DOCSLIB.ORG

Minnesota Service Cooperatives Knowledge Bowl

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Minnesota Service Cooperatives Knowledge Bowl Minnesota Service Cooperatives Knowledge Bowl Meet #7 - HS Written Round 1 Planets 6 The Constitution Because the orbits of Mercury and Venus are closer Which word does not appear even once in the U.S. to the Sun that that of the Earth, these planets are Constitution? described as ... A. revenue A. inferior B. elections B. interior C. democracy C. superior D. impeachment D. anterior E. counterfeiting E. posterior 2 Literary Forms 7 Plurals Which line is a malediction? Which word does not have an uninflected plural? A. In Xanadu did Kubla Khan ... A. dog B. Ye flowery banks o'bonnie Doon ... B. folk C. Y'all come back real soon, ya heah! C. deer D. Cursed be he that moves my bones. D. swine E. Illiterate him quite from your memory. E. sheep 3 Coin Tossing 8 Zoology When you toss four coins, what is the probability that On what part of an animal would you find a dewlap? they all will come up tails? A. on the tail A. 1/2 B. above the ears B. 1/4 C. behind the hips C. 1/16 D. beneath the neck D. 1/32 E. adjacent to the hoof E. 1/64 4 Native Americans 9 Archaeological Geography Which tribe routinely used totem poles to represent The reservoir created by the Aswan High Dam family history? permanently flooded important archaeological sites in A. Hopi ... B. Apache A. Nubia C. Mohawk B. Nippon D. Chinook C. Assyria E. Seminole D. Vineland E. Northumbria 5 European Borders 10 Art Associations What sea is east of Bulgaria? Who is not paired with a type of art for which he was A. Red famed? B. Black A. Diego Rivera - mural C. Yellow B. Pierre Renoir - painting D. Caspian C. Alexander Calder - mobile E. Mediterranean D. Auguste Rodin - sculpture E. Frederic Remington - fresco Minnesota Service Cooperatives Knowledge Bowl Meet #7 - HS Written Round 11 Dads in Literature 16 Household Chemistry Which father is an antithesis of Atticus Finch? Which is a key ingredient of Alka Seltzer? A. Pap Finn A. ascorbic acid B. Bob Cratchit B. ethylene glycol C. Daniel Peggoty C. silicon dioxide D. Arthur Weasley D. sodium bicarbonate E. Caractacus Pott E. tetrafluoroethylene 12 A Salem Legacy 17 Zoology One historian wrote that "the Salem witchcraft was Shells, exoskeletons, and bones are ... the rock on which the ---- shattered." A. igneous A. theocracy B. foliaceous B. plutocracy C. calcareous C. aristocracy D. sanguineous D. technocracy E. diatomaceous E. gynecocracy 13 Jefferson 18 Rebels Thomas Jefferson believed that the small ---- was the The leader of the 19th century Filipino revolution was backbone of American democracy. Emilio ... A. banker A. Rivera B. farmer B. Delgado C. community C. Estevez D. manufacturer D. Martinez E. white-collar worker E. Aguinaldo 14 Duality 19 Taxation Which exhibit wave-particle duality? Sales taxes, value added taxes, and excise taxes are A. plutons types of ---- taxes. B. protons A. income C. phytons B. estate D. photons C. property E. pompons D. progressive E. consumption 15 Islands 20 Fictional Figures A tied island is connected to a mainland by a ... Historical research indicates that Nicolas Chauvin A. ria was probably a wholly fictional figure, much like B. spit which legendary Greek? C. polder A. Phidias D. tombolo B. Miles Gloriosis E. drumlin C. Pliny the Elder D. Thales of Miletus E. Archimedes of Syracuse Minnesota Service Cooperatives Knowledge Bowl Meet #7 - HS Written Round 21 Angles 26 Metallurgy Which is an example of a reflex angle? A process that prevents metals from rusting was A. 15 degrees named for what