CYP4F3 (Human) Recombinant Protein (Q01)

Total Page：16

File Type：pdf, Size：1020Kb

CYP4F3 (Human) Recombinant Protein (Q01)

Produktinformation Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien Weitere Information auf den folgenden Seiten! See the following pages for more information! Lieferung & Zahlungsart Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic CYP4F3 (Human) Recombinant cholesterol, steroids and other lipids. This protein Protein (Q01) localizes to the endoplasmic reticulum. The enzyme starts the process of inactivating and degrading Catalog Number: H00004051-Q01 leukotriene B4, a potent mediator of inflammation. This gene is part of a cluster of cytochrome P450 genes on Regulation Status: For research use only (RUO) chromosome 19. Another member of this family, CYP4F8, is approximately 18 kb away. [provided by Product Description: Human CYP4F3 partial ORF ( RefSeq] NP_000887, 100 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal. Sequence: RIFHPTYIKPVLFAPAAIVPKDKVFYSFLKPWLGDGLLL SAGEKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHA KWQLLASEGSARLDMFEHISLM Host: Wheat Germ (in vitro) Theoretical MW (kDa): 36.63 Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Preparation Method: in vitro wheat germ expression system Purification: Glutathione Sepharose 4 Fast Flow Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 4051 Gene Symbol: CYP4F3 Gene Alias: CPF3, CYP4F, LTB4H Gene Summary: This gene, CYP4F3, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of Page 1/1 Powered by TCPDF (www.tcpdf.org).

Copy Link

Recommended publications

Cytochrome P450 Enzymes in Oxygenation of Prostaglandin Endoperoxides and Arachidonic Acid
Comprehensive Summaries of Uppsala Dissertations from the Faculty of Pharmacy 231 _____________________________ _____________________________ Cytochrome P450 Enzymes in Oxygenation of Prostaglandin Endoperoxides and Arachidonic Acid Cloning, Expression and Catalytic Properties of CYP4F8 and CYP4F21 BY JOHAN BYLUND ACTA UNIVERSITATIS UPSALIENSIS UPPSALA 2000 Dissertation for the Degree of Doctor of Philosophy (Faculty of Pharmacy) in Pharmaceutical Pharmacology presented at Uppsala University in 2000 ABSTRACT Bylund, J. 2000. Cytochrome P450 Enzymes in Oxygenation of Prostaglandin Endoperoxides and Arachidonic Acid: Cloning, Expression and Catalytic Properties of CYP4F8 and CYP4F21. Acta Universitatis Upsaliensis. Comprehensive Summaries of Uppsala Dissertations from Faculty of Pharmacy 231 50 pp. Uppsala. ISBN 91-554-4784-8. Cytochrome P450 (P450 or CYP) is an enzyme system involved in the oxygenation of a wide range of endogenous compounds as well as foreign chemicals and drugs. This thesis describes investigations of P450-catalyzed oxygenation of prostaglandins, linoleic and arachidonic acids. The formation of bisallylic hydroxy metabolites of linoleic and arachidonic acids was studied with human recombinant P450s and with human liver microsomes. Several P450 enzymes catalyzed the formation of bisallylic hydroxy metabolites. Inhibition studies and stereochemical analysis of metabolites suggest that the enzyme CYP1A2 may contribute to the biosynthesis of bisallylic hydroxy fatty acid metabolites in adult human liver microsomes. 19R-Hydroxy-PGE and 20-hydroxy-PGE are major components of human and ovine semen, respectively. They are formed in the seminal vesicles, but the mechanism of their biosynthesis is unknown. Reverse transcription-polymerase chain reaction using degenerate primers for mammalian CYP4 family genes, revealed expression of two novel P450 genes in human and ovine seminal vesicles.
