DAZ2 Polyclonal Antibody Gene Symbol: DAZ2

DAZ2 polyclonal antibody Gene Symbol: DAZ2

Gene Alias: MGC126442, pDP1678 Catalog Number: PAB30017

Gene Summary: This gene is a member of the DAZ Regulatory Status: For research use only (RUO) gene family and is a candidate for the human Product Description: Rabbit polyclonal antibody raised Y-chromosomal azoospermia factor (AZF). Its against synthetic peptide of human DAZ2. expression is restricted to premeiotic germ cells, particularly in spermatogonia. It encodes an Immunogen: A synthetic peptide corresponding to RNA-binding protein that is important for N-terminus of human DAZ2. spermatogenesis. Four copies of this gene are found on chromosome Y within palindromic duplications; one pair Sequence: of genes is part of the P2 palindrome and the second MDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFV pair is part of the P1 palindrome. Each gene contains a NDVDVQKIVGSQ 2.4 kb repeat including a 72-bp exon, called the DAZ repeat; the number of DAZ repeats is variable and there Host: Rabbit are several variations in the sequence of the DAZ repeat. Each copy of the gene also contains a 10.8 kb Theoretical MW (kDa): 59 region that may be amplified; this region includes five exons that encode an RNA recognition motif (RRM) Reactivity: Human domain. This gene contains one copy of the 10.8 kb Applications: IHC-P, WB-Ce repeat. Alternative splicing results in multiple transcript (See our web site product page for detailed applications variants encoding different isoforms. [provided by information) RefSeq]

Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols

Form: Liquid

Purification: Affinity purification

Recommend Usage: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL) Western Blot (0.2-1 ug/mL) The optimal working dilution should be determined by the end user.

Storage Buffer: In PBS (2% sucrose, 0.09% sodium azide).

Storage Instruction: Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.

Entrez GeneID: 57055

Page 1/1