Gene Polymorphisms That Can Predict Response to Anti-TNF Therapy in Patients with Psoriasis and Related Autoimmune Diseases

Total Page:16

File Type:pdf, Size:1020Kb

Gene Polymorphisms That Can Predict Response to Anti-TNF Therapy in Patients with Psoriasis and Related Autoimmune Diseases The Pharmacogenomics Journal (2013) 13, 297–305 & 2013 Macmillan Publishers Limited All rights reserved 1470-269X/13 www.nature.com/tpj REVIEW Gene polymorphisms that can predict response to anti-TNF therapy in patients with psoriasis and related autoimmune diseases R Prieto-Pe´ rez1, T Cabaleiro1, E Daude´n2 and F Abad-Santos1 Psoriasis (Ps) is a chronic inflammatory disease with an important genetic component. It shares pathophysiological mechanisms with other autoimmune diseases such as psoriatic arthritis (PsA), rheumatoid arthritis (RA) and Crohn’s disease (CD). These conditions can be treated using biological drugs such as infliximab, adalimumab and etanercept, which selectively block the proinflammatory cytokine tumor necrosis factor (TNF)-a. Although these agents have greatly improved the prognosis of Ps, PsA, RA and CD, they do not cure the disease and are expensive; in addition, significant proportions of patients do not respond or develop serious adverse effects. Therefore, it is important to investigate biomarkers, such as gene polymorphisms, that can predict which patients will respond best to a specific drug. Some polymorphisms in genes TNF, TNF receptor superfamily 1B (TNFR1B) and TNFa-induced protein 3 gene (TNFAIP3) have been associated with response to anti-TNF therapy in patients with Ps. The present article reviews other polymorphisms that could also play a role in prediction of response to these treatments. The Pharmacogenomics Journal (2013) 13, 297–305; doi:10.1038/tpj.2012.53; published online 22 January 2013 Keywords: gene polymorphisms; psoriasis; etanercept; adalimumab; infliximab INTRODUCTION Medicines Agency, an 8-to-12-weeks study is generally sufficient 11,12 Psoriasis (Ps) is a chronic inflammatory disease with a multi- to show short-term efficacy. factorial origin that has a considerable impact on health-care. The anti-TNF agents are effective in the treatment of Ps (XPASI- Cytokines have an important role in the pathogenesis of the 75 in 50–80% of patients at 12 weeks). However, these drugs are disease by mediating intercellular communication between not effective in all patients and do not cure the disease. Moreover, 13,14 immune cells that infiltrate the skin and keratinocytes.1 The they are expensive and can also produce long-term toxicity. prevalence of Ps varies with geographic location and has been Consequently, it is necessary to further investigate the reported to range from 1%–3%.2,3 pathogenesis of Ps to find new therapeutic targets that enable Family and twin studies show that genetic predisposition the development of more effective drugs. It is also important to has a major role in the development of Ps.4 In addition, several search for new biomarkers, in particular, genetic polymorphisms studies have reported that environmental factors can trigger that can predict which patients will respond to a specific drug. the disease.5 Identification of pharmacogenetic markers that allow us to treat Genome-wide association studies (GWAS) have uncovered only those patients who will respond without the risk of adverse several Ps-related chromosomal regions, such as the receptors events would significantly optimize the efficiency of therapy and for interleukin (IL)-23 and IL-12B.6,7 The major histocompatibility reduce costs. complex human leukocyte antigen-Cw6 region, however, has This review is based on current knowledge of the genetic basis been consistently associated with Ps (present in 67% of patients of the pathogenesis of Ps and of the relationship between Ps and versus 15% of the general population).8 other autoimmune diseases (PsA, RA and CD). We examined the Ps is a complex disease that can occur simultaneously with association between these diseases and response to biological