DAZ2 Polyclonal Antibody Gene Symbol: DAZ2

Total Page：16

File Type：pdf, Size：1020Kb

DAZ2 polyclonal antibody Gene Symbol: DAZ2 Gene Alias: MGC126442, pDP1678 Catalog Number: PAB30017 Gene Summary: This gene is a member of the DAZ Regulatory Status: For research use only (RUO) gene family and is a candidate for the human Product Description: Rabbit polyclonal antibody raised Y-chromosomal azoospermia factor (AZF). Its against synthetic peptide of human DAZ2. expression is restricted to premeiotic germ cells, particularly in spermatogonia. It encodes an Immunogen: A synthetic peptide corresponding to RNA-binding protein that is important for N-terminus of human DAZ2. spermatogenesis. Four copies of this gene are found on chromosome Y within palindromic duplications; one pair Sequence: of genes is part of the P2 palindrome and the second MDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFV pair is part of the P1 palindrome. Each gene contains a NDVDVQKIVGSQ 2.4 kb repeat including a 72-bp exon, called the DAZ repeat; the number of DAZ repeats is variable and there Host: Rabbit are several variations in the sequence of the DAZ repeat. Each copy of the gene also contains a 10.8 kb Theoretical MW (kDa): 59 region that may be amplified; this region includes five exons that encode an RNA recognition motif (RRM) Reactivity: Human domain. This gene contains one copy of the 10.8 kb Applications: IHC-P, WB-Ce repeat. Alternative splicing results in multiple transcript (See our web site product page for detailed applications variants encoding different isoforms. [provided by information) RefSeq] Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Form: Liquid Purification: Affinity purification Recommend Usage: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL) Western Blot (0.2-1 ug/mL) The optimal working dilution should be determined by the end user. Storage Buffer: In PBS (2% sucrose, 0.09% sodium azide). Storage Instruction: Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 57055 Page 1/1 Powered by TCPDF (www.tcpdf.org).

Copy Link

Recommended publications

Aneuploidy: Using Genetic Instability to Preserve a Haploid Genome?
Health Science Campus FINAL APPROVAL OF DISSERTATION Doctor of Philosophy in Biomedical Science (Cancer Biology) Aneuploidy: Using genetic instability to preserve a haploid genome? Submitted by: Ramona Ramdath In partial fulfillment of the requirements for the degree of Doctor of Philosophy in Biomedical Science Examination Committee Signature/Date Major Advisor: David Allison, M.D., Ph.D. Academic James Trempe, Ph.D. Advisory Committee: David Giovanucci, Ph.D. Randall Ruch, Ph.D. Ronald Mellgren, Ph.D. Senior Associate Dean College of Graduate Studies Michael S. Bisesi, Ph.D. Date of Defense: April 10, 2009 Aneuploidy: Using genetic instability to preserve a haploid genome? Ramona Ramdath University of Toledo, Health Science Campus 2009 Dedication I dedicate this dissertation to my grandfather who died of lung cancer two years ago, but who always instilled in us the value and importance of education. And to my mom and sister, both of whom have been pillars of support and stimulating conversations. To my sister, Rehanna, especially- I hope this inspires you to achieve all that you want to in life, academically and otherwise. ii Acknowledgements As we go through these academic journeys, there are so many along the way that make an impact not only on our work, but on our lives as well, and I would like to say a heartfelt thank you to all of those people: My Committee members- Dr. James Trempe, Dr. David Giovanucchi, Dr. Ronald Mellgren and Dr. Randall Ruch for their guidance, suggestions, support and confidence in me. My major advisor- Dr. David Allison, for his constructive criticism and positive reinforcement.