Italian? B. 33 degrees A. Luigi Galvani C. 96 degrees B. Sacco Vanzetti D. 171 degrees C. Arturo Toscanini E. 212 degrees D. Cosimo de' Medici E. Guglielmo Marconi 22 People 27 Ancient Geography Hiram Bingham was an American ... Which ancient city was built upon a delta? A. gangster A. Thebes B. engineer B. Nineveh C. architect C. Londinium D. newscaster D. Alexandria E. archaeologist E. Tenochtitlan 23 Oceania 28 Rock Boundaries Which is located farthest west in the Pacific? A boundary between two different rock types is called A. Fiji a ... B. Palau A. hem C. Easter Island B. butt D. Western Samoa C. touch E. Marshall Islands D. stripe E. contact 24 Things in the News 29 Religious Writings Much in the news in early 2017 was Trappist-1, Significant Hindu literature does not include the ... which is a(n) ... A. Ramayana A. star B. Upanishads B. monk C. Mahabharata C. comet D. Tao te Ching D. asteroid E. Bhagavad Gita E. meteoroid 25 American Law 30 Trigonometry In American law, the exclusionary rule pertains to ... Sin (a + b) = ... A. segregation A. sin (a + b) + sin (a - b) B. classified information B. cos a cos b - sin a sin b C. United States territories C. cos (a + b) + cos (a - b) D. evidence obtained improperly D. sin a cos b + cos a sin b E. access to military facilities E. cos a cos b + sin a sin b Minnesota Service Cooperatives Knowledge Bowl Meet #7 - HS Written Round 31 Treatises 36 Bad Moves for Czars Concepts underlying the English revolution of 1688 Czar Nicholas II repeatedly dissolved the ... and American revolution were suggested in the A. Diet "Treatises on Civil Government," by ... B. Duma A. John Locke C. Althing B. John Milton D. Knesset C. David Hume E. Bundestag D. Adam Smith E. Thomas Hobbes 32 Nyms 37 Injuries What kind of phrases are "toe the line", "foot the A boxer who is punch drunk may have dementia ... bill," and "face the music"? A. erotica A. eponyms B. exotica B. synonyms C. sciatica C. toponyms D. hepatica D. anatonyms E. pugilistica E. pseudonyms 33 Religious Orders 38 Kipling Sufi dervishes and Buddhist monks are examples of What name is missing in this verse by Kipling? ---- orders. They've taken his buttons off and' cut his A. vesicant stripes away, / An' they're hangin' ---- in the B. applicant mornin'. C. desiccant A. Fuzzy Wuzzy D. mendicant B. Bastian Bux E. coruscant C. Danny Deever D. Bilbo Baggins E. Captain Carrot 34 Adaptations 39 Photographic Word Problems Mass extinctions often create a number of vacant A rectangular photograph 11 by 14 inches is ecological ... surrounded by a 3 inch-wide mat. The area of the A. niches mat is ---- square inches. B. biomes A. 100 C. plumes B. 142 D. influents C. 186 E. xerophytes D. 198 E. 212 35 The Mideast 40 Historical Documents Which does not border the Persian Gulf? Which document was a foundation of the women's A. Iran rights movement? B. Qatar A. Wilmot Proviso C. Yemen B. Atlantic Charter D. Kuwait C. Ostend Manifesto E. United Arab Emirates D. Declaration of Rights E. Seneca Falls Declaration Minnesota Service Cooperatives Knowledge Bowl Meet #7 - HS Written Round 41 Household Chemistry 46 Animal Categories Easy-off largely consists of ... Piscivores are all ... A. titanium dioxide A. omnivores B. sodium hydroxide B. carnivores C. magnesium sulfate C. frugivores D. acetylsalicylic acid D. herbivores E. potassium carbonate E. insectivores 42 Greek Etymology 47 Authors What adjective derived from Greek mythology Which author spent three years in prison after being indicates something that is excellent or extremely convicted of embezzlement? delicious? A. Lew Wallace A. vestal B. Horatio Alger B. auroral C. Henry