Bcl11b Controls Odorant Receptor Class Choice in Mice
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Whole-Genome Microarray Detects Deletions and Loss of Heterozygosity of Chromosome 3 Occurring Exclusively in Metastasizing Uveal Melanoma
Anatomy and Pathology Whole-Genome Microarray Detects Deletions and Loss of Heterozygosity of Chromosome 3 Occurring Exclusively in Metastasizing Uveal Melanoma Sarah L. Lake,1 Sarah E. Coupland,1 Azzam F. G. Taktak,2 and Bertil E. Damato3 PURPOSE. To detect deletions and loss of heterozygosity of disease is fatal in 92% of patients within 2 years of diagnosis. chromosome 3 in a rare subset of fatal, disomy 3 uveal mela- Clinical and histopathologic risk factors for UM metastasis noma (UM), undetectable by fluorescence in situ hybridization include large basal tumor diameter (LBD), ciliary body involve- (FISH). ment, epithelioid cytomorphology, extracellular matrix peri- ϩ ETHODS odic acid-Schiff-positive (PAS ) loops, and high mitotic M . Multiplex ligation-dependent probe amplification 3,4 5 (MLPA) with the P027 UM assay was performed on formalin- count. Prescher et al. showed that a nonrandom genetic fixed, paraffin-embedded (FFPE) whole tumor sections from 19 change, monosomy 3, correlates strongly with metastatic death, and the correlation has since been confirmed by several disomy 3 metastasizing UMs. Whole-genome microarray analy- 3,6–10 ses using a single-nucleotide polymorphism microarray (aSNP) groups. Consequently, fluorescence in situ hybridization were performed on frozen tissue samples from four fatal dis- (FISH) detection of chromosome 3 using a centromeric probe omy 3 metastasizing UMs and three disomy 3 tumors with Ͼ5 became routine practice for UM prognostication; however, 5% years’ metastasis-free survival. to 20% of disomy 3 UM patients unexpectedly develop metas- tases.11 Attempts have therefore been made to identify the RESULTS. Two metastasizing UMs that had been classified as minimal region(s) of deletion on chromosome 3.12–15 Despite disomy 3 by FISH analysis of a small tumor sample were found these studies, little progress has been made in defining the key on MLPA analysis to show monosomy 3. -
3B and Semaphorin-3F in Ovarian Cancer
Published OnlineFirst February 2, 2010; DOI: 10.1158/1535-7163.MCT-09-0664 Research Article Molecular Cancer Therapeutics Hormonal Regulation and Distinct Functions of Semaphorin- 3B and Semaphorin-3F in Ovarian Cancer Doina Joseph1, Shuk-Mei Ho2, and Viqar Syed1 Abstract Semaphorins comprise a family of molecules that influence neuronal growth and guidance. Class-3 sema- phorins, semaphorin-3B (SEMA3B) and semaphorin-3F (SEMA3F), illustrate their effects by forming a com- plex with neuropilins (NP-1 or NP-2) and plexins. We examined the status and regulation of semaphorins and their receptors in human ovarian cancer cells. A significantly reduced expression of SEMA3B (83 kDa), SE- MA3F (90 kDa), and plexin-A3 was observed in ovarian cancer cell lines when compared with normal human ovarian surface epithelial cells. The expression of NP-1, NP-2, and plexin-A1 was not altered in human ovar- ian surface epithelial and ovarian cancer cells. The decreased expression of SEMA3B, SEMA3F, and plexin-A3 was confirmed in stage 3 ovarian tumors. The treatment of ovarian cancer cells with luteinizing hormone, follicle-stimulating hormone, and estrogen induced a significant upregulation of SEMA3B, whereas SEMA3F was upregulated only by estrogen. Cotreatment of cell lines with a hormone and its specific antagonist blocked the effect of the hormone. Ectopic expression of SEMA3B or SEMA3F reduced soft-agar colony for- mation, adhesion, and cell invasion of ovarian cancer cell cultures. Forced expression of SEMA3B, but not SEMA3F, inhibited viability of ovarian cancer cells. Overexpression of SEMA3B and SEMA3F reduced focal adhesion kinase phosphorylation and matrix metalloproteinase-2 and matrix metalloproteinase-9 expression in ovarian cancer cells. -
DGCR8 Microprocessor Defect Characterizes Familial Multinodular Goiter with Schwannomatosis