[Show full text]
DAZ (Z6Q): Sc-100705
SANTA CRUZ BIOTECHNOLOGY, INC. DAZ (Z6Q): sc-100705 BACKGROUND RECOMMENDED SUPPORT REAGENTS Spermatogenesis is the process by which male spermatogonia develop into To ensure optimal results, the following support reagents are recommended: mature spermatozoa. DAZ (deleted in azoospermia) are RNA-binding proteins 1) Western Blotting: use m-IgGk BP-HRP: sc-516102 or m-IgGk BP-HRP (Cruz that play an essential role in spermatogenesis. DAZ proteins influence the Marker): sc-516102-CM (dilution range: 1:1000-1:10000), Cruz Marker™ first stages of spermatogenesis and the maintenance of germ cell populations. Molecular Weight Standards: sc-2035, UltraCruz® Blocking Reagent: DAZ proteins (DAZ1, DAZ2, DAZ3, DAZ4 and DAZ5) are encoded by separate sc-516214 and Western Blotting Luminol Reagent: sc-2048. 2) Immunopre- genes on chromosome Y, each of which contain an AZFc domain in their cod- cipitation: use Protein A/G PLUS-Agarose: sc-2003 (0.5 ml agarose/2.0 ml). ing region. DAZ proteins are localized to the nucleus of spermatogonia, but 3) Immunofluorescence: use m-IgGk BP-FITC: sc-516140 or m-IgGk BP-PE: relocate to the cytoplasm during meiosis. DAZ proteins contain an RRM (RNA sc-516141 (dilution range: 1:50-1:200) with UltraCruz® Mounting Medium: recognition motif) domain that may regulate mRNA translation by binding sc-24941 or UltraCruz® Hard-set Mounting Medium: sc-359850. 4) Immuno- to the 3' UTR. Deletions in the genes encoding DAZ proteins may cause histochemistry: use m-IgGk BP-HRP: sc-516102 with DAB, 50X: sc-24982 azoospermia or oligospermia which can lead to male infertility.
[Show full text]
DAZ2 Antibody Cat
DAZ2 Antibody Cat. No.: 29-234 DAZ2 Antibody Antibody used in WB on Human Daudi cells at 0.2-1 ug/ml. Specifications HOST SPECIES: Rabbit SPECIES REACTIVITY: Human Antibody produced in rabbits immunized with a synthetic peptide corresponding a region IMMUNOGEN: of human DAZ2. TESTED APPLICATIONS: ELISA, IHC, WB DAZ2 antibody can be used for detection of DAZ2 by ELISA at 1:62500. DAZ2 antibody can APPLICATIONS: be used for detection of DAZ2 by western blot at 0.5 μg/mL, and HRP conjugated secondary antibody should be diluted 1:50,000 - 100,000. POSITIVE CONTROL: 1) Cat. No. 1224 - Daudi Cell Lysate PREDICTED MOLECULAR 59 kDa, 65 kDa, 65 kDa, 41 kDa, 65 kDa, 65 kDa, 63 kDa, 50 kDa, 44 kDa WEIGHT: September 30, 2021 1 https://www.prosci-inc.com/daz2-antibody-29-234.html Properties PURIFICATION: Antibody is purified by peptide affinity chromatography method. CLONALITY: Polyclonal CONJUGATE: Unconjugated PHYSICAL STATE: Liquid Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% BUFFER: sucrose. CONCENTRATION: batch dependent For short periods of storage (days) store at 4˚C. For longer periods of storage, store DAZ2 STORAGE CONDITIONS: antibody at -20˚C. As with any antibody avoid repeat freeze-thaw cycles. Additional Info OFFICIAL SYMBOL: DAZ2 ALTERNATE NAMES: DAZ2, pDP1678 ACCESSION NO.: NP_001005785 PROTEIN GI NO.: 54292105 GENE ID: 57055 USER NOTE: Optimal dilutions for each application to be determined by the researcher. Background and References DAZ2 is a member of the DAZ family and is a candidate for the human Y-chromosomal azoospermia factor (AZF).