[Show full text]
Synonymous Single Nucleotide Polymorphisms in Human Cytochrome
DMD Fast Forward. Published on February 9, 2009 as doi:10.1124/dmd.108.026047 DMD #26047 TITLE PAGE: A BIOINFORMATICS APPROACH FOR THE PHENOTYPE PREDICTION OF NON- SYNONYMOUS SINGLE NUCLEOTIDE POLYMORPHISMS IN HUMAN CYTOCHROME P450S LIN-LIN WANG, YONG LI, SHU-FENG ZHOU Department of Nutrition and Food Hygiene, School of Public Health, Peking University, Beijing 100191, P. R. China (LL Wang & Y Li) Discipline of Chinese Medicine, School of Health Sciences, RMIT University, Bundoora, Victoria 3083, Australia (LL Wang & SF Zhou). 1 Copyright 2009 by the American Society for Pharmacology and Experimental Therapeutics. DMD #26047 RUNNING TITLE PAGE: a) Running title: Prediction of phenotype of human CYPs. b) Author for correspondence: A/Prof. Shu-Feng Zhou, MD, PhD Discipline of Chinese Medicine, School of Health Sciences, RMIT University, WHO Collaborating Center for Traditional Medicine, Bundoora, Victoria 3083, Australia. Tel: + 61 3 9925 7794; fax: +61 3 9925 7178. Email: [email protected] c) Number of text pages: 21 Number of tables: 10 Number of figures: 2 Number of references: 40 Number of words in Abstract: 249 Number of words in Introduction: 749 Number of words in Discussion: 1459 d) Non-standard abbreviations: CYP, cytochrome P450; nsSNP, non-synonymous single nucleotide polymorphism. 2 DMD #26047 ABSTRACT Non-synonymous single nucleotide polymorphisms (nsSNPs) in coding regions that can lead to amino acid changes may cause alteration of protein function and account for susceptivity to disease. Identification of deleterious nsSNPs from tolerant nsSNPs is important for characterizing the genetic basis of human disease, assessing individual susceptibility to disease, understanding the pathogenesis of disease, identifying molecular targets for drug treatment and conducting individualized pharmacotherapy.
[Show full text]
Identification of the Cytochrome P450 Enzymes Responsible for the X
FEBS Letters 580 (2006) 3794–3798 Identification of the cytochrome P450 enzymes responsible for the x-hydroxylation of phytanic acid J.C. Komen, R.J.A. Wanders* Departments of Clinical Chemistry and Pediatrics, Emma Children’s Hospital, Academic Medical Center, University of Amsterdam, Meibergdreef 9, 1105 AZ Amsterdam, The Netherlands Received 27 March 2006; revised 26 May 2006; accepted 30 May 2006 Available online 9 June 2006 Edited by Sandro Sonnino tanic acid occurs effectively by bacteria present in the rumen Abstract Patients suffering from Refsum disease have a defect in the a-oxidation pathway which results in the accumulation of of ruminants. phytanic acid in plasma and tissues. Our previous studies have Phytanic acid accumulates in patients with adult Refsum dis- shown that phytanic acid is also a substrate for the x-oxidation ease (ARD, MIM 266500) which is due to a defect in the a-oxi- pathway. With the use of specific inhibitors we now show that dation pathway caused by mutations in one of two genes members of the cytochrome P450 (CYP450) family 4 class are including the PAHX gene which codes for phytanoyl-CoA responsible for phytanic acid x-hydroxylation. Incubations with hydroxylase [2,3], and the PEX7 gene which codes for the microsomes containing human recombinant CYP450s (Super- PTS2 receptor [4]. The majority of ARD patients have muta- TM somes ) revealed that multiple CYP450 enzymes of the family tions in the PAHX gene. The increased levels of phytanic acid 4 class are able to x-hydroxylate phytanic acid with the follow- in plasma and tissues are thought to be the direct cause for the ing order of efficiency: CYP4F3A > CYP4F3B > CYP4F2 > pathology of the disease.
