A Potent in Vivo Antitumor Efficacy of Novel Recombinant Type I Interferon

Total Page:16

File Type:pdf, Size:1020Kb

Load more

Published OnlineFirst September 28, 2016; DOI: 10.1158/1078-0432.CCR-16-1386 Cancer Therapy: Preclinical Clinical Cancer Research A Potent In Vivo Antitumor Efficacy of Novel Recombinant Type I Interferon Kang-Jian Zhang1,2,3, Xiao-Fei Yin1, Yuan-Qin Yang1,4, Hui-Ling Li1, Yan-Ni Xu1, Lie-Yang Chen1, Xi-Jun Liu1, Su-Jing Yuan1, Xian-Long Fang1, Jing Xiao1, Shuai Wu1, Hai-Neng Xu1,5, Liang Chu1, Kanstantsin V. Katlinski2, Yuliya V. Katlinskaya2, Rong-Bing Guo3, Guang-Wen Wei3, Da-Cheng Wang6, Xin-Yuan Liu1,4, and Serge Y.Fuchs2 Abstract Purpose: Antiproliferative, antiviral, and immunomodulatory Results: sIFN-I displayed greater affinity for IFNAR1 (over activities of endogenous type I IFNs (IFN1) prompt the design of IFNAR2) chain of the IFN1 receptor and elicited a greater recombinant IFN1 for therapeutic purposes. However, most of the extent of IFN1 signaling and expression of IFN-inducible designed IFNs exhibited suboptimal therapeutic efficacies against genes in human cells. Unlike IFNa-2b, sIFN-I induced solid tumors. Here, we report evaluation of the in vitro and in vivo JAK–STAT signaling in mouse cells and exhibited an extend- antitumorigenic activities of a novel recombinant IFN termed sIFN-I. ed half-life in mice. Treatment with sIFN-I inhibited intra- þ Experimental Design: We compared primary and tertiary tumoral angiogenesis, increased CD8 T-cell infiltration, and structures of sIFN-I with its parental human IFNa-2b, as well as robustly suppressed growth of transplantable and genetically affinities of these ligands for IFN1 receptor chains and pharma- engineered tumors in immunodeficient and immunocompe- cokinetics. These IFN1 species were also compared for their ability tent mice. to induce JAK–STAT signaling and expression of the IFN1-stim- Conclusions: These findings define sIFN-I as a novel recom- ulated genes and to elicit antitumorigenic effects. Effects of sIFN-I binant IFN1 with potent preclinical antitumorigenic effects on tumor angiogenesis and immune infiltration were also tested against solid tumor, thereby prompting the assessment of in transplanted and genetically engineered immunocompetent sIFN-I clinical efficacy in humans. Clin Cancer Res; 23(8); 2038–49. mouse models. Ó2016 AACR. Introduction 40 years of trials, the use of IFN1 against tumors is limited by the suboptimal ratio between clinical efficacy and the severity of its Type I IFN (IFN1) family of antiviral cytokines comprises 13 side effects (6), as well as limited response rate, which is often different subtypes of IFNa, as well as IFNb, IFNe, IFNk, IFNw, etc attributed to the downregulation of IFN1 receptor (7). This (1–3). Potent antiproliferative, proapoptotic, antiangiogenic, and heterodimeric receptor complex encompassing the IFNAR1 and immunomodulatory effects of IFN1 prompted their use for anti- IFNAR2 chains mediates all effects of IFN1 on cells (8–10). Levels cancer treatment (reviewed in refs. 4, 5). However, after more than of IFN1 receptor were indeed shown to correlate with IFN1- induced growth arrest (11) and apoptosis in the tumor samples (12, 13). 1State Key Laboratory of Cell Biology, Shanghai Institute of Biochemistry and The levels of IFN1 receptor on cell surface are largely regulated Cell Biology, Shanghai Institutes for Biological Sciences, Chinese Academy of 2 by the ubiquitin-mediated internalization and degradation of Sciences, Shanghai, China. Department of Biomedical Sciences, University of – 3 IFNAR1 (10, 14 18). Downregulation of IFNAR1 can be accel- Pennsylvania, Philadelphia, Pennsylvania. Sichuan Huiyang Life Science and – Technology Corp., Chengdu, Sichuan, China. 4Xinyuan Institute of Medicine and erated in some cancers (19 22), thereby limiting the antitumori- Biotechnology, Zhejiang Sci-Tech University, Hangzhou, China. 5Department of genic effects of IFN1. Remarkably, although activation of the JAK– Radiation Oncology, University of Pennsylvania Perelman School of Medicine, STAT pathway is required for both antiviral and antitumor effects Philadelphia, Pennsylvania. 6National Laboratory of Biomacromolecules, Insti- of IFN1, lower receptor density still allows efficient antiviral tute of Biophysics, Chinese Academy of Sciences, Beijing, China. responses while impeding ability of IFN1 to suppress cell prolif- Note: Supplementary data for this article are available at Clinical Cancer eration (23). Schreiber and colleagues have proposed that Research Online (http://clincancerres.aacrjournals.org/). responses to IFN1 could be classified as "robust" (such as antiviral K.-J. Zhang, X.-F. Yin, and Y.