[Show full text]
Product Description SALSA MLPA Probemix P360-B2 Y-Chromosome
MRC-Holland ® Product Description version B2-01; Issued 20 March 2019 MLPA Product Description SALSA ® MLPA ® Probemix P360-B2 Y-Chromosome Microdeletions To be used with the MLPA General Protocol. Version B2. As compared to version B1, one probe length has been adjusted . For complete product history see page 14. Catalogue numbers: • P360-025R: SALSA MLPA Probemix P360 Y-Chromosome Microdeletions, 25 reactions. • P360-050R: SALSA MLPA Probemix P360 Y-Chromosome Microdeletions, 50 reactions. • P360-100R: SALSA MLPA Probemix P360 Y-Chromosome Microdeletions, 100 reactions. To be used in combination with a SALSA MLPA reagent kit, available for various number of reactions. MLPA reagent kits are either provided with FAM or Cy5.0 dye-labelled PCR primer, suitable for Applied Biosystems and Beckman capillary sequencers, respectively (see www.mlpa.com ). This SALSA MLPA probemix is for basic research and intended for experienced MLPA users only! This probemix is intended to quantify genes or chromosomal regions in which the occurrence of copy number changes is not yet well-established and the relationship between genotype and phenotype is not yet clear. Interpretation of results can be complicated. MRC-Holland recommends thoroughly screening any available literature. Certificate of Analysis: Information regarding storage conditions, quality tests, and a sample electropherogram from the current sales lot is available at www.mlpa.com . Precautions and warnings: For professional use only. Always consult the most recent product description AND the MLPA General Protocol before use: www.mlpa.com . It is the responsibility of the user to be aware of the latest scientific knowledge of the application before drawing any conclusions from findings generated with this product.
[Show full text]
Genomic and Expression Profiling of Human Spermatocytic Seminomas: Primary Spermatocyte As Tumorigenic Precursor and DMRT1 As Candidate Chromosome 9 Gene
Research Article Genomic and Expression Profiling of Human Spermatocytic Seminomas: Primary Spermatocyte as Tumorigenic Precursor and DMRT1 as Candidate Chromosome 9 Gene Leendert H.J. Looijenga,1 Remko Hersmus,1 Ad J.M. Gillis,1 Rolph Pfundt,4 Hans J. Stoop,1 Ruud J.H.L.M. van Gurp,1 Joris Veltman,1 H. Berna Beverloo,2 Ellen van Drunen,2 Ad Geurts van Kessel,4 Renee Reijo Pera,5 Dominik T. Schneider,6 Brenda Summersgill,7 Janet Shipley,7 Alan McIntyre,7 Peter van der Spek,3 Eric Schoenmakers,4 and J. Wolter Oosterhuis1 1Department of Pathology, Josephine Nefkens Institute; Departments of 2Clinical Genetics and 3Bioinformatics, Erasmus Medical Center/ University Medical Center, Rotterdam, the Netherlands; 4Department of Human Genetics, Radboud University Medical Center, Nijmegen, the Netherlands; 5Howard Hughes Medical Institute, Whitehead Institute and Department of Biology, Massachusetts Institute of Technology, Cambridge, Massachusetts; 6Clinic of Paediatric Oncology, Haematology and Immunology, Heinrich-Heine University, Du¨sseldorf, Germany; 7Molecular Cytogenetics, Section of Molecular Carcinogenesis, The Institute of Cancer Research, Sutton, Surrey, United Kingdom Abstract histochemistry, DMRT1 (a male-specific transcriptional regulator) was identified as a likely candidate gene for Spermatocytic seminomas are solid tumors found solely in the involvement in the development of spermatocytic seminomas. testis of predominantly elderly individuals. We investigated these tumors using a genome-wide analysis for structural and (Cancer Res 2006; 66(1): 290-302) numerical chromosomal changes through conventional kar- yotyping, spectral karyotyping, and array comparative Introduction genomic hybridization using a 32 K genomic tiling-path Spermatocytic seminomas are benign testicular tumors that resolution BAC platform (confirmed by in situ hybridization).