Thoreau C. martial D. Ambrose Bierce D. mercurial E. William Sydney Porter E. ambrosial 43 Heavenly Bodies 48 Surveying A main difference between asteroids and comets is How many townships are in 36 square miles? that the latter obviously ... A. 1 A. pulsate B. 2 B. oscillate C. 4 C. defoliate D. 6 D. sporulate E. 8 E. sublimate 44 Political Dominance 49 Generals The dominance or leadership of one country over Which general had command of the U.S. soldiers another is called ... who massacred at least 200 Indians at Wounded A. acrimony Knee? B. hegemony A. Nelson Miles C. parsimony B. Omar Bradley D. matrimony C. George Custer E. sanctimony D. Zachary Taylor E. William Harrison 45 Explorers 50 Oceania Sir ---- was not a British explorer. Which island is farthest north? A. Henry Stanley A. Wake B. Richard Burton B. Tahiti C. James Chadwick C. Tarawa D. James Clark Ross D. Guadalcanal E. Ernest Shackleton E. New Caledonia Minnesota Service Cooperatives Knowledge Bowl Meet #7 - HS Written Round 51 People in the News 56 Fictional Females In 2015, Abu Bakr al-Baghdadi was a self-proclaimed Who are not fictional characters? ... A. Edna Ferber and Willa Cather A. czar B. Jane Marple and Eliza Dolittle B. caliph C. Moll Flanders and Becky Sharp C. emperor D. Daisy Miller and Madeline Usher D. muezzin E. Scarlett O'Hara and Hester Prynne E. constitutional monarch 52 Bioluminescence 57 Symbol Geometry Luciferase catalyzes the oxidation of luciferin in How many degrees are in each interior angle of the bioluminescence. It is a(n) ... figure formed within a Star of David? A. gel A. 60 B. flux B. 90 C. enzyme C. 108 D. desiccator D. 120 E. electrolyte E. 135 53 Artists 58 Espionage The painting, "The Charge of the Rough Riders at Who was a double agent? San Juan Hill," was created by ... A. Kim Philby A. Grant Wood B. Gerry Adams B. James Whistler C. Edward Heath C. Norman Rockwell D. Clement Attlee D. Frederic Remington E. William Gladstone E. Thomas Gainsborough 54 Alliances 59 Loess Which was a Cold War alliance? Expansive deposits of loess are found in ... A. Holy League A. Kansas and Nebraska B. Warsaw Pact B. Tennessee and Georgia C. Little Entente C.
Load more

Recommended publications
  • Who Will Save the Redheads?
    :+2:,//6$9(7+(5('+($'6"72:$5'6$1 $17,%8//<7+(25<2)-8',&,$/5(9,(:$1' 3527(&7,212)'(02&5$&< <DQLY5R]QDL Dedicated in memory of Israeli Supreme Court Justice Mishael Cheshin, a brilliant jurist; bold protector of democracy and judi- cial independence; and a redhead. 'HPRFUDF\LVLQFULVLVWKURXJKRXWWKHZRUOG$QGFRXUWVSOD\DNH\UROHZLWKLQ WKLVSURFHVVDVDPDLQWDUJHWRISRSXOLVWOHDGHUVDQGLQOLJKWRIWKHLUDELOLW\WRKLQGHU DGPLQLVWUDWLYHOHJDODQGFRQVWLWXWLRQDOFKDQJHV)RFXVLQJRQWKHDELOLW\RIFRXUWV WREORFNFRQVWLWXWLRQDOFKDQJHVWKLV$UWLFOHDQDO\]HVWKHPDLQWHQVLRQVVLWXDWHGDW WKHKHDUWRIGHPRFUDWLFHURVLRQSURFHVVHVDURXQGWKHZRUOGWKHFRQIOLFWEHWZHHQ VXEVWDQWLYHDQGIRUPDOQRWLRQVRIGHPRFUDF\DFRQIOLFWEHWZHHQEHOLHYHUVDQGQRQ EHOLHYHUVWKDWFRXUWVFDQVDYHGHPRFUDF\DQGWKHWHQVLRQEHWZHHQVWUDWHJLFDQG OHJDOFRQVLGHUDWLRQVFRXUWVFRQVLGHUZKHQWKH\IDFHSUHVVXUHIURPSROLWLFDOEUDQFKHV $VVRFLDWH 3URIHVVRU +DUU\ 5DG]\QHU /DZ 6FKRRO ,QWHUGLVFLSOLQDU\ &HQWHU ,'& +HU]OL\D7KLV$UWLFOHLVDUHYLVHGDQGHODERUDWHGYHUVLRQRIDSDSHUSUHVHQWHGDWWKHFRQIHUHQFH ³5HIRUPD&RQVWLWXFLRQDO\'HIHQVDGHOD'HPRFUDFLD´KHOGLQ2YLHGRIURPWKHWKWRWKHVW RI0D\DQGSXEOLVKHGLQ6SDQLVKLQWKHERRN³5HIRUPD&RQVWLWXFLRQDO\'HIHQVDGHOD 'HPRFUDFLD´E\WKH&HQWURGH(VWXGLRV3ROtWLFRV\&RQVWLWXFLRQDOHVDOORIZKLFKKDVEHHQSRV VLEOHWKDQNVWRWKHUHVHDUFKJUDQWRIWKH6SDQLVK0LQLVWU\RI(FRQRP\DQG&RPSHWLWLYHQHVV 0,1(&2'(53,ZLVKWRWKDQN%HQLWR$ODH]&RUUDOIRULQYLWLQJPHWRMRLQWKLV LPSRUWDQWSURMHFWRQFRQVWLWXWLRQDODPHQGPHQWVDQGWKHGHIHQVHRIGHPRFUDF\$QHDUOLHUYHUVLRQ ZDVDOVRSUHVHQWHGDWWKH&RPSDUDWLYH&RQVWLWXWLRQDO/DZ5HVHDUFK6HPLQDU &KLQHVH8QLYHUVLW\ RI+RQJ.RQJ2FWREHU &HQWHUIRU&RPSDUDWLYHDQG3XEOLF/DZ6HPLQDU