other inflammatory disorders such as psoriatic arthritis (PsA) in treatments. We propose to identify genetic biomarkers that could 10–30% of cases.2 In addition, Ps shares pathophysiological possibly be associated with response to the treatment of Ps with mechanisms with PsA, rheumatoid arthritis (RA) and Crohn’s anti-TNF. disease (CD). These disorders involve a strong genetic component and can be treated with the drugs used to treat Ps.9,10 Several agents are available for the treatment of Ps, including biologics that selectively block tumor necrosis factor (TNF)-a (infliximab, IMMUNOPATHOGENESIS AND GENETICS OF PS AND RELATED adalimumab and etanercept). AUTOIMMUNE DISEASES The regular tool for assessing efficacy of treatment of Ps in Failure of the immune system to recognize autologous tissues or clinical trials is Ps area and severity index (PASI) score. The components of the immune system as self leads to inflammation, European Medicines Agency has recognized PASI-75 response injury and death of healthy cells, as well as onset of autoimmune (75% improvement from baseline PASI) as an indicator for severe diseases such as Ps, PsA, RA and CD. The exact cause of loss of Ps response to treatment in clinical trials. According to European recognition of self is not well known. 1Service of Clinical Pharmacology, Hospital Universitario de la Princesa, Instituto Teo´ filo Hernando, Universidad Auto´noma de Madrid, Instituto de Investigacio´ n Sanitaria Princesa (IP), Madrid, Spain and 2Service of Dermatology, Hospital Universitario de la Princesa, Instituto de Investigacio´n Sanitaria Princesa (IP), Madrid, Spain. Correspondence: R Prieto- Pe´rez Service of Clinical Pharmacology, Hospital Universitario de la Princesa, Instituto Teo´filo Hernando, Instituto de Investigacio´n Sanitaria Princesa (IP), C/Diego de Leo´n, 62, Madrid 28006, Spain. E-mail: [email protected] Received 6 August 2012; revised 24 October 2012; accepted 16 November 2012; published online 22 January 2013 Gene polymorphisms in response to anti-TNF therapy R Prieto-Pe´rez et al 298 Several studies have associated Ps, PsA, RA and CD with an activation into Th1 that produce IFN-g. Other cytokines produced immune response involving the helper T cells Th1 and Th17 that is by APCs include IL-19, IL-20 and IL-24, which cause alteration of triggered by bacterial infection or an environmental stimulus.15 keratinocytes in psoriatic skin.1 Antigens cross the epithelium through cells and are phagocytized IL-18 maintains the response of Th1, whose production is by antigen-presenting cells (APCs) such as macrophages and increased in CD.23 Th1 cells develop mainly as a result of cytokine dendritic cells. Naive CD4 þ T cells become activated by cytokines IL-12 production by macrophages and increased production such as TNF-a, IL-1, IL-6 and chemokines and inflammatory of IFN-g by T cells.16 Recent studies have associated polymor- molecules released by APCs after an environmental stimulus or phisms in IL-12B (rs6887695 and rs3212227) with Ps in Caucasian infection (Figure 1). patients.7 These findings have been confirmed elsewhere,6,24–26 The influx of activated leukocytes and monocytes leads to the and single-nucleotide polymorphisms (SNPs) have been detected production of inflammatory mediators that amplify inflammation in Caucasian patients with CD,27,28 PsA29,30 and RA.31 However, and cause tissue injury.16 IL-1, IL-6 and TNF-a are the major APCs Varade et al.32 found no association between these SNPs and RA, derived from the cytokines present in the rheumatoid joint. All of although their data suggest that IL-23R contributes to the etiology these agents cause aberrant activation of osteoclasts and joint of RA (Table 1). erosion in patients with RA.15,17,18 Activated Th1 also increase production of TNF-a, which acts on Increased levels of proinflammatory cytokines (TNF-a, IL-6 and intestinal fibroblasts and leads to the release of IL-13 and IL-1b), favoring the recruitment of leukocytes intensify the transforming growth factor-b (TGF-b), which