[Show full text]
Cytochrome P450 Expression and Activities in Human Tongue Cells and Their Modulation by Green Tea Extract
Cytochrome P450 expression and activities in human tongue cells and their modulation by green tea extract By: Shin-Pei Yang, and Gregory M. Raner Yang, S.-P. and Raner, G.M. Cytochrome P450 Expression, Induction and Activities in Human Tongue Cells and their Modulation by Green Tea Extract, Toxicol. Appl. Pharmacol. 202, 140-150 (2005). DOI: 10.1016/j.taap.2004.06.014 Made available courtesy of Elsevier: http://www.elsevier.com/wps/find/homepage.cws_home ***Reprinted with permission. No further reproduction is authorized without written permission from Elsevier. This version of the document is not the version of record. Figures and/or pictures may be missing from this format of the document.*** Abstract: The expression, inducibility, and activities of several cytochrome P450 (CYP) enzymes were investigated in a human tongue carcinoma cell model, CAL 27, and compared with the human liver model HepG2 cells. The modulation effects of green tea on various CYP isoforms in both cell lines were also examined. RT-PCR analysis of CAL 27 cells demonstrated constitutive expression of mRNA for CYPs 1A1, 1A2, 2C, 2E1, 2D6, and 4F3. The results were negative for CYP2A6, 2B6/7, 3A3/4, and 3A7. Both cell lines displayed identical expression and induction profiles for all of the isoforms examined in this study except 3A7 and 2B6/7, which were produced constitutively in HepG2 but not Cal-27 cells. CYP1A1 and 1A2 were both induced by treatment with β-napthoflavone as indicated by RT-PCR and Western blotting, while CYP2C mRNA was upregulated by all-trans retinoic acid and farnesol.
[Show full text]
Effect of Genetic Variability in the CYP4F2, CYP4F11 and CYP4F12 Genes on Liver Mrna Levels and Warfarin Response
Effect of genetic variability in the CYP4F2, CYP4F11 and CYP4F12 genes on liver mRNA levels and warfarin response J. Eunice Zhang1, Kathrin Klein2, Andrea L. Jorgensen3, Ben Francis3, Ana Alfirevic1, Stephane Bourgeois4, Panagiotis Deloukas4,5,6, Ulrich M. Zanger2 and Munir Pirmohamed1* 1Wolfson Centre for Personalized Medicine, Department of Molecular & Clinical Pharmacology, The University of Liverpool, UK 2Dr Margarete Fischer-Bosch Institute of Clinical Pharmacology, Stuttgart, and University of Tuebingen, Tuebingen, Germany. 3Department of Biostatistics, The University of Liverpool, UK 4William Harvey Research Institute, Barts and the London School of Medicine and Dentistry, Queen Mary University of London, UK 5Wellcome Trust Sanger Institute, Hinxton, Cambridge, UK. 6Princess Al-Jawhara Al-Brahim Centre of Excellence in Research of Hereditary Disorders, King Abdulaziz University, Jeddah, Saudi Arabia. Correspondence: Professor Sir Munir Pirmohamed Wolfson Centre for Personalised Medicine Department of Molecular & Clinical Pharmacology Block A: Waterhouse Buildings The University of Liverpool 1-5 Brownlow Street L69 3GL, UK [email protected] Running Title: Genotype-phenotype assessment of CYP4F12-CYP4F2-CYP4F11 region Keywords: warfarin, pharmacogenetics, mRNA expression, CYP4F2, CYP4F11, CYP4F12 1 Abstract Genetic polymorphisms in the gene encoding cytochrome P450 (CYP) 4F2, a vitamin K oxidase, affect stable warfarin dose requirements and time to therapeutic INR. CYP4F2 is part of the CYP4F gene cluster, which is highly polymorphic and exhibits a high degree of linkage disequilibrium, making it difficult to define causal variants. Our objective was to examine the effect of genetic variability in the CYP4F gene cluster on expression of the individual CYP4F genes and warfarin response. mRNA levels of the CYP4F gene cluster were quantified in human liver samples (n=149) obtained from a well characterized liver bank and fine mapping of the CYP4F gene cluster encompassing CYP4F2, CYP4F11 and CYP4F12 was performed.
[Show full text]
Expression of CYP2S1 in Human Hepatic Stellate Cells
View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Elsevier - Publisher Connector FEBS Letters 581 (2007) 781–786 Expression of CYP2S1 in human hepatic stellate cells Carylyn J. Mareka, Steven J. Tuckera, Matthew Korutha, Karen Wallacea,b, Matthew C. Wrighta,b,* a School of Medical Sciences, Institute of Medical Science, University of Aberdeen, Aberdeen, UK b Liver Faculty Research Group, School of Clinical and Laboratory Sciences, University of Newcastle, Newcastle, UK Received 22 November 2006; revised 16 January 2007; accepted 23 January 2007 Available online 2 February 2007 Edited by Laszlo Nagy the expression and accumulation of scarring extracellular Abstract Activated stellate cells are myofibroblast-like cells associated with the generation of fibrotic scaring in chronically fibrotic matrix protein [2]. It is currently thought an inhibition damaged liver. Gene chip analysis was performed on cultured fi- of fibrosis in liver diseases may be an effective approach to brotic stellate cells. Of the 51 human CYP genes known, 13 treating patients for which the cause is refractive to current CYP and 5 CYP reduction-related genes were detected with 4 treatments (e.g. in approx. 30% of hepatitis C infected CYPs (CYP1A1, CYP2E1, CY2S1 and CYP4F3) consistently patients) [2,3]. At present, there is no approved treatment for present in stellate cells isolated from three individuals. Quantita- fibrosis. tive RT-PCR indicated that CYP2S1 was a major expressed Inadvertent toxicity of drugs is often associated with a ‘‘met- CYP mRNA transcript. The presence of a CYP2A-related pro- abolic activation’’ by CYPs [1].