    [Show full text]
  • Israel As a Jewish State
    ISRAEL AS A JEWISH STATE Daniel J.Elazar Beyond Israel's self-definition as a Jewish state, the question remains as to what extent Israel is a continuation of Jewish political history within the context of the Jewish political tradition. This article addresses that question, first by looking at the realities of Israel as a Jewish state and at the same time one compounded of Jews of varying ideologies and per suasions, plus non-Jews; the tensions between the desire on the part of many Israeli Jews for Israel to be a state like any other and the desire on the part of others for it to manifest its Jewishness in concrete ways that will make it unique. The article explores the ways in which the tradi tional domains of authority into which power is divided in the Jewish po litical tradition are manifested in the structure of Israel's political sys tem, both structurally and politically; relations between the Jewish reli gion, state and society; the Jewish dimension of Israel's political culture and policy-making, and how both are manifested through Israel's emerging constitution and the character of its democracy. Built into the founding of every polity are certain unresolved ten sions that are balanced one against another as part of that founding to make the existence of the polity possible, but which must be resolved anew in every generation. Among the central tensions built into the founding of the State of Israel are those that revolve around Israel as a Jewish state. on Formally, Israel is built themodern European model of central ized, reified statehood.
    [Show full text]
  • Spotlight on Parliaments in Europe
    Spotlight on Parliaments in Europe Directorate for Relations with National Parliaments - Institutional Cooperation Unit Source: Comparative Requests and Answers via European Centre for Parliamentary Research and Documentation N° 28 - March 2020 Preventive and sanitary measures in Parliaments Following the COVID-19 outbreak and its consequences on the functioning of Parliaments, many national Parliaments followed the example of the European Parliament to adopt preventive and sanitary measures. Spotlight N0 28 focusses on sanitary preventive measures, changes in the work of the Parliament, travel and visitors, and the need for a statement and medical examination when entering premises. It is based on requests 4333 and 4350 submitted by the Polish Sejm on 26 February and 13 March 2020. In total 44 chambers replied to request 4333 and 39 chambers replied to request 4350. Due to the rapidly changing context of this crisis, the current situation may vary from the one outlined in this document. For updates, please contact the editor. General trends in national Parliaments Cancellation of events, suspension of visits and travel were the main trends in most national Parliaments. 37 Chambers mentioned the introduction of hand sanitizers and 30 Chambers mentioned some form of communication to staff via email, posters or intranet. Another general trend was the request to work from home, teleworking. In many Parliaments, a ‘skeleton staff’, only those who are essential for the core business, were required to go to work. Certain groups were allowed to stay at home, either because they were vulnerable to the virus (60+, medical history, pregnant) or because they had possibly contracted the virus (travelled to an affected area, in contact with a person who got affected, feeling unwell).