-Q. Yang contributed equally to this article. effects) or "tunable" (such as antiproliferative or proinflamma- Corresponding Authors: Xin-Yuan Liu, Institute of Biochemistry and Cell Bio- tory), the latter being much more sensitive to receptor density logy, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, (24). Indeed, high cell-surface receptor density and maximal 320 Yue-Yang Road, Shanghai, China 200031. Phone: 8621-5492-1127; Fax: receptor occupancy by relatively high doses of ligands are required 8621-5492-1256; E-mail: [email protected]; and Serge Y. Fuchs, University of to mount an efficient antiproliferative effect (24, 25). Pennsylvania, 380 South University Avenue, Room 316 Hill, Philadelphia, PA Furthermore, the affinity of IFN1 subtypes for the extracellular 19104. Phone: 215-573-6949; Fax: 215-573-5188; E-mail: [email protected] domain of IFNAR1 correlates with the ability of these subtypes to doi: 10.1158/1078-0432.CCR-16-1386 elicit specific antiproliferative effect (26–29). Thus, antitumori- Ó2016 American Association for Cancer Research. genic efficacy of IFN1 may be optimized by increasing cell-surface 2038 Clin Cancer Res; 23(8) April 15, 2017 Downloaded from clincancerres.aacrjournals.org on September 23, 2021. © 2017 American Association for Cancer Research. Published OnlineFirst September 28, 2016; DOI: 10.1158/1078-0432.CCR-16-1386 Antitumor Effects of Recombinant Interferon sIFN-I IFNb (#: 50708-M02H), M-CSF (#: 11792-H08H), recombinant Translational Relevance type I IFN receptor subunit extracellular domain IFNAR1-EC Despite potent antitumorigenic properties of natural and (#: 13222-H08H) and IFNAR2-EC (#: 10359-H08H) were pur- pharmacologic type I IFNs (IFN1), these agents achieved only a chased from Sino Biological Inc. Recombinant B18R protein limited success in cancer therapy. This article describes the (vaccinia virus-encoded neutralizing type I interferon receptor) molecular and biological characterization of de novo engi- was purchased from eBioscience (#: 14-8185). neered and highly potent recombinant IFN (sIFN-I), which has evoked massive clinical interest and is currently undergo- Protein crystallization, data collection, and structure ing clinical trials in patients with solid tumors in Singapore determination (CTC1300056) and the United States (NCT02464007), as Crystals of super interferon (sIFN-I) were grown by the hang- well as patients with HBV in China (2009L04155). Here, we ing-drop vapor diffusion method (3 mg/mL protein concentra- present data obtained in both in vitro and in vivo settings; these tion) at 20 C with, in the buffer of 1.2 mol/L Li2SO4, 0.1 mol/L data demonstrate that sIFN-I exhibits superior pharmacody- 3-(cyclohexylamino)-1-propanesulfonic acid, pH 11.1, 0.02 namic and pharmacokinetic characteristics compared with its mol/L MgCL2. Before data collection, the crystals were equilibrat- parental human IFNa-2b species. Furthermore, studies con- ed in a solution containing paraffin oil for a few seconds, and then ducted in cells and in animals harboring transplantable and flash cooled in a liquid nitrogen stream at À173C. Original data genetically engineered tumor models reveal that sIFN-I evokes collection to 2.6 Å resolutions was conducted by using the potent antitumorigenic effects at least in part by inhibiting synchrotron radiation from beamline BL5A at a photon factory stromal angiogenesis and by stimulating antitumor immunity. in Tsukuba, Japan. Primary structural determination was achieved by a combination of molecular replacement method. The posi- tion of the sIFN-I was found by molecular replacement using PHASER with the crystal structure of IFNa (Protein Data Bank receptor density and/or by designing novel recombinant IFN1 name: IB5L) used as the search model. The final sIFN-I structure species that display a greater affinity for IFNAR1. A number of was refined by using molecular modeling techniques and a IFN1 variants were generated and shown to be effective against computerized optimization program, CNS1.1. tumor cells. For example, a mutant derivative of IFNa-2, IFNa- YNS exhibited tight binding to IFNAR1 and elicited potent proa- Surface plasmon resonance assay poptotic activity and antiproliferative/antiangiogenesis effects in On the basis of surface plasmon resonance technology, binding vivo; this mutant surpassed IFNa-2 in antitumorigenic activity in a affinities of both IFNa-2b and sIFN-I toward recombinant extra- breast cancer xenograft (28, 30). cellular (EC) domain of type I interferon receptor subunit fi Yet, another approach to increase ef cacy of IFN1 treatment is IFNAR1-EC or IFNAR2-EC were measured using the Biacore to improve its pharmacokinetics and biological activities. Various T100 Protein Interaction Array system (General Electric Health- efforts in this direction include the use of IFNa-2b-albumin Care Co.). For immobilization of the receptor subunit via binding fusion protein (31), antibody armed with IFN1 (32), and
Recommended publications
  • The C9orf72-Interacting Protein Smcr8 Is a Negative Regulator of Autoimmunity and Lysosomal Exocytosis