The Journal of Clinical Investigation CLINICAL MEDICINE DGCR8 microprocessor defect characterizes familial multinodular goiter with schwannomatosis Barbara Rivera,1,2,3 Javad Nadaf,2,3 Somayyeh Fahiminiya,4 Maria Apellaniz-Ruiz,2,3,4,5 Avi Saskin,5,6 Anne-Sophie Chong,2,3 Sahil Sharma,7 Rabea Wagener,8 Timothée Revil,5,9 Vincenzo Condello,10 Zineb Harra,2,3 Nancy Hamel,4 Nelly Sabbaghian,2,3 Karl Muchantef,11,12 Christian Thomas,13 Leanne de Kock,2,3,5 Marie-Noëlle Hébert-Blouin,14 Angelia V. Bassenden,15 Hannah Rabenstein,8 Ozgur Mete,16,17 Ralf Paschke,18,19,20,21,22 Marc P. Pusztaszeri,23 Werner Paulus,13 Albert Berghuis,15 Jiannis Ragoussis,4,9 Yuri E. Nikiforov,10 Reiner Siebert,8 Steffen Albrecht,24 Robert Turcotte,25,26 Martin Hasselblatt,13 Marc R. Fabian,1,2,3,7,15 and William D. Foulkes1,2,3,4,5,6 1Gerald Bronfman Department of Oncology, McGill University, Montreal, Quebec, Canada. 2Lady Davis Institute for Medical Research and 3Segal Cancer Centre, Jewish General Hospital, Montreal, Quebec, Canada. 4Cancer Research Program, McGill University Health Centre, Montreal, Quebec, Canada. 5Department of Human Genetics, McGill University, Montreal, Quebec, Canada. 6Division of Medical Genetics, Department of Medicine, McGill University Health Centre and Jewish General Hospital, Montreal, Quebec, Canada. 7Department of Experimental Medicine, McGill University, Montreal, Quebec, Canada. 8Institute of Human Genetics, University of Ulm and University of Ulm Medical Center, Ulm, Germany. 9Génome Québec Innovation Centre, McGill University, Montreal, Quebec, Canada. 10Department of Pathology, University of Pittsburgh Medical Center, Pittsburgh, Pennsylvania, USA. 11Department of Diagnostic Radiology, McGill University, Montreal, Quebec, Canada. -
Genetic Expression and Mutational Profile Analysis in Different
Gao et al. BMC Cancer (2021) 21:786 https://doi.org/10.1186/s12885-021-08442-y RESEARCH Open Access Genetic expression and mutational profile analysis in different pathologic stages of hepatocellular carcinoma patients Xingjie Gao1,2*†, Chunyan Zhao1,2†, Nan Zhang1,2†, Xiaoteng Cui1,2,3, Yuanyuan Ren1,2, Chao Su1,2, Shaoyuan Wu1,2, Zhi Yao1,2 and Jie Yang1,2* Abstract Background: The clinical pathologic stages (stage I, II, III-IV) of hepatocellular carcinoma (HCC) are closely linked to the clinical prognosis of patients. This study aims at investigating the gene expression and mutational profile in different clinical pathologic stages of HCC. Methods: Based on the TCGA-LIHC cohort, we utilized a series of analytical approaches, such as statistical analysis, random forest, decision tree, principal component analysis (PCA), to identify the differential gene expression and mutational profiles. The expression patterns of several targeting genes were also verified by analyzing the Chinese HLivH060PG02 HCC cohort, several GEO datasets, HPA database, and diethylnitrosamine-induced HCC mouse model. Results: We identified a series of targeting genes with copy number variation, which is statistically associated with gene expression. Non-synonymous mutations mainly existed in some genes (e.g.,TTN, TP53, CTNNB1). Nevertheless, no association between gene mutation frequency and pathologic stage distribution was detected. The random forest and decision tree modeling analysis data showed a group of genes related to different HCC pathologic stages, including GAS2L3 and SEMA3F. Additionally, our PCA data indicated several genes associated with different pathologic stages, including SNRPA and SNRPD2. Compared with adjacent normal tissues, we observed a highly expressed level of GAS2L3, SNRPA, and SNRPD2 (P = 0.002) genes in HCC tissues of our HLivH060PG02 cohort. -
Identification of Transcriptional Mechanisms Downstream of Nf1 Gene Defeciency in Malignant Peripheral Nerve Sheath Tumors Daochun Sun Wayne State University
Wayne State University DigitalCommons@WayneState Wayne State University Dissertations 1-1-2012 Identification of transcriptional mechanisms downstream of nf1 gene defeciency in malignant peripheral nerve sheath tumors Daochun Sun Wayne State University, Follow this and additional works at: http://digitalcommons.wayne.edu/oa_dissertations Recommended Citation Sun, Daochun, "Identification of transcriptional mechanisms downstream of nf1 gene defeciency in malignant peripheral nerve sheath tumors" (2012). Wayne State University Dissertations. Paper 558. This Open Access Dissertation is brought to you for free and open access by DigitalCommons@WayneState. It has been accepted for inclusion in Wayne State University Dissertations by an authorized administrator of DigitalCommons@WayneState. IDENTIFICATION OF TRANSCRIPTIONAL MECHANISMS DOWNSTREAM OF NF1 GENE DEFECIENCY IN MALIGNANT PERIPHERAL NERVE SHEATH TUMORS by DAOCHUN SUN DISSERTATION Submitted to the Graduate School of