IFNK Monoclonal Antibody (M01), Expressed in Keratinocytes and the Gene Is Found on Clone 1B7 Chromosome 9, Adjacent to the Type I Interferon Cluster

IFNK monoclonal antibody (M01), expressed in keratinocytes and the gene is found on clone 1B7 chromosome 9, adjacent to the type I interferon cluster. [provided by RefSeq] Catalog Number: H00056832-M01 References: Regulatory Status: For research use only (RUO) 1. High risk HPV repress constitutive interferon-kappa transcription via E6 to prevent pathogen recognition Product Description: Mouse monoclonal antibody receptor and antiviral gene expression. Reiser J, Hurst J, raised against a partial recombinant IFNK. Voges M, Kraus P, Munch P, Iftner T, Stubenrauch F. J Virol. 2011 Aug 17. [Epub ahead of print] Clone Name: 1B7 2. Epigenetic silencing of interferon-kappa in human papillomavirus type 16-positive cells. Rincon-Orozco B, Immunogen: IFNK (NP_064509, 35 a.a. ~ 129 a.a) Halec G, Rosenberger S, Muschik D, Nindl I, Bachmann partial recombinant protein with GST tag. MW of the A, Ritter TM, Dondog B, Ly R, Bosch FX, Zawatzky R, GST tag alone is 26 KDa. Rosl F. Cancer Res. 2009 Nov 15;69(22):8718-25. Epub 2009 Nov 3. Sequence: VHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQE FLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKE RHLKQIQIGLDQQAEYLNQCL

Host: Mouse

Reactivity: Human

Applications: ELISA, WB-Re (See our web site product page for detailed applications information)

Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols

Isotype: IgG2a Kappa

Storage Buffer: In 1x PBS, pH 7.4

Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Entrez GeneID: 56832

Gene Symbol: IFNK

Gene Alias: RP11-27J8.1

Gene Summary: This gene encodes a member of the type I interferon family. Type I interferons are a group of related glycoproteins that play an important role in host defenses against viral infections. This protein is

Page 1/1