    The C9orf72-Interacting Protein Smcr8 Is a Negative Regulator of Autoimmunity and Lysosomal Exocytosis

    Downloaded from genesdev.cshlp.org on October 5, 2021 - Published by Cold Spring Harbor Laboratory Press The C9orf72-interacting protein Smcr8 is a negative regulator of autoimmunity and lysosomal exocytosis Yingying Zhang,1,2,3 Aaron Burberry,1,2,3 Jin-Yuan Wang,1,2,3 Jackson Sandoe,1,2,3 Sulagna Ghosh,1,2,3 Namrata D. Udeshi,4 Tanya Svinkina,4 Daniel A. Mordes,1,2,3,5 Joanie Mok,1,2,3 Maura Charlton,1,2,3 Quan-Zhen Li,6,7 Steven A. Carr,4 and Kevin Eggan1,2,3 1Department of Stem Cell and Regenerative Biology, 2Department of Molecular and Cellular Biology, Harvard University, Cambridge, Massachusetts 02138, USA; 3Stanley Center for Psychiatric Research, Broad Institute of Massachusetts Institute of Technology and Harvard, Cambridge, Massachusetts 02142, USA; 4Proteomics Platform, Broad Institute of MIT and Harvard, Cambridge, Massachusetts 02142, USA; 5Department of Pathology, Massachusetts General Hospital, Boston, Massachusetts 02114, USA; 6Department of Immunology, 7Department of Internal Medicine, University of Texas Southwestern Medical Center, Dallas, Texas 75390, USA While a mutation in C9ORF72 is the most common genetic contributor to amyotrophic lateral sclerosis (ALS), much remains to be learned concerning the function of the protein normally encoded at this locus. To elaborate further on functions for C9ORF72, we used quantitative mass spectrometry-based proteomics to identify interacting proteins in motor neurons and found that its long isoform complexes with and stabilizes SMCR8, which further enables interaction with WDR41. To study the organismal and cellular functions for this tripartite complex, we generated Smcr8 loss-of-function mutant mice and found that they developed phenotypes also observed in C9orf72 loss-of- function animals, including autoimmunity.
  • Current Therapies for Chronic Hepatitis C

