Mouse anti-Human WSB1 monoclonal antibody, clone 4F21 (CABT-B11801) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Immunogen WSB1 (AAH21110, 53 a.a. ~ 138 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Isotype IgG2a Source/Host Mouse Species Reactivity Human Clone 4F21 Conjugate Unconjugated Applications sELISA,ELISA Sequence Similarities QGHRTVKLVPWSQCLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVWSLAF GSSVPEKQSRCVNIEWHRFRFG* Format Liquid Size 100 μg Buffer In 1x PBS, pH 7.2 Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. BACKGROUND Introduction This gene encodes a member of the WD-protein subfamily. This protein shares a high sequence identity to mouse and chick proteins. It contains several WD-repeats spanning most of the protein and an SOCS box in the C-terminus. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008] Keywords WSB1; WD repeat and SOCS box containing 1; SWIP1; WSB-1; WD repeat and SOCS box- containing protein 1; WD repeat and SOCS box-containing 1; SOCS box-containing WD protein SWiP-1; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved GENE INFORMATION Entrez Gene ID 26118 UniProt ID Q9Y6I7 Pathway Adaptive Immunity Signaling, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; Immune System, organism-specific biosystem Function protein binding 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.