Wayne State University, Detroit, Michigan in partial fulfillment of the requirements for the degree of DOCTOR OF PHILOSOPHY 2012 MAJOR: MOLECULAR BIOLOGY AND GENETICS Approved by: _______________________________________ Advisor Date _______________________________________ _______________________________________ _______________________________________ © COPYRIGHT BY DAOCHUN SUN 2012 All Rights Reserved DEDICATION This work is dedicated to my parents and my wife Ze Zheng for their continuous support and understanding during the years of my education. I could not achieve my goal without them. ii ACKNOWLEDGMENTS I would like to express tremendous appreciation to my mentor, Dr. Michael Tainsky. His guidance and encouragement throughout this project made this dissertation come true. I would also like to thank my committee members, Dr. Raymond Mattingly and Dr. John Reiners Jr. for their sustained attention to this project during the monthly NF1 group meetings and committee meetings, Dr. -
S41467-021-24841-Y.Pdf
ARTICLE https://doi.org/10.1038/s41467-021-24841-y OPEN Integrative oncogene-dependency mapping identifies RIT1 vulnerabilities and synergies in lung cancer Athea Vichas1,10, Amanda K. Riley 1,2,10, Naomi T. Nkinsi1, Shriya Kamlapurkar1, Phoebe C. R. Parrish 1,3, April Lo1,3, Fujiko Duke4, Jennifer Chen4, Iris Fung4, Jacqueline Watson4, Matthew Rees 4, Austin M. Gabel 3,5,6,7, James D. Thomas 6,7, Robert K. Bradley 3,6,7, John K. Lee1, Emily M. Hatch 1,7, ✉ Marina K. Baine8, Natasha Rekhtman8, Marc Ladanyi8, Federica Piccioni4,9 & Alice H. Berger 1,3 1234567890():,; CRISPR-based cancer dependency maps are accelerating advances in cancer precision medicine, but adequate functional maps are limited to the most common oncogenes. To identify opportunities for therapeutic intervention in other rarer subsets of cancer, we investigate the oncogene-specific dependencies conferred by the lung cancer oncogene, RIT1. Here, genome-wide CRISPR screening in KRAS, EGFR, and RIT1-mutant isogenic lung cancer cells identifies shared and unique vulnerabilities of each oncogene. Combining this genetic data with small-molecule sensitivity profiling, we identify a unique vulnerability of RIT1- mutant cells to loss of spindle assembly checkpoint regulators. Oncogenic RIT1M90I weakens the spindle assembly checkpoint and perturbs mitotic timing, resulting in sensitivity to Aurora A inhibition. In addition, we observe synergy between mutant RIT1 and activation of YAP1 in multiple models and frequent nuclear overexpression of YAP1 in human primary RIT1-mutant lung tumors. These results provide a genome-wide atlas of oncogenic RIT1 functional inter- actions and identify components of the RAS pathway, spindle assembly checkpoint, and Hippo/YAP1 network as candidate therapeutic targets in RIT1-mutant lung cancer. -
Supplementary Data
Supplemental figures Supplemental figure 1: Tumor sample selection. A total of 98 thymic tumor specimens were stored in Memorial Sloan-Kettering Cancer Center tumor banks during the study period. 64 cases corresponded to previously untreated tumors, which were resected upfront after diagnosis. Adjuvant treatment was delivered in 7 patients (radiotherapy in 4 cases, cyclophosphamide- doxorubicin-vincristine (CAV) chemotherapy in 3 cases). 34 tumors were resected after induction treatment, consisting of chemotherapy in 16 patients (cyclophosphamide-doxorubicin- cisplatin (CAP) in 11 cases, cisplatin-etoposide (PE) in 3 cases, cisplatin-etoposide-ifosfamide (VIP) in 1 case, and cisplatin-docetaxel in 1 case), in radiotherapy (45 Gy) in 1 patient, and in sequential chemoradiation (CAP followed by a 45 Gy-radiotherapy) in 1 patient. Among these 34 patients, 6 received adjuvant radiotherapy. 1 Supplemental Figure 2: Amino acid alignments of KIT H697 in the human protein and related orthologs, using (A) the Homologene database (exons 14 and 15), and (B) the UCSC Genome Browser database (exon 14). Residue H697 is highlighted with red boxes. Both alignments indicate that residue H697 is highly conserved. 2 Supplemental Figure 3: Direct comparison of the genomic profiles of thymic squamous cell carcinomas (n=7) and lung primary squamous cell carcinomas (n=6). (A) Unsupervised clustering analysis. Gains are indicated in red, and losses in green, by genomic position along the 22 chromosomes. (B) Genomic profiles and recurrent copy number alterations in thymic carcinomas and lung squamous cell carcinomas. Gains are indicated in red, and losses in blue. 3 Supplemental Methods Mutational profiling The exonic regions of interest (NCBI Human Genome Build 36.1) were broken into amplicons of 500 bp or less, and specific primers were designed using Primer 3 (on the World Wide Web for general users and for biologist programmers (see Supplemental Table 2) [1]. -