    Current Therapies for Chronic Hepatitis C

    Southern Illinois University Edwardsville SPARK Pharmacy Faculty Research, Scholarship, and Creative Activity School of Pharmacy 1-2011 Current Therapies for Chronic Hepatitis C McKenzie C. Ferguson Southern Illinois University Edwardsville, [email protected] Follow this and additional works at: https://spark.siue.edu/pharmacy_fac Part of the Pharmacy and Pharmaceutical Sciences Commons Recommended Citation Ferguson, McKenzie C., "Current Therapies for Chronic Hepatitis C" (2011). Pharmacy Faculty Research, Scholarship, and Creative Activity. 4. https://spark.siue.edu/pharmacy_fac/4 This Article is brought to you for free and open access by the School of Pharmacy at SPARK. It has been accepted for inclusion in Pharmacy Faculty Research, Scholarship, and Creative Activity by an authorized administrator of SPARK. For more information, please contact [email protected],[email protected]. Chronic Hepatitis C & Current Therapies 1 Review of Chronic Hepatitis C & Current Therapies Reviews of Therapeutics Pharmacotherapy McKenzie C. Ferguson, Pharm.D., BCPS From the School of Pharmacy, Southern Illinois University Edwardsville, Department of Pharmacy Practice, Edwardsville, Illinois. Address for reprint requests : Southern Illinois University Edwardsville School of Pharmacy 220 University Park Drive, Ste 1037 Edwardsville, IL 62026-2000 Email: [email protected] Keywords : hepatitis C, HCV, ribavirin, interferon, peginterferon alfa-2a, peginterferon alfa-2b, albinterferon, taribavirin, telaprevir, therapeutic efficacy, safety The author received no sources of support in the form of grants, equipment, or drugs. Chronic Hepatitis C & Current Therapies 2 ABSTRACT Hepatitis C virus affects more than 180 million people worldwide and as many as 4 million people in the United States. Given that most patients are asymptomatic until late in disease progression, diagnostic screening and evaluation of patients that display high-risk behaviors associated with acquisition of hepatitis C should be performed.
  • 4-6 Weeks Old Female C57BL/6 Mice Obtained from Jackson Labs Were Used for Cell Isolation

    4-6 Weeks Old Female C57BL/6 Mice Obtained from Jackson Labs Were Used for Cell Isolation

    Methods Mice: 4-6 weeks old female C57BL/6 mice obtained from Jackson labs were used for cell isolation. Female Foxp3-IRES-GFP reporter mice (1), backcrossed to B6/C57 background for 10 generations, were used for the isolation of naïve CD4 and naïve CD8 cells for the RNAseq experiments. The mice were housed in pathogen-free animal facility in the La Jolla Institute for Allergy and Immunology and were used according to protocols approved by the Institutional Animal Care and use Committee. Preparation of cells: Subsets of thymocytes were isolated by cell sorting as previously described (2), after cell surface staining using CD4 (GK1.5), CD8 (53-6.7), CD3ε (145- 2C11), CD24 (M1/69) (all from Biolegend). DP cells: CD4+CD8 int/hi; CD4 SP cells: CD4CD3 hi, CD24 int/lo; CD8 SP cells: CD8 int/hi CD4 CD3 hi, CD24 int/lo (Fig S2). Peripheral subsets were isolated after pooling spleen and lymph nodes. T cells were enriched by negative isolation using Dynabeads (Dynabeads untouched mouse T cells, 11413D, Invitrogen). After surface staining for CD4 (GK1.5), CD8 (53-6.7), CD62L (MEL-14), CD25 (PC61) and CD44 (IM7), naïve CD4+CD62L hiCD25-CD44lo and naïve CD8+CD62L hiCD25-CD44lo were obtained by sorting (BD FACS Aria). Additionally, for the RNAseq experiments, CD4 and CD8 naïve cells were isolated by sorting T cells from the Foxp3- IRES-GFP mice: CD4+CD62LhiCD25–CD44lo GFP(FOXP3)– and CD8+CD62LhiCD25– CD44lo GFP(FOXP3)– (antibodies were from Biolegend). In some cases, naïve CD4 cells were cultured in vitro under Th1 or Th2 polarizing conditions (3, 4).
  • Porcine Interferon Complex and Co-Evolution with Increasing Viral Pressure After Domestication

