Mouse Anti-Human WSB1 Monoclonal Antibody, Clone 4F21 (CABT-B11801) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

Mouse anti-Human WSB1 monoclonal antibody, clone 4F21 (CABT-B11801) This product is for research use only and is not intended for diagnostic use.

PRODUCT INFORMATION

Immunogen WSB1 (AAH21110, 53 a.a. ~ 138 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Isotype IgG2a

Source/Host Mouse

Species Reactivity Human

Clone 4F21

Conjugate Unconjugated

Applications sELISA,ELISA

Sequence Similarities QGHRTVKLVPWSQCLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVWSLAF GSSVPEKQSRCVNIEWHRFRFG*

Format Liquid

Size 100 μg

Buffer In 1x PBS, pH 7.2

Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

BACKGROUND

Introduction This gene encodes a member of the WD-protein subfamily. This protein shares a high sequence identity to mouse and chick proteins. It contains several WD-repeats spanning most of the protein and an SOCS box in the C-terminus. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Keywords WSB1; WD repeat and SOCS box containing 1; SWIP1; WSB-1; WD repeat and SOCS box- containing protein 1; WD repeat and SOCS box-containing 1; SOCS box-containing WD protein SWiP-1;

45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]

Entrez Gene ID 26118

UniProt ID Q9Y6I7

Pathway Adaptive Immunity Signaling, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; Immune System, organism-specific biosystem

Function protein binding

45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]