer types promotes use of their transcriptomic and clinical data in a variety of cross-tumour analyses, including identifcation of common biomarkers, and assessing the validity of prognostic signatures. Here, we demonstrate that MetaGxData is a fexible framework that facilitates meta-analyses by using it to identify common prognostic genes in ovarian and breast cancer. Furthermore, we use the data compendium to create the frst gene signature that is prognostic in a meta-analysis across 3 cancer types. These fndings demonstrate the potential of MetaGxData to serve as an important resource in oncology research, and provide a foundation for future development of cancer-specifc compendia. Ovarian, breast and pancreatic cancers are among the leading causes of cancer deaths among women, and recent studies have identifed biological and molecular commonalities between them1–4.
    [Show full text]
  • A Bacterial Protein Targets the BAHD1 Chromatin Complex to Stimulate Type III Interferon Response
    A bacterial protein targets the BAHD1 chromatin complex to stimulate type III interferon response Alice Lebreton, Goran Lakisic, Viviana Job, Lauriane Fritsch, To Nam Tham, Ana Camejo, Pierre-Jean Matteï, Béatrice Regnault, Marie-Anne Nahori, Didier Cabanes, et al. To cite this version: Alice Lebreton, Goran Lakisic, Viviana Job, Lauriane Fritsch, To Nam Tham, et al.. A bacterial protein targets the BAHD1 chromatin complex to stimulate type III interferon response. Science, American Association for the Advancement of Science, 2011, 331 (6022), pp.1319-21. 10.1126/sci- ence.1200120. cea-00819299 HAL Id: cea-00819299 https://hal-cea.archives-ouvertes.fr/cea-00819299 Submitted on 26 Jul 2020 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Lebreton et al. Science 2011 doi:10.1126/science.1200120 A Bacterial Protein Targets the BAHD1 Chromatin Complex to Stimulate Type III Interferon Response Alice Lebreton1,2,3, Goran Lakisic4, Viviana Job5, Lauriane Fritsch6, To Nam Tham1,2,3, Ana Camejo7, Pierre-Jean Matteï5, Béatrice Regnault8, Marie-Anne Nahori1,2,3, Didier Cabanes7, Alexis Gautreau4, Slimane Ait-Si-Ali6, Andréa Dessen5, Pascale Cossart1,2,3* and Hélène Bierne1,2,3* 1.
    [Show full text]
  • Integrating Structure to Protein-Protein Interaction Networks That Drive Metastasis to Brain and Lung in Breast Cancer
    Integrating Structure to Protein-Protein Interaction Networks That Drive Metastasis to Brain and Lung in Breast Cancer H. Billur Engin1, Emre Guney2, Ozlem Keskin1, Baldo Oliva2, Attila Gursoy1* 1 Center for Computational Biology and Bioinformatics and College of Engineering, Koc University, Istanbul, Turkey, 2 Structural Bioinformatics Group (GRIB), Universitat Pompeu Fabra Abstract Blocking specific protein interactions can lead to human diseases. Accordingly, protein interactions and the structural knowledge on interacting surfaces of proteins (interfaces) have an important role in predicting the genotype- phenotype relationship. We have built the phenotype specific sub-networks of protein-protein interactions (PPIs) involving the relevant genes responsible for lung and brain metastasis from primary tumor in breast cancer. First, we selected the PPIs most relevant to metastasis causing genes (seed genes), by using the “guilt-by-association” principle. Then, we modeled structures of the interactions whose complex forms are not available in Protein Databank (PDB). Finally, we mapped mutations to interface structures (real and modeled), in order to spot the interactions that might be manipulated by these mutations. Functional analyses performed on these sub-networks revealed the potential relationship between immune system-infectious diseases and lung metastasis progression, but this connection was not observed significantly in the brain metastasis. Besides, structural analyses showed that some PPI interfaces in both metastasis sub-networks are originating from microbial proteins, which in turn were mostly related with cell adhesion. Cell adhesion is a key mechanism in metastasis, therefore these PPIs may be involved in similar molecular pathways that are shared by infectious disease and metastasis. Finally, by mapping the mutations and amino acid variations on the interface regions of the proteins in the metastasis sub-networks we found evidence for some mutations to be involved in the mechanisms differentiating the type of the metastasis.