    Porcine Interferon Complex and Co-Evolution with Increasing Viral Pressure After Domestication

    viruses Review Porcine Interferon Complex and Co-Evolution with Increasing Viral Pressure after Domestication Jordan Jennings and Yongming Sang * Department of Agricultural and Environmental Sciences, College of Agriculture, Tennessee State University, Nashville, TN 37209, USA; [email protected] * Correspondence: [email protected]; Tel.: +615-963-5183 Received: 17 May 2019; Accepted: 13 June 2019; Published: 15 June 2019 Abstract: Consisting of nearly 60 functional genes, porcine interferon (IFN)-complex represents an evolutionary surge of IFN evolution in domestic ungulate species. To compare with humans and mice, each of these species contains about 20 IFN functional genes, which are better characterized using the conventional IFN-α/β subtypes as examples. Porcine IFN-complex thus represents an optimal model for studying IFN evolution that resulted from increasing viral pressure during domestication and industrialization. We hypothesize and justify that porcine IFN-complex may extend its functionality in antiviral and immunomodulatory activity due to its superior molecular diversity. Furthermore, these unconventional IFNs could even confer some functional and signaling novelty beyond that of the well-studied IFN-α/β subtypes. Investigations into porcine IFN-complex will further our understanding of IFN biology and promote IFN-based therapeutic designs to confront swine viral diseases. Keywords: interferon; immune evolution; antiviral; porcine model 1. Introduction Interferons (IFNs) are a group of cytokines that have evolved in jawed vertebrates and bear a pivotal role in antiviral regulation as well as other biological functions [1–4]. Three types of IFNs, namely Type I, II, and III IFNs, have been defined based on their molecular signatures, interacting receptors, and signaling propensities in immune regulation [3,4].
  • Interferon-Based Biopharmaceuticals: Overview on the Production, Purification, and Formulation

    Interferon-Based Biopharmaceuticals: Overview on the Production, Purification, and Formulation

    Review Interferon-Based Biopharmaceuticals: Overview on the Production, Purification, and Formulation Leonor S. Castro 1,†, Guilherme S. Lobo 1,†, Patrícia Pereira 2 , Mara G. Freire 1 ,Márcia C. Neves 1,* and Augusto Q. Pedro 1,* 1 CICECO–Aveiro Institute of Materials, Chemistry Department, University of Aveiro, Campus Universitário de Santiago, 3810-193 Aveiro, Portugal; [email protected] (L.S.C.); [email protected] (G.S.L.); [email protected] (M.G.F.) 2 Centre for Mechanical Engineering, Materials and Processes, Department of Chemical Engineering, University of Coimbra, Rua Sílvio Lima-Polo II, 3030-790 Coimbra, Portugal; [email protected] * Correspondence: [email protected] (M.C.N.); [email protected] (A.Q.P.) † These authors contributed equally to this work. Abstract: The advent of biopharmaceuticals in modern medicine brought enormous benefits to the treatment of numerous human diseases and improved the well-being of many people worldwide. First introduced in the market in the early 1980s, the number of approved biopharmaceutical products has been steadily increasing, with therapeutic proteins, antibodies, and their derivatives accounting for most of the generated revenues. The success of pharmaceutical biotechnology is closely linked with remarkable developments in DNA recombinant technology, which has enabled the production of proteins with high specificity. Among promising biopharmaceuticals are interferons, first described by Isaacs and Lindenmann in 1957 and approved for clinical use in humans nearly thirty years later. Interferons are secreted autocrine and paracrine proteins, which by regulating several biochemical Citation: Castro, L.S.; Lobo, G.S.; pathways have a spectrum of clinical effectiveness against viral infections, malignant diseases, Pereira, P.; Freire, M.G.; Neves, M.C.; and multiple sclerosis.
  • 2018 Award Recipients