[Show full text]
Title Page CYP4F3B Expression Is Associated with Differentiation Of
DMD Fast Forward. Published on July 21, 2011 as DOI: 10.1124/dmd.110.036848 DMD ThisFast article Forward. has not been Published copyedited andon formatted.July 21, The 2011 final asversion doi:10.1124/dmd.110.036848 may differ from this version. DMD #36846 1 Title page CYP4F3B expression is associated with differentiation of HepaRG human hepatocytes and unaffected by fatty acid overload. Stéphanie Madec, Virginie Cerec, Emmanuelle Plée-Gautier, Joseph Antoun, Denise Glaise, Jean-Pierre Salaun, Christiane Guguen-Guillouzo and.Anne Corlu Downloaded from CNRS, UMR 7139, Station Biologique, BP74, 29682 Roscoff Cedex, France. (S.M., J-P. S.) dmd.aspetjournals.org Inserm, UMR–S 991, Liver Metabolisms and Cancer, Université de Rennes 1, CHU Rennes, avenue de la bataille Flandres-Dunkerque, 35033 Rennes, France. (V.C., D.G., C.G-G, A.C.) at ASPET Journals on October 1, 2021 Université de Bretagne Occidentale, Laboratoire de Biochimie, EA-948, Faculté de Médecine, CS 93837, 29238 Brest Cedex 3, France. (E. P-G., J.A., J-P. S) Copyright 2011 by the American Society for Pharmacology and Experimental Therapeutics. DMD Fast Forward. Published on July 21, 2011 as DOI: 10.1124/dmd.110.036848 This article has not been copyedited and formatted. The final version may differ from this version. DMD #36846 2 Running title page Running title: CYP4F3B and ω-hydroxylation of fatty acids in HepaRG cells Corresponding authors: Dr C. Guguen-Guillouzo and Dr A. Corlu, INSERM UMR-S 991, Hôpital Pontchaillou, 35033 Rennes cedex (France), Tel +33 (0)2 23 23 38 52,
[Show full text]
A Pharmacogenetic Study of Docetaxel and Thalidomide in Patients with Castration-Resistant Prostate Cancer Using the DMET Genotyping Platform
The Pharmacogenomics Journal (2010) 10, 191–199 & 2010 Nature Publishing Group All rights reserved 1470-269X/10 www.nature.com/tpj ORIGINAL ARTICLE A pharmacogenetic study of docetaxel and thalidomide in patients with castration-resistant prostate cancer using the DMET genotyping platform JF Deeken1, T Cormier2, The anticancer agent docetaxel shows significant inter-individual variation in 3 3 its pharmacokinetic and toxicity profile. Thalidomide is an active anticancer DK Price , TM Sissung , agent and also shows wide pharmacological variation. Past pharmacogenetic 4 2 SM Steinberg , K Tran , research has not explained this variation. Patients with prostate cancer DJ Liewehr4, WL Dahut3, enrolled in a randomized phase II trial using docetaxel and thalidomide X Miao2 and WD Figg3 versus docetaxel alone were genotyped using the Affymetrix DMET 1.0 platform, which tests for 1256 genetic variations in 170 drug disposition 1Lombardi Cancer Center, Georgetown University genes. Genetic polymorphisms were analyzed for associations with clinical Medical Center, Washington, DC, USA; response and toxicity. In all, 10 single-nucleotide polymorphisms (SNPs) in 2 3 Affymetrix, Inc., Santa Clara, CA, USA; Medical three genes were potentially associated with response to therapy: peroxisome Oncology Branch, National Cancer Institute, NIH, Bethesda, MD, USA and 4Biostatistics and Data proliferator-activated receptor-d (PPAR-d), sulfotransferase family, cytosolic, 1C, Management Section, National Cancer Institute, member 2 (SULT1C2) and carbohydrate (chondroitin
[Show full text]
Lipid Mediators in Immune Regulation and Resolution