    [Show full text]
  • Downregulation of SNRPG Induces Cell Cycle Arrest and Sensitizes Human Glioblastoma Cells to Temozolomide by Targeting Myc Through a P53-Dependent Signaling Pathway
    Cancer Biol Med 2020. doi: 10.20892/j.issn.2095-3941.2019.0164 ORIGINAL ARTICLE Downregulation of SNRPG induces cell cycle arrest and sensitizes human glioblastoma cells to temozolomide by targeting Myc through a p53-dependent signaling pathway Yulong Lan1,2*, Jiacheng Lou2*, Jiliang Hu1, Zhikuan Yu1, Wen Lyu1, Bo Zhang1,2 1Department of Neurosurgery, Shenzhen People’s Hospital, Second Clinical Medical College of Jinan University, The First Affiliated Hospital of Southern University of Science and Technology, Shenzhen 518020, China;2 Department of Neurosurgery, The Second Affiliated Hospital of Dalian Medical University, Dalian 116023, China ABSTRACT Objective: Temozolomide (TMZ) is commonly used for glioblastoma multiforme (GBM) chemotherapy. However, drug resistance limits its therapeutic effect in GBM treatment. RNA-binding proteins (RBPs) have vital roles in posttranscriptional events. While disturbance of RBP-RNA network activity is potentially associated with cancer development, the precise mechanisms are not fully known. The SNRPG gene, encoding small nuclear ribonucleoprotein polypeptide G, was recently found to be related to cancer incidence, but its exact function has yet to be elucidated. Methods: SNRPG knockdown was achieved via short hairpin RNAs. Gene expression profiling and Western blot analyses were used to identify potential glioma cell growth signaling pathways affected by SNRPG. Xenograft tumors were examined to determine the carcinogenic effects of SNRPG on glioma tissues. Results: The SNRPG-mediated inhibitory effect on glioma cells might be due to the targeted prevention of Myc and p53. In addition, the effects of SNRPG loss on p53 levels and cell cycle progression were found to be Myc-dependent. Furthermore, SNRPG was increased in TMZ-resistant GBM cells, and downregulation of SNRPG potentially sensitized resistant cells to TMZ, suggesting that SNRPG deficiency decreases the chemoresistance of GBM cells to TMZ via the p53 signaling pathway.
    [Show full text]
  • Ncounter® Human Autoimmune Profiling Panel
    nCounter® Human AutoImmune Profiling Panel - Gene and Probe Details Official Symbol Accession Alias / Previous Symbol Official Full Name Other targets or Isoform Information ACE NM_000789.2 DCP1;angiotensin I converting enzyme (peptidyl-dipeptidase A) 1 angiotensin I converting enzyme ACIN1 NM_001164815.1 ACINUS;apoptotic chromatin condensation inducer in the nucleus apoptotic chromatin condensation inducer 1 ACP5 NM_001611.3 acid phosphatase 5, tartrate resistant CTRN2;ARP1 (actin-related protein 1, yeast) homolog B (centractin beta),ARP1 actin-related ACTR1B NM_005735.3 protein 1 homolog B, centractin beta ARP1 actin related protein 1 homolog B ADAM17 NM_003183.4 TACE;tumor necrosis factor, alpha, converting enzyme ADAM metallopeptidase domain 17 ADAR NM_001111.3 IFI4,G1P1;interferon-induced protein 4 adenosine deaminase, RNA specific ADORA2A NM_000675.3 ADORA2 adenosine A2a receptor AGER NM_001136.3 advanced glycosylation end-product specific receptor AGT NM_000029.3 SERPINA8;serpin peptidase inhibitor, clade A, member 8 angiotensinogen AHR NM_001621.3 aryl hydrocarbon receptor AICDA NM_020661.2 activation-induced cytidine deaminase activation induced cytidine deaminase AIM2 NM_004833.1 absent in melanoma 2 APECED;autoimmune regulator (autoimmune polyendocrinopathy candidiasis ectodermal AIRE NM_000383.2 dystrophy) autoimmune regulator AKT1 NM_001014432.1 v-akt murine thymoma viral oncogene homolog 1 AKT serine/threonine kinase 1 AKT2 NM_001626.4 v-akt murine thymoma viral oncogene homolog 2 AKT serine/threonine kinase 2 AKT3 NM_005465.4
    [Show full text]