[Show full text]
Molecular Pathogenesis of a Malformation Syndrome Associated with a Pericentric Chromosome 2 Inversion
UNIVERSIDADE DE LISBOA FACULDADE DE CIÊNCIAS DEPARTAMENTO DE BIOLOGIA ANIMAL Molecular pathogenesis of a malformation syndrome associated with a pericentric chromosome 2 inversion Manuela Pinto Cardoso Mestrado em Biologia Humana e do Ambiente Dissertação orientada por: Doutor Dezsö David Doutora Deodália Dias 2017 ACKNOWLEDGEMENTS I would like to say “thank you!” to all the people that contributed in some way to this thesis. First and foremost, I would like to express my deepest gratitude to my supervisor, Dr. Dezsö David, for giving me the opportunity to work in his research group and for everything he taught me. Without his mentorship I would have never learned so much. I am grateful for Prof. Deodália Dias’s encouragement and support in all these years that I have been under her wings. I would like to extent my thanks to everyone at the National Health Institute Dr. Ricardo Jorge, for their continuous help in all stages of this thesis. To the team at Harvard Medical School, thank you for the technical assistance, and in special Dr. Cynthia Morton and Dr. Michael Talkowski. I am also grateful to Dr. Rui Gonçalves and Dr. João Freixo, who accompanied this case study and shared their medical knowledge. Of course, I am grateful for the family members for their involvement in this study. To my lab mates, a shout-out to them all! I really hold them dear for their help and the many laughs we shared every day. Thank you Mariana for being there literally since day one and for playing the role of a more mature counterpart.
[Show full text]
Biological Role and Disease Impact of Copy Number Variation in Complex Disease
University of Pennsylvania ScholarlyCommons Publicly Accessible Penn Dissertations 2014 Biological Role and Disease Impact of Copy Number Variation in Complex Disease Joseph Glessner University of Pennsylvania, [email protected] Follow this and additional works at: https://repository.upenn.edu/edissertations Part of the Bioinformatics Commons, and the Genetics Commons Recommended Citation Glessner, Joseph, "Biological Role and Disease Impact of Copy Number Variation in Complex Disease" (2014). Publicly Accessible Penn Dissertations. 1286. https://repository.upenn.edu/edissertations/1286 This paper is posted at ScholarlyCommons. https://repository.upenn.edu/edissertations/1286 For more information, please contact [email protected]. Biological Role and Disease Impact of Copy Number Variation in Complex Disease Abstract In the human genome, DNA variants give rise to a variety of complex phenotypes. Ranging from single base mutations to copy number variations (CNVs), many of these variants are neutral in selection and disease etiology, making difficult the detection of true common orar r e frequency disease-causing mutations. However, allele frequency comparisons in cases, controls, and families may reveal disease associations. Single nucleotide polymorphism (SNP) arrays and exome sequencing are popular assays for genome-wide variant identification. oT limit bias between samples, uniform testing is crucial, including standardized platform versions and sample processing. Bases occupy single points while copy variants occupy segments.
[Show full text]
Novel Targets of Apparently Idiopathic Male Infertility
International Journal of Molecular Sciences Review Molecular Biology of Spermatogenesis: Novel Targets of Apparently Idiopathic Male Infertility Rossella Cannarella * , Rosita A. Condorelli , Laura M. Mongioì, Sandro La Vignera * and Aldo E. Calogero Department of Clinical and Experimental Medicine, University of Catania, 95123 Catania, Italy; [email protected] (R.A.C.); [email protected] (L.M.M.); [email protected] (A.E.C.) * Correspondence: [email protected] (R.C.); [email protected] (S.L.V.) Received: 8 February 2020; Accepted: 2 March 2020; Published: 3 March 2020 Abstract: Male infertility affects half of infertile couples and, currently, a relevant percentage of cases of male infertility is considered as idiopathic. Although the male contribution to human fertilization has traditionally been restricted to sperm DNA, current evidence suggest that a relevant number of sperm transcripts and proteins are involved in acrosome reactions, sperm-oocyte fusion and, once released into the oocyte, embryo growth and development. The aim of this review is to provide updated and comprehensive insight into the molecular biology of spermatogenesis, including evidence on spermatogenetic failure and underlining the role of the sperm-carried molecular factors involved in oocyte fertilization and embryo growth. This represents the first step in the identification of new possible diagnostic and, possibly, therapeutic markers in the field of apparently idiopathic male infertility. Keywords: spermatogenetic failure; embryo growth; male infertility; spermatogenesis; recurrent pregnancy loss; sperm proteome; DNA fragmentation; sperm transcriptome 1. Introduction Infertility is a widespread condition in industrialized countries, affecting up to 15% of couples of childbearing age [1]. It is defined as the inability to achieve conception after 1–2 years of unprotected sexual intercourse [2].