    2018 Award Recipients

    AWARD RECIPIENTS 1 CREATING A BRIGHTER FUTURE FOR RHEUMATOLOGY The Rheumatology Research Foundation is committed to improving care for the more than 54 million Americans affected by arthritis or other forms of rheumatic disease. The Foundation’s extensive awards program helps patients by increasing the number of rheumatology health professionals while also funding research advancements that lead to new treatments and cures. For more than two decades, the Foundation has supported high-quality clinical and translational research as well as education and training programs. In the coming fiscal year (July 1, 2018 – June 30, 2019), the Foundation has committed to fund more than $9.4 million to rheumatology research and training. About half of those awards will support efforts to recruit and train the next generation of rheumatology professionals, which decreases patient wait times and increases access to rheumatology care. The remaining funds will be awarded to advance research projects that lead to breakthroughs in treating people with rheumatic diseases. In all, the Foundation has committed more than $161 million to fund more than 3,400 awards since 1985, making it the largest private funding source of rheumatology research and training in the United States. Congratulations to the Foundation’s latest award recipients. Their work is vital to creating a brighter future for the field of rheumatology and for the people impacted by rheumatic disease. BRYCE A. BINSTADT, MD, PHD CHAIR, SCIENTIFIC ADVISORY COUNCIL ASSOCIATE PROFESSOR OF PEDIATRICS AND A DISTINGUISHED UNIVERSITY TEACHING PROFESSOR, DIVISION OF PEDIATRIC RHEUMATOLOGY, UNIVERSITY OF MINNESOTA MEDICAL SCHOOL 2 TABLE OF CONTENTS 04 INNOVATIVE RESEARCH AWARDS 13 CAREER DEVELOPMENT RESEARCH AWARDS 14 CAREER DEVELOPMENT BRIDGE FUNDING AWARD: K BRIDGE 15 CAREER DEVELOPMENT BRIDGE FUNDING AWARD: K SUPPLEMENT 16 CAREER DEVELOPMENT BRIDGE FUNDING AWARD: R BRIDGE 18 INVESTIGATOR AWARD 21 SCIENTIST DEVELOPMENT AWARD 29 TOBÉ AND STEPHEN E.
  • IFNK (NM 020124) Human Tagged ORF Clone Product Data

    IFNK (NM 020124) Human Tagged ORF Clone Product Data

    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC221055L4 IFNK (NM_020124) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: IFNK (NM_020124) Human Tagged ORF Clone Tag: mGFP Symbol: IFNK Synonyms: IFNT1; INFE1 Vector: pLenti-C-mGFP-P2A-Puro (PS100093) E. coli Selection: Chloramphenicol (34 ug/mL) Cell Selection: Puromycin ORF Nucleotide The ORF insert of this clone is exactly the same as(RC221055). Sequence: Restriction Sites: SgfI-MluI Cloning Scheme: ACCN: NM_020124 ORF Size: 621 bp This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 IFNK (NM_020124) Human Tagged ORF Clone – RC221055L4 OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_020124.1 RefSeq Size: 1164 bp RefSeq ORF: 624 bp Locus ID: 56832 UniProt ID: Q9P0W0 Protein Families: Druggable Genome, Secreted Protein, Transmembrane Protein Pathways: Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway, RIG-I-like receptor signaling pathway MW: 22.1 kDa Gene Summary: This gene encodes a member of the type I interferon family.
  • Genome-Scale Activation Screen Identifies a Lncrna Locus Regulating a Gene Neighbourhood Julia Joung1,2,3,4, Jesse M

    Genome-Scale Activation Screen Identifies a Lncrna Locus Regulating a Gene Neighbourhood Julia Joung1,2,3,4, Jesse M

    LETTER doi:10.1038/nature23451 Genome-scale activation screen identifies a lncRNA locus regulating a gene neighbourhood Julia Joung1,2,3,4, Jesse M. Engreitz2, Silvana Konermann2,3,4†, Omar O. Abudayyeh2,3,4,5, Vanessa K. Verdine2,3, Francois Aguet2, Jonathan S. Gootenberg2,3,4,6, Neville E. Sanjana2,3,4†, Jason B. Wright2,3,4, Charles P. Fulco2,6, Yuen-Yi Tseng2, Charles H. Yoon7, Jesse S. Boehm2, Eric S. Lander2,6,8 & Feng Zhang1,2,3,4 Mammalian genomes contain thousands of loci that transcribe long genes, one of which confers the resistance phenotype. Our screening noncoding RNAs (lncRNAs)1,2, some of which are known to carry and characterization approach provides a CRISPR toolkit with out critical roles in diverse cellular processes through a variety of which to systematically discover the functions of noncoding loci and mechanisms3–8. Although some lncRNA loci encode RNAs that elucidate their diverse roles in gene regulation and cellular function. act non-locally (in trans)5, there is emerging evidence that many We have previously used the Cas9 synergistic activation mediator lncRNA loci act locally (in cis) to regulate the expression of nearby (SAM) to screen for protein-coding genes that confer resistance to genes—for example, through functions of the lncRNA promoter, the BRAF inhibitor vemurafenib in melanoma cells9, making this an transcription, or transcript itself3,6–8. Despite their potentially ideal phenotype for screening lncRNA loci (Supplementary Note 1). important roles, it remains challenging to identify functional We designed a genome-scale single guide RNA (sgRNA) library lncRNA loci and distinguish among these and other mechanisms.
  • Regulation of Type I Interferons in Health and Autoimmune Disease