LIPID MEDIATORS IN IMMUNE REGULATION AND RESOLUTION Derek W Gilroy and David Bishop-Bailey DWG: Centre for Clinical Pharmacology and Therapeutics, Division of Medicine, 5 University Street, University College London, London WC1E 6JJ, UK. DBB: Comparative Biological Sciences, Royal Veterinary College, University of London, Royal College Street, London NW1 0TU, UK. Address correspondence to DWGilroy. E-mail [email protected]; fax +020-7679- 6351 KEYWORDS: arachidonic acid, polyunsaturated fatty acids, eicosanoids, prostanoids, leukotrienes, lipoxins, epoxyeicosatrienoic acids, docosahexaenoic acid, resolvins, protectins, maresins, cytochrome p450. Running title: Lipids in inflammation The authors have no competing interests This article has been accepted for publication and undergone full peer review but has not been through the copyediting, typesetting, pagination and proofreading process which may lead to differences between this version and the Version of Record. Please cite this article as doi: 10.1111/bph.14587 This article is protected by copyright. All rights reserved. ABSTRACT We are all too familiar with the events that follow a bee sting – heat, redness, swelling and pain. These are Celsus’ four cardinal signs of inflammation that are driven by very well defined signals and hormones; in fact targeting the factors that drive this onset phase is the basis upon which most current anti-inflammatory therapies were developed. We are also very well aware that within a few hours these cardinal signs normally disappear. In other words, inflammation resolves. When it does not, inflammation persists resulting in damaging chronic conditions. While inflammatory onset is actively driven so also is its resolution – years of research has identified novel internal counter-regulatory signals that work together to switch off inflammation.
[Show full text]
Biodiversity of P-450 Monooxygenase: Cross-Talk
Cytochrome P450: Oxygen activation and biodiversty 1 Biodiversity of P-450 monooxygenase: Cross-talk between chemistry and biology Heme Fe(II)-CO complex 450 nm, different from those of hemoglobin and other heme proteins 410-420 nm. Cytochrome Pigment of 450 nm Cytochrome P450 CYP3A4…. 2 High Energy: Ultraviolet (UV) Low Energy: Infrared (IR) Soret band 420 nm or g-band Mb Fe(II) ---------- Mb Fe(II) + CO - - - - - - - Visible region Visible bands Q bands a-band, b-band b a 3 H2O/OH- O2 CO Fe(III) Fe(II) Fe(II) Fe(II) Soret band at 420 nm His His His His metHb deoxy Hb Oxy Hb Carbon monoxy Hb metMb deoxy Mb Oxy Mb Carbon monoxy Mb H2O/Substrate O2-Substrate CO Substrate Soret band at 450 nm Fe(III) Fe(II) Fe(II) Fe(II) Cytochrome P450 Cys Cys Cys Cys Active form 4 Monooxygenase Reactions by Cytochromes P450 (CYP) + + RH + O2 + NADPH + H → ROH + H2O + NADP RH: Hydrophobic (lipophilic) compounds, organic compounds, insoluble in water ROH: Less hydrophobic and slightly soluble in water. Drug metabolism in liver ROH + GST → R-GS GST: glutathione S-transferase ROH + UGT → R-UG UGT: glucuronosyltransferaseGlucuronic acid Insoluble compounds are converted into highly hydrophilic (water soluble) compounds. 5 Drug metabolism at liver: Sleeping pill, pain killer (Narcotic), carcinogen etc. Synthesis of steroid hormones (steroidgenesis) at adrenal cortex, brain, kidney, intestine, lung, Animal (Mammalian, Fish, Bird, Insect), Plants, Fungi, Bacteria 6 NSAID: non-steroid anti-inflammatory drug 7 8 9 10 11 Cytochrome P450: Cysteine-S binding to Fe(II) heme is important for activation of O2.