Stress Susceptibility-Specific Phenotype Associated with Different
Lisowski et al. BMC Neuroscience 2013, 14:144 http://www.biomedcentral.com/1471-2202/14/144 RESEARCH ARTICLE Open Access Stress susceptibility-specific phenotype associated with different hippocampal transcriptomic responses to chronic tricyclic antidepressant treatment in mice Pawel Lisowski1*, Grzegorz R Juszczak2, Joanna Goscik3, Adrian M Stankiewicz2, Marek Wieczorek4, Lech Zwierzchowski1 and Artur H Swiergiel5,6 Abstract Background: The effects of chronic treatment with tricyclic antidepressant (desipramine, DMI) on the hippocampal transcriptome in mice displaying high and low swim stress-induced analgesia (HA and LA lines) were studied. These mice displayed different depression-like behavioral responses to DMI: stress-sensitive HA animals responded to DMI, while LA animals did not. Results: To investigate the effects of DMI treatment on gene expression profiling, whole-genome Illumina Expres- sion BeadChip arrays and qPCR were used. Total RNA isolated from hippocampi was used. Expression profiling was then performed and data were analyzed bioinformatically to assess the influence of stress susceptibility-specific phe- notypes on hippocampal transcriptomic responses to chronic DMI. DMI treatment affected the expression of 71 genes in HA mice and 41 genes in LA mice. We observed the upregulation of Igf2 and the genes involved in neuro- genesis (HA: Sema3f, Ntng1, Gbx2, Efna5, and Rora; LA: Otx2, Rarb, and Drd1a) in both mouse lines. In HA mice, we observed the upregulation of genes involved in neurotransmitter transport, the termination of GABA and glycine ac- tivity (Slc6a11, Slc6a9), glutamate uptake (Slc17a6), and the downregulation of neuropeptide Y (Npy) and cortico- tropin releasing hormone-binding protein (Crhbp). In LA mice, we also observed the upregulation of other genes involved in neuroprotection (Ttr, Igfbp2, Prlr) and the downregulation of genes involved in calcium signaling and ion binding (Adcy1, Cckbr, Myl4, Slu7, Scrp1, Zfp330). -
(SEMA3F) Rabbit Polyclonal Antibody – TA342215
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA342215 Semaphorin 3F (SEMA3F) Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: IHC, IP, WB Recommended Dilution: IP, IHC, WB Reactivity: Human, Mouse Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for anti-Sema3f antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FIHAELIPDSAERNDDKLYFFFRERSAEAPQNPAVYARIGRICLNDDGGH Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Concentration: lot specific Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 83 kDa Gene Name: semaphorin 3F Database Link: NP_004177 Entrez Gene 20350 MouseEntrez Gene 6405 Human Q13275 Background: The function remains unknown. Synonyms: SEMA-IV; SEMA4; SEMAK Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Zebrafish: 91% Protein Families: Secreted Protein This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, -
Genetic Testing in Inherited Endocrine Disorders
Eggermann et al. Orphanet Journal of Rare Diseases (2020) 15:144 https://doi.org/10.1186/s13023-020-01420-w REVIEW Open Access Genetic testing in inherited endocrine disorders: joint position paper of the European reference network on rare endocrine conditions (Endo-ERN) Thomas Eggermann1* , Miriam Elbracht1, Ingo Kurth1, Anders Juul2,3, Trine Holm Johannsen2,3, Irène Netchine4, George Mastorakos5, Gudmundur Johannsson6, Thomas J. Musholt7, Martin Zenker8, Dirk Prawitt9, Alberto M. Pereira10, Olaf Hiort11 and on behalf of the European Reference Network on Rare Endocrine Conditions (ENDO-ERN Abstract Background: With the development of molecular high-throughput assays (i.e. next generation sequencing), the knowledge on the contribution of genetic and epigenetic alterations to the etiology of inherited endocrine disorders has massively expanded. However, the rapid implementation of these new molecular tools in the diagnostic settings makes the interpretation of diagnostic data increasingly complex. Main body: This joint paper of the ENDO-ERN members aims to overview chances, challenges, limitations