    [Show full text]
  • Taxonomy of Minority Governments
    Indiana Journal of Constitutional Design Volume 3 Article 1 10-17-2018 Taxonomy of Minority Governments Lisa La Fornara [email protected] Follow this and additional works at: https://www.repository.law.indiana.edu/ijcd Part of the Administrative Law Commons, American Politics Commons, Comparative and Foreign Law Commons, Comparative Politics Commons, Constitutional Law Commons, International Law Commons, Law and Politics Commons, Legislation Commons, Public Law and Legal Theory Commons, Rule of Law Commons, and the State and Local Government Law Commons Recommended Citation La Fornara, Lisa (2018) "Taxonomy of Minority Governments," Indiana Journal of Constitutional Design: Vol. 3 , Article 1. Available at: https://www.repository.law.indiana.edu/ijcd/vol3/iss1/1 This Article is brought to you for free and open access by Digital Repository @ Maurer Law. It has been accepted for inclusion in Indiana Journal of Constitutional Design by an authorized editor of Digital Repository @ Maurer Law. For more information, please contact [email protected]. Taxonomy of Minority Governments LISA LA FORNARA INTRODUCTION A minority government in its most basic form is a government in which the party holding the most parliamentary seats still has fewer than half the seats in parliament and therefore cannot pass legislation or advance policy without support from unaffiliated parties.1 Because seats in minority parliaments are more evenly distributed amongst multiple parties, opposition parties have greater opportunity to block legislation. A minority government must therefore negotiate with external parties and adjust its policies to garner the majority of votes required to advance its initiatives.2 This paper serves as a taxonomy of minority governments in recent history and proceeds in three parts.
    [Show full text]
  • Israel: 2021 Parliamentary Election and New Coalition Government
    By Nigel Walker 14 June 2021 Israel: 2021 parliamentary election and new coalition government Summary 1 Background 2 2021 Parliamentary election commonslibrary.parliament.uk Number CBP 9189 Israel: 2021 parliamentary election and new coalition government Image Credits .Wikimedia Commons page – טימי טרנר (Israel) flag by (Timmy Turner) ישראל / image cropped. Licensed under the Creative Commons Attribution-Share Alike 4.0 International (CC BY-SA 4.0). Disclaimer The Commons Library does not intend the information in our research publications and briefings to address the specific circumstances of any particular individual. We have published it to support the work of MPs. You should not rely upon it as legal or professional advice, or as a substitute for it. We do not accept any liability whatsoever for any errors, omissions or misstatements contained herein. You should consult a suitably qualified professional if you require specific advice or information. Read our briefing ‘Legal help: where to go and how to pay’ for further information about sources of legal advice and help. This information is provided subject to the conditions of the Open Parliament Licence. Feedback Every effort is made to ensure that the information contained in these publicly available briefings is correct at the time of publication. Readers should be aware however that briefings are not necessarily updated to reflect subsequent changes. If you have any comments on our briefings please email [email protected]. Please note that authors are not always able to engage in discussions with members of the public who express opinions about the content of our research, although we will carefully consider and correct any factual errors.
    [Show full text]
  • Voter Protection Laws in National Elections
    Voter Protection Laws in National Elections Armenia • France • Germany • Haiti • Iraq • Israel Italy • Pakistan • Sweden • United Kingdom December 2012 LL File No. 2012-006966 LRA-D-PUB-000359 The Law Library of Congress, Global Legal Research Directorate (202) 707-5080 (phone) • (866) 550-0442 (fax) • [email protected] • http://www.law.gov This report is provided for reference purposes only. It does not constitute legal advice and does not represent the official opinion of the United States Government. The information provided reflects research undertaken as of the date of writing. It has not been updated. Contents Comparative Summary ....................................................................................................................1 Comparative Chart...........................................................................................................................4 Armenia............................................................................................................................................8 France.............................................................................................................................................13 Germany.........................................................................................................................................17 Haiti................................................................................................................................................21 Iraq .................................................................................................................................................24
    [Show full text]
  • The Financial Management of Visitor Groups to the National Parliaments
    BRIEFING For the CONT committee The financial management of visitor groups to the national parliaments KEY FINDINGS In most Member States, visitor’ groups are not sponsored to visit the national parliament. A visit to the national parliament is free of charge, and all the costs related to the visit, for example travel costs, accommodation and local minor expenses, need to be paid by the visitors themselves. Germany is the only country which has various kinds of programmes where visitors can be reimbursed. Members of Parliament can invite up to 200 people a year of which the travel costs are partially covered by the German Bundestag. There is also a programme which consists of more days for which all the costs related to travel and accommodation are covered by the German government. The German Bundesrat has a programme in which the 16 federal states can invite people for a visit of multiple days to Berlin. In this case the travel costs and accommodation are paid for by the Bundesrat. For all reimbursements, the rules apply that the receipts and underlying documents need to be provided to the Bundestag and Bundesrat after the visit. All documents and receipts are checked through an ex-post control. The United Kingdom has a programme in which costs are reimbursed, and this programme is funded by the commercial tours of the parliament. In this case, it can be MPs, Peers or the House of Commons or Lords who can invite visitors who are eligible for reimbursement. In Hungary, only schools can get reimbursement for their travel costs and the entry fee for the national parliament.