[Show full text]
Application of Genomic Technologies to Study Infertility Nicholas Rui Yuan Ho Washington University in St
Washington University in St. Louis Washington University Open Scholarship Arts & Sciences Electronic Theses and Dissertations Arts & Sciences Spring 5-15-2016 Application of Genomic Technologies to Study Infertility Nicholas Rui Yuan Ho Washington University in St. Louis Follow this and additional works at: https://openscholarship.wustl.edu/art_sci_etds Part of the Bioinformatics Commons, Genetics Commons, and the Molecular Biology Commons Recommended Citation Yuan Ho, Nicholas Rui, "Application of Genomic Technologies to Study Infertility" (2016). Arts & Sciences Electronic Theses and Dissertations. 786. https://openscholarship.wustl.edu/art_sci_etds/786 This Dissertation is brought to you for free and open access by the Arts & Sciences at Washington University Open Scholarship. It has been accepted for inclusion in Arts & Sciences Electronic Theses and Dissertations by an authorized administrator of Washington University Open Scholarship. For more information, please contact [email protected]. WASHINGTON UNIVERSITY IN ST. LOUIS Division of Biology and Biomedical Sciences Computational and Systems Biology Dissertation Examination Committee: Donald Conrad, Chair Barak Cohen Joseph Dougherty John Edwards Liang Ma Application of Genomic Technologies to Study Infertility by Nicholas Rui Yuan Ho A dissertation presented to the Graduate School of Arts & Sciences of Washington University in partial fulfillment of the requirements for the degree of Doctor of Philosophy May 2016 St. Louis, Missouri © 2016, Nicholas Rui Yuan Ho Table of
[Show full text]
Bcmf30a and Bcmf30c, Two Novel Non-Tandem CCCH Zinc-Finger Proteins, Function in Pollen Development and Pollen Germination in Brassica Campestris Ssp
International Journal of Molecular Sciences Article BcMF30a and BcMF30c, Two Novel Non-Tandem CCCH Zinc-Finger Proteins, Function in Pollen Development and Pollen Germination in Brassica campestris ssp. chinensis Liai Xu 1,2 , Xingpeng Xiong 1,2, Weimiao Liu 1,2, Tingting Liu 1,2 , Youjian Yu 3 and Jiashu Cao 1,2,* 1 Laboratory of Cell & Molecular Biology, Institute of Vegetable Science, Zhejiang University, Hangzhou 310058, China; [email protected] (L.X.); [email protected] (X.X.); [email protected] (W.L.); [email protected] (T.L.) 2 Key Laboratory of Horticultural Plant Growth, Development and Quality Improvement, Ministry of Agriculture/Zhejiang Provincial Key Laboratory of Horticultural Plant Integrative Biology, Hangzhou 310058, China 3 Department of Horticulture, College of Agriculture and Food Science, Zhejiang A & F University, Lin’an 311300, China; [email protected] * Correspondence: [email protected]; Tel.: +86-131-8501-1958 Received: 18 July 2020; Accepted: 31 August 2020; Published: 3 September 2020 Abstract: Chinese cabbage (Brassica campestris) is an economically important leaf vegetable crop worldwide. Mounting studies have shown that cysteine-cysteine-cysteine-histidine (CCCH) zinc-finger protein genes are involved in various plant growth and development processes. However, research on the involvement of these genes in male reproductive development is still in its infancy. Here, we identified 11 male fertility-related CCCH genes in Chinese cabbage. Among them, a pair of paralogs encoding novel non-tandem CCCH zinc-finger proteins, Brassica campestris Male Fertility 30a (BcMF30a) and BcMF30c, were further characterized. They were highly expressed in pollen during microgametogenesis and continued to express in germinated pollen.