    Regulation of Type I Interferons in Health and Autoimmune Disease

    Regulation of type I interferons in health and autoimmune disease Antonios Psarras Submitted in accordance with the requirements for the degree of Doctor of Philosophy (PhD) University of Leeds Leeds Institute of Rheumatic and Musculoskeletal Medicine September 2018 i Intellectual property and publication statements The candidate confirms that the work submitted is his own, except where work which has formed part of jointly-authored publications has been included. The contribution of the candidate and the other authors to this work has been explicitly indicated below. The candidate confirms that appropriate credit has been given within the thesis where reference has been made to the work of others. Chapter 1 includes data from a jointly-authored publication: Psarras A, Emery P, Vital EM. Type I interferon-mediated autoimmune diseases: pathogenesis, diagnosis and targeted therapy. Rheumatology (Oxford). 2017;56(10):1662-75. Psarras A performed the review of literature, critically appraised scientific evidences of the relevant topics and led the writing of the manuscripts. Emery revised the manuscripts for important intellectual content and final approval of the manuscript. Chapter 3 includes data from two jointly-authored publications: El-Sherbiny YM*, Psarras A*, Yusof MYM, Hensor EMA, Tooze R, Doody G, et al. A novel two-score system for interferon status segregates autoimmune diseases and correlates with clinical features. Sci Rep. 2018;8(1):5793. *joint first author El-Sherbiny YM, Emery P, and Vital EM performed conception and design
  • Genetic Regulation of Tmem106b in the Pathogenesis of Frontotemporal Lobar Degeneration

    Genetic Regulation of Tmem106b in the Pathogenesis of Frontotemporal Lobar Degeneration

    University of Pennsylvania ScholarlyCommons Publicly Accessible Penn Dissertations 2017 Genetic Regulation Of Tmem106b In The Pathogenesis Of Frontotemporal Lobar Degeneration Michael Gallagher University of Pennsylvania, [email protected] Follow this and additional works at: https://repository.upenn.edu/edissertations Part of the Genetics Commons, Molecular Biology Commons, and the Neuroscience and Neurobiology Commons Recommended Citation Gallagher, Michael, "Genetic Regulation Of Tmem106b In The Pathogenesis Of Frontotemporal Lobar Degeneration" (2017). Publicly Accessible Penn Dissertations. 2294. https://repository.upenn.edu/edissertations/2294 This paper is posted at ScholarlyCommons. https://repository.upenn.edu/edissertations/2294 For more information, please contact [email protected]. Genetic Regulation Of Tmem106b In The Pathogenesis Of Frontotemporal Lobar Degeneration Abstract Neurodegenerative diseases are an emerging global health crisis, with the projected global cost of dementia alone expected to exceed $1 trillion, or >1% of world GDP, by 2018. However, there are no disease-modifying treatments for the major neurodegenerative diseases, such as Alzheimer’s disease, Parkinson’s disease, frontotemporal lobar degeneration (FTLD), and amyotrophic lateral sclerosis. Therefore, there is an urgent need for a better understanding of the pathophysiology underlying these diseases. While genome-wide association studies (GWAS) have identified ~200 genetic ariantsv that are associated with risk of developing neurodegenerative disease, the biological mechanisms underlying these associations are largely unknown. This dissertation investigates the mechanisms by which common genetic variation at TMEM106B, a GWAS-identified risk locus for FTLD, influences disease risk. First, using genetic and clinical data from thirty American and European medical centers, I demonstrate that the TMEM106B locus acts as a genetic modifier of a common Mendelian form of FTLD.
  • IFNK Monoclonal Antibody (M01), Expressed in Keratinocytes and the Gene Is Found on Clone 1B7 Chromosome 9, Adjacent to the Type I Interferon Cluster