    [Show full text]
  • Committee on the Human Rights of Parliamentarians
    158th session of the Committee on the Human Rights of Parliamentarians Geneva, 29 January - 8 February 2019 CONTENTS Page Africa Democratic Republic of the Congo: Mr. Ne Muanda Nsemi Decision adopted by the Committee ............................................ 1 Mauritania: Mr. Biram Dah Abeid Decision adopted by the Committee ............................................ 3 Americas Colombia: Mr. Oscar Arboleda Palacio Decision adopted by the Committee ............................................ 5 Venezuela: Sixty parliamentarians Decision adopted by the Committee ............................................ 7 Asia Bangladesh: Sheikh Hasina Decision adopted by the Committee ............................................ 11 Maldives: Fifty parliamentarians Decision adopted by the Committee ............................................ 13 Europe Belarus: Mr. Victor Gonchar Decision adopted by the Committee ............................................ 16 Russian Federation: Ms. Galina Starovoitova Decision adopted by the Committee ............................................ 19 DH/2019/158/R.1 - ii - Geneva, 29 January - 8 February 2019 MENA Bahrain: Mr. Matar Ebrahim Matar Mr. Jawad Fairooz Ghuloom Decision adopted by the Committee ........................................................................... 21 Israel: Mr. Jamal Zahalka Ms. Haneen Zoabi Mr. Basel Ghattas Decision adopted by the Committee ........................................................................... 24 Kuwait: Ms. Safa Al-Hashem Decision adopted by the
    [Show full text]
  • Lista Uczestników Konferencji Korespondentów ECPRD
    List of participants Country Chamber Name Family name E-mail Parliamentary Assembly of the Horst Schade [email protected] Council of Europe Parliamentary Assembly of the Yann de Buyer [email protected] Council of Europe Parliamentary Assembly of the Kathleen Layle [email protected] Council of Europe European Parliament Christine Verger [email protected] European Parliament Ulrich Hueschen [email protected] European Parliament Jerry Hilbert [email protected] Parliament - Nationalrat and [email protected] Austria Elisabeth Dietrich-Schulz Bundesrat Azerbaijan National Assembly Mehman Namazov [email protected] Belgium Chambre des Représentants Alberik Goris [email protected] Belgium Sénat André Rezsohazy [email protected] Belgium Chambre des Représentants Marc Van Der Hulst [email protected] Bosnia- Parliamentary Assembly - House Sena Bajraktarevic [email protected] Herzegovina of Representatives Canada Parliament Joseph Jackson [email protected] Croatia Hrvatski Sabor Branka Martincic [email protected] Cyprus House of Representatives Evelyn Moridou [email protected] Czech Republic Chamber of Deputies Karel Sosna [email protected] Czech Republic Chamber of Deputies Robert Vyklicky [email protected] Denmark Folketinget Hanne Rasmussen [email protected] Denmark Folketinget Christina Ringvard [email protected] Estonia Riigikogu Margit Muul [email protected] Estonia Riigikogu Siiri Sillajöe
    [Show full text]
  • Israel: Background and U.S
    Israel: Background and U.S. Relations Jim Zanotti Specialist in Middle Eastern Affairs November 1, 2013 Congressional Research Service 7-5700 www.crs.gov RL33476 CRS Report for Congress Prepared for Members and Committees of Congress Israel: Background and U.S. Relations Summary Since Israel’s founding in 1948, successive U.S. Presidents and many Members of Congress have demonstrated a commitment to Israel’s security and to maintaining close U.S.