[Show full text]
Comparative Gene Expression of Intestinal Metabolizing Enzymes
BIOPHARMACEUTICS & DRUG DISPOSITION Biopharm. Drug Dispos. 30: 411–421 (2009) Published online 9 September 2009 in Wiley InterScience (www.interscience.wiley.com) DOI: 10.1002/bdd.675 Comparative Gene Expression of Intestinal Metabolizing Enzymes Ho-Chul Shina,Ã, Hye-Ryoung Kima, Hee-Jung Choa, Hee Yia, Soo-Min Choa, Dong-Goo Leea, A. M. Abd El-Atya, Jin-Suk Kima, Duxin Sunb and Gordon L . Amidonb aDepartment of Veterinary Pharmacology and Toxicology, Konkuk University, Seoul 143-701, Republic of Korea bDepartment of Pharmaceutical Sciences, College of Pharmacy, University of Michigan, Ann Arbor, MI 48109, USA ABSTRACT: The purpose of this study was to compare the expression profiles of drug- metabolizing enzymes in the intestine of mouse, rat and human. Total RNA was isolated from the duodenum and the mRNA expression was measured using Affymetrix GeneChip oligonucleotide arrays. Detected genes from the intestine of mouse, rat and human were ca. 60% of 22690 sequences, 40% of 8739 and 47% of 12559, respectively. Total genes of metabolizing enzymes subjected in this study were 95, 33 and 68 genes in mouse, rat and human, respectively. Of phase I enzymes, the mouse exhibited abundant gene expressions for Cyp3a25, Cyp4v3, Cyp2d26, followed by Cyp2b20, Cyp2c65 and Cyp4f14, whereas, the rat showed higher expression profiles of Cyp3a9, Cyp2b19, Cyp4f1, Cyp17a1, Cyp2d18, Cyp27a1 and Cyp4f6. However, the highly expressed P450 enzymes were CYP3A4, CYP3A5, CYP4F3, CYP2C18, CYP2C9, CYP2D6, CYP3A7, CYP11B1 and CYP2B6 in the human. For phase II enzymes, glucuronosyltransferase Ugt1a6, glutathione S-transferases Gstp1, Gstm3 and Gsta2, sulfotransferase Sult1b1 and acyltransferase Dgat1 were highly expressed in the mouse.
[Show full text]
Differential Expression of Prostaglandin I2 Synthase Associated with Arachidonic Acid Pathway in the Oral Squamous Cell Carcinoma
Hindawi Journal of Oncology Volume 2018, Article ID 6301980, 13 pages https://doi.org/10.1155/2018/6301980 Research Article Differential Expression of Prostaglandin I2 Synthase Associated with Arachidonic Acid Pathway in the Oral Squamous Cell Carcinoma Anelise Russo ,1 Patr-cia M. Biselli-Chicote ,1 Rosa S. Kawasaki-Oyama,1 Márcia M. U. Castanhole-Nunes,1 José V. Maniglia,2 Dal-sio de Santi Neto,3 Érika C. Pavarino ,1 and Eny M. Goloni-Bertollo 1 1 Department of Molecular Biology: Biological and Genetics and Molecular Biology Research Unit – UPGEM, Sao˜ Jose´ do Rio Preto Medical School – FAMERP, Sao˜ Jose´ do Rio Preto, SP 15090-000, Brazil 2Department of Otorhinolaryngology and Head and Neck Surgery, FAMERP, Sao˜ Jose´ do Rio Preto, SP 15090-000, Brazil 3Department of Pathology, FAMERP, Sao˜ Jose´ do Rio Preto, SP 15090-000, Brazil Correspondence should be addressed to Anelise Russo; [email protected] and Eny M. Goloni-Bertollo; [email protected] Received 17 July 2018; Accepted 16 October 2018; Published 8 November 2018 Academic Editor: Tomas R. Chauncey Copyright © 2018 Anelise Russo et al. Tis is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Introduction. Diferential expression of genes encoding cytochrome P450 (CYP) and other oxygenases enzymes involved in biotransformation mechanisms of endogenous and exogenous compounds can lead to oral tumor development. Objective.We aimed to identify the expression profle of these genes, searching for susceptibility biomarkers in oral squamous cell carcinoma.
[Show full text]