Anti-NACA (C-Terminal) Polyclonal Antibody (DPABH-27484) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

Anti-NACA (C-terminal) polyclonal antibody (DPABH-27484) This product is for research use only and is not intended for diagnostic use.

PRODUCT INFORMATION

Antigen Description Prevents inappropriate targeting of non-secretory polypeptides to the endoplasmic reticulum (ER). Binds to nascent polypeptide chains as they emerge from the ribosome and blocks their interaction with the signal recognition particle (SRP), which normally targets nascent secretory peptides to the ER. Also reduces the inherent affinity of ribosomes for protein translocation sites in the ER membrane (M sites) By similarity. Isoform 1 and isoform 2 appear to bind DNA and play roles in transcription. May act to regulate the expression of genes involved in the development of myotubes.

Immunogen Synthetic peptide within Mouse Naca-rs (C terminal). The exact sequence is proprietary.Sequence: VMFEERICSESHLGPKAGFRKEKEVNLQELGKVELPPSWFRDLRTKYPVK

Isotype IgG

Source/Host Rabbit

Species Reactivity Mouse

Purification Immunogen affinity purified

Conjugate Unconjugated

Applications WB

Format Liquid

Size 50 μg

Buffer Constituents: 98% PBS, 2% Sucrose

Preservative None

Storage Shipped at 4°C. Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

GENE INFORMATION

45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]

Official Symbol NACA

Synonyms NACA; nascent polypeptide-associated complex alpha polypeptide; skNAC; Gm1878; AL022831; AL024382; mKIAA0363; nascent polypeptide-associated complex subunit alpha; alpha- NAC/1.9.2; alpha-NAC, muscle-specific form; nascent polypeptide-associated complex alpha subunit; nascent polypeptide-associated complex subunit alpha, muscle-specific form;

Entrez Gene ID 17938

Protein Refseq NP_001106670.1

UniProt ID P70670

Function DNA binding; TBP-class protein binding; transcription coactivator activity;

45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]