-Israel defense, diplomatic, and economic cooperation. U.S. and Israeli leaders have developed close relations based on common perceptions of shared democratic values and religious affinities. U.S. policymakers often seek to determine how regional events and U.S. policy choices may affect Israel’s security, and Congress provides active oversight of executive branch dealings with Israel and the broader Middle East. Some Members of Congress and some analysts criticize what they perceive as U.S. support for Israel without sufficient scrutiny of its actions. Israel is a leading recipient of U.S. foreign aid and is a frequent purchaser of major U.S. weapons systems. The United States and Israel maintain close security cooperation—predicated on a U.S. commitment to maintain Israel’s “qualitative military edge” over other countries in its region. The two countries signed a free trade agreement in 1985, and the United States is Israel’s largest trading partner. For more information, see CRS Report RL33222, U.S. Foreign Aid to Israel, by Jeremy M. Sharp. Israel has many regional security concerns. Israeli leaders calling for urgent international action against Iran’s nuclear program hint at the possibility of a unilateral military strike against Iran’s nuclear facilities.
    [Show full text]
  • The National Electoral Threshold: a Comparative Review Across Countries and Over Time
    The National Electoral Threshold: A Comparative Review across Countries and over Time Written by: Judah Troen, PhD Approved by: Deena Tzadok, Head of Inter-Parliamentary Research Date: 24 Tevet 5779, 1 January 2019 Comparative Review THE KNESSET - RESEARCH & INFORMATION CENTER www.knesset.gov.il/mmm The National Electoral Threshold: A Comparative Review across Countries and over Time Table of Contents Summary .............................................................................................................................. 1 1. Introduction ................................................................................................................. 2 2. Theoretical Aspects of the Electoral Threshold ...................................................... 4 2.1 The Natural Mathematical Threshold and the Number of Seats in a District ........ 4 2.2 Justifications and reservations .................................................................................. 5 2.3 Wasted votes ................................................................................................................ 6 2.4 Joint Party Lists ............................................................................................................ 7 2.5 Frequency of Change, Pace of Adaptation, and the Political Interest .................... 8 3. Comparing the National Legal Electoral Threshold: The Single National Constituency, Electoral Districts, and the Mixed System .................................................................... 10 3.1 The Single
    [Show full text]
  • The Evolving Israel-China Relationship
    The Evolving Israel- China Relationship Shira Efron, Howard J. Shatz, Arthur Chan, Emily Haskel, Lyle J. Morris, Andrew Scobell C O R P O R A T I O N For more information on this publication, visit www.rand.org/t/RR2641 Library of Congress Cataloging-in-Publication Data is available for this publication. ISBN: 978-1-9774-0233-2 Published by the RAND Corporation, Santa Monica, Calif. © Copyright 2019 RAND Corporation R® is a registered trademark. Cover: Photo by esfera via Shutterstock. Limited Print and Electronic Distribution Rights This document and trademark(s) contained herein are protected by law. This representation of RAND intellectual property is provided for noncommercial use only. Unauthorized posting of this publication online is prohibited. Permission is given to duplicate this document for personal use only, as long as it is unaltered and complete. Permission is required from RAND to reproduce, or reuse in another form, any of its research documents for commercial use. For information on reprint and linking permissions, please visit www.rand.org/pubs/permissions. The RAND Corporation is a research organization that develops solutions to public policy challenges to help make communities throughout the world safer and more secure, healthier and more prosperous. RAND is nonprofit, nonpartisan, and committed to the public interest. RAND’s publications do not necessarily reflect the opinions of its research clients and sponsors. Support RAND Make a tax-deductible charitable contribution at www.rand.org/giving/contribute www.rand.org Preface Since the early 2000s, relations between China and Israel have expanded rapidly in numerous areas, including diplomacy, trade, investment, construction, educational partnerships, scientific coopera- tion, and tourism.
    [Show full text]