    IFNK Monoclonal Antibody (M01), Expressed in Keratinocytes and the Gene Is Found on Clone 1B7 Chromosome 9, Adjacent to the Type I Interferon Cluster

    IFNK monoclonal antibody (M01), expressed in keratinocytes and the gene is found on clone 1B7 chromosome 9, adjacent to the type I interferon cluster. [provided by RefSeq] Catalog Number: H00056832-M01 References: Regulatory Status: For research use only (RUO) 1. High risk HPV repress constitutive interferon-kappa transcription via E6 to prevent pathogen recognition Product Description: Mouse monoclonal antibody receptor and antiviral gene expression. Reiser J, Hurst J, raised against a partial recombinant IFNK. Voges M, Kraus P, Munch P, Iftner T, Stubenrauch F. J Virol. 2011 Aug 17. [Epub ahead of print] Clone Name: 1B7 2. Epigenetic silencing of interferon-kappa in human papillomavirus type 16-positive cells. Rincon-Orozco B, Immunogen: IFNK (NP_064509, 35 a.a. ~ 129 a.a) Halec G, Rosenberger S, Muschik D, Nindl I, Bachmann partial recombinant protein with GST tag. MW of the A, Ritter TM, Dondog B, Ly R, Bosch FX, Zawatzky R, GST tag alone is 26 KDa. Rosl F. Cancer Res. 2009 Nov 15;69(22):8718-25. Epub 2009 Nov 3. Sequence: VHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQE FLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKE RHLKQIQIGLDQQAEYLNQCL Host: Mouse Reactivity: Human Applications: ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Isotype: IgG2a Kappa Storage Buffer: In 1x PBS, pH 7.4 Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 56832 Gene Symbol: IFNK Gene Alias: RP11-27J8.1 Gene Summary: This gene encodes a member of the type I interferon family.
  • Unique Responses of the Avian Macrophage to Different Species of Eimeria Rami A

    Unique Responses of the Avian Macrophage to Different Species of Eimeria Rami A

    Molecular Immunology 44 (2007) 558–566 Unique responses of the avian macrophage to different species of Eimeria Rami A. Dalloul a,1, Travis W. Bliss b,1, Yeong-Ho Hong a, Imed Ben-Chouikha a, Dong Woon Park a, Calvin L. Keeler b, Hyun S. Lillehoj a,∗ a Animal Parasitic Diseases Laboratory, Animal and Natural Resources Institute, USDA Agricultural Research Service, Bldg. 1040, BARC-East, Beltsville, MD 20705, United States b Department of Animal and Food Sciences, College of Agriculture and Natural Resources, University of Delaware, Newark, DE 19716, United States Received 6 January 2006; received in revised form 7 February 2006; accepted 9 February 2006 Available online 24 March 2006 Abstract Coccidiosis is recognized as the major parasitic disease of poultry and is caused by the apicomplexan protozoa Eimeria. Increasing evidence shows the complexity of the host immune response to Eimeria and microarray technology presents a powerful tool for the study of such an intricate biological process. Using an avian macrophage microarray containing 4906 unique gene elements, we identified important host genes whose expression changed following infection of macrophages with sporozoites of Eimeria tenella (ET), Eimeria acervulina (EA), and Eimeria maxima (EM). This approach enabled us to identify a common core of 25 genetic elements whose transcriptional expression is induced or repressed by exposure to Eimeria sporozoites and to identify additional transcription patterns unique to each individual Eimeria species. Besides inducing the expression of IL-1␤, IL-6, and IL-18 and repressing the expression of IL-16, Eimeria treated macrophages were commonly found to induce the expression of the CCL chemokine family members macrophage inflammatory protein (MIP)-1␤ (CCLi1), K203 (CCLi3), and ah221 (CCLi7).