and relevance of comprehensive genetic diagnostic testing in rare endocrine conditions in order to achieve an early molecular diagnosis. This early diagnosis of a genetically based endocrine disorder contributes to a precise management and helps the patients and their families in their self-determined planning of life. Furthermore, the identification of a causative (epi)genetic alteration allows an accurate prognosis of recurrence risks for family planning as the basis of genetic counselling. Asymptomatic carriers of pathogenic variants can be identified, and prenatal testing might be offered, where appropriate. Conclusions: The decision on genetic testing in the diagnostic workup of endocrine disorders should be based on their appropriateness to reliably detect the disease-causing and –modifying mutation, their informational value, and cost-effectiveness. -
2016 Nf Conference
2016 NF CONFERENCE “YOU’VE GOT THE POWER!” June 18-21, 2016 JW Marriott Austin, TX NF CONFERENCE 2 | Children’s Tumor Foundation · Ending Neurofibromatosis Through Research Dear NF Conference Attendees: Welcome to Austin—the capital of Texas, the live music capital of the world, and for these next three and a half days, the capital of NF research! We are thrilled to be with you all in such a thriving city, an ideal location for the greatest minds in NF research to congregate, collaborate, and make strides towards ending NF. This year’s 2016 NF Conference, brief neighbors of the NF Patient Forum, is based on the larger premise that you, along with the incredibly brave NF patients and their families, have the power to end NF. There are three core principles of the NF Conference that drive this premise: creating new networks and friendships for attendees; bringing patients, researchers and clinicians face- to-face, and ensuring that we at the Foundation continue to use this event as a platform to stimulate collaborative NF research, and to showcase our incredible progress. Moreover, at this Conference, there will be the first open data release in NF. It is only as a team that we can succeed! It is you, our friends and colleagues, and your dedication to NF research, who have made this progress and promise a reality. You represent the expansive, and often unpredictable spectrum that encompasses science, and within the singularly difficult realm of NF research. It is you who have made all of the accomplishments in NF since last year’s Conference possible, and it is you who will foster further accomplishments this year and beyond. -
The Ezrin Metastatic Phenotype Is Associated with the Initiation of Protein Translation
Volume 14 Number 4 April 2012 pp. 297–310 297 www.neoplasia.com The Ezrin Metastatic Phenotype Is Joseph W. Briggs*, Ling Ren*, Rachel Nguyen*, Kristi Chakrabarti*, Jessica Cassavaugh*, Associated with the Initiation of Said Rahim†, Gulay Bulut†, Ming Zhou‡, 1 Timothy D. Veenstra‡, Qingrong Chen§, Jun S. Wei§, Protein Translation Javed Khan§, Aykut Uren† and Chand Khanna* *Tumor and Metastasis Biology Section, Pediatric Oncology Branch, Center for Cancer Research, National Cancer Institute, Bethesda, MD, USA; †Lombardi Cancer Center, Georgetown University, Washington, DC, USA; ‡Laboratory of Proteomics and Analytical Technologies, Advanced Technology Program, SAIC – Frederick, Inc, National Cancer Institute - Frederick, Frederick, MD, USA; §Oncogenomics Section, Pediatric Oncology Branch, Center for Cancer Research, National Cancer Institute, Bethesda, MD, USA Abstract We previously associated the cytoskeleton linker protein, Ezrin, with the metastatic phenotype of pediatric sarcomas, including osteosarcoma and rhabdomyosarcoma. These studies have suggested that Ezrin contributes to the survival of cancer cells after their arrival at secondary metastatic locations. To better understand this role in metastasis, we undertook two noncandidate analyses of Ezrin function including a microarray subtraction of high- and low-Ezrin- expressing cells and a proteomic approach to identify proteins that bound the N-terminus of Ezrin in tumor lysates. Functional analyses of these data led to a novel and unifying hypothesis that Ezrin contributes to the efficiency of metastasis through regulation of protein translation. In support of this hypothesis, we found Ezrin to be part of the ribonucleoprotein complex to facilitate the expression of complex messenger RNA in cells and to bind with poly A binding protein 1 (PABP1; PABPC1).