[Show full text]
Rabbit Anti-DAZ2/FITC Conjugated Antibody-SL14999R-FITC
SunLong Biotech Co.,LTD Tel: 0086-571- 56623320 Fax:0086-571- 56623318 E-mail:[email protected] www.sunlongbiotech.com Rabbit Anti-DAZ2/FITC Conjugated antibody SL14999R-FITC Product Name: Anti-DAZ2/FITC Chinese Name: FITC标记的无精症缺失基因2抗体 DAZ2; DAZ2_HUMAN; DAZ3; Deleted in azoospermia 2; Deleted in azoospermia Alias: protein 2; Deleted in azoospermia protein 3; MGC126442; pDP1678. Organism Species: Rabbit Clonality: Polyclonal React Species: Human,Mouse,Rat,Pig,Cow,Horse,Sheep, ICC=1:50-200IF=1:50-200 Applications: not yet tested in other applications. optimal dilutions/concentrations should be determined by the end user. Molecular weight: 63kDa Form: Lyophilized or Liquid Concentration: 1mg/ml immunogen: KLH conjugated synthetic peptide derived from human DAZ2 Lsotype: IgG Purification: affinity purified by Protein A Storage Buffer: 0.01M TBS(pH7.4) with 1% BSA, 0.03% Proclin300 and 50% Glycerol. Storewww.sunlongbiotech.com at -20 °C for one year. Avoid repeated freeze/thaw cycles. The lyophilized antibody is stable at room temperature for at least one month and for greater than a year Storage: when kept at -20°C. When reconstituted in sterile pH 7.4 0.01M PBS or diluent of antibody the antibody is stable for at least two weeks at 2-4 °C. background: This gene is a member of the DAZ gene family and is a candidate for the human Y- chromosomal azoospermia factor (AZF). Its expression is restricted to premeiotic germ cells, particularly in spermatogonia. It encodes an RNA-binding protein that is Product Detail: important for spermatogenesis. Four copies of this gene are found on chromosome Y within palindromic duplications; one pair of genes is part of the P2 palindrome and the second pair is part of the P1 palindrome.
[Show full text]
The Tip of the Iceberg: RNA-Binding Proteins with Prion-Like Domains in Neurodegenerative Disease
BRES-42024; No. of pages: 20; 4C: 7, 8, 10, 12, 13 BRAIN RESEARCH XX (2012) XXX– XXX Available online at www.sciencedirect.com www.elsevier.com/locate/brainres Review The tip of the iceberg: RNA-binding proteins with prion-like domains in neurodegenerative disease Oliver D. Kinga,⁎, Aaron D. Gitlerb,⁎⁎, James Shorterc,⁎⁎⁎ aBoston Biomedical Research Institute, 64 Grove St., Watertown, MA 02472, USA bDepartment of Genetics, Stanford University School of Medicine, 300 Pasteur Drive, M322 Alway Building, Stanford, CA 94305-5120, USA cDepartment of Biochemistry and Biophysics, University of Pennsylvania School of Medicine, 805b Stellar-Chance Laboratories, 422 Curie Boulevard, Philadelphia, PA 19104, USA ARTICLE INFO ABSTRACT Article history: Prions are self-templating protein conformers that are naturally transmitted between individ- Accepted 7 January 2012 uals and promote phenotypic change. In yeast, prion-encoded phenotypes can be beneficial, neutral or deleterious depending upon genetic background and environmental conditions. A dis- Keywords: tinctive and portable ‘prion domain’ enriched in asparagine, glutamine, tyrosine and glycine res- Prion idues unifies the majority of yeast prion proteins. Deletion of this domain precludes RNA-binding protein prionogenesis and appending this domain to reporter proteins can confer prionogenicity. An al- TDP-43 gorithm designed to detect prion domains has successfully identified 19 domains that can confer FUS prion behavior. Scouring the human genome with this algorithm enriches a select group of RNA- TAF15 binding proteins harboring a canonical RNA recognition motif (RRM) and a putative prion do- EWSR1 main. Indeed, of 210 human RRM-bearing proteins, 29 have a putative prion domain, and 12 of Amyotrophic lateral sclerosis these are in the top 60 prion candidates in the entire genome.
[Show full text]