causes fibrosis and inflammatory response.19 These cytokines have a major role in stricture formation in CD.33 the perpetuation of intestinal inflammation in CD, resulting in an The role of IL-13 and IL-4 is unclear, although genetic variations imbalance between proinflammatory and anti-inflammatory may result in deregulation of the Th1 and Th17 pathways.34 SNPs in cytokines.20 They also have an important role in the mechanism the IL-13 gene (rs2054, rs848 and rs1800925) have been associated of arthritic bone destruction, because they induce the receptor with Ps31,35,36 and PsA.37 Eder et al.38 associated these polymorphisms activator of NF-kB (RANK) in synovial fibroblasts, which require with increased susceptibility to PsA in patients with Ps. RANK ligand (RANKL) to trigger the differentiation of osteoclast The SNPs rs20541 and rs1800925 were found to be closely precursor cells into activated osteoclasts. This process results in associated with susceptibility to PsA. However, Bowes et al.39 bone resorption and the eventual manifestation of PsA.21 T cells found that neither was significantly associated with susceptibility also express RANKL. In contrast, levels of interferon-g (IFN-g), a to Ps vulgaris. Li et al.40 suggested that the most significant 5q31 potent RANKL inhibitor produced by T cells, are very low. This variants (including rs1800925 in the IL-13 gene) associated with Ps imbalance may be responsible for the aberrant activation of were not significant in CD. Therefore, association with CD and Ps osteoclast formation in arthritis.22 in this region seems to result from the presence of different Activated APCs release other proinflammatory cytokines such as variants. As for RA, the results of Marinou et al.41 indicated that IL-12, IL-18, IL-15, IL-6 and IL-8, and, together with TNF-a and IL-1, common variants of the IL-4/IL-13 pathway did not significantly they acquire the ability to drive T-cell differentiation and contribute to susceptibility to this disease. Environmental factors, Bacteria Epithelium -Defensin-2 Joint inflammation, enthesitis, cytokine-induced + Antigen osteoclastogenesis, bone resorption by CD68 IL-4, IL-13 osteoclast in PsA.
Recommended publications
  • The C9orf72-Interacting Protein Smcr8 Is a Negative Regulator of Autoimmunity and Lysosomal Exocytosis
    Downloaded from genesdev.cshlp.org on October 5, 2021 - Published by Cold Spring Harbor Laboratory Press The C9orf72-interacting protein Smcr8 is a negative regulator of autoimmunity and lysosomal exocytosis Yingying Zhang,1,2,3 Aaron Burberry,1,2,3 Jin-Yuan Wang,1,2,3 Jackson Sandoe,1,2,3 Sulagna Ghosh,1,2,3 Namrata D. Udeshi,4 Tanya Svinkina,4 Daniel A. Mordes,1,2,3,5 Joanie Mok,1,2,3 Maura Charlton,1,2,3 Quan-Zhen Li,6,7 Steven A. Carr,4 and Kevin Eggan1,2,3 1Department of Stem Cell and Regenerative Biology, 2Department of Molecular and Cellular Biology, Harvard University, Cambridge, Massachusetts 02138, USA; 3Stanley Center for Psychiatric Research, Broad Institute of Massachusetts Institute of Technology and Harvard, Cambridge, Massachusetts 02142, USA; 4Proteomics Platform, Broad Institute of MIT and Harvard, Cambridge, Massachusetts 02142, USA; 5Department of Pathology, Massachusetts General Hospital, Boston, Massachusetts 02114, USA; 6Department of Immunology, 7Department of Internal Medicine, University of Texas Southwestern Medical Center, Dallas, Texas 75390, USA While a mutation in C9ORF72 is the most common genetic contributor to amyotrophic lateral sclerosis (ALS), much remains to be learned concerning the function of the protein normally encoded at this locus. To elaborate further on functions for C9ORF72, we used quantitative mass spectrometry-based proteomics to identify interacting proteins in motor neurons and found that its long isoform complexes with and stabilizes SMCR8, which further enables interaction with WDR41. To study the organismal and cellular functions for this tripartite complex, we generated Smcr8 loss-of-function mutant mice and found that they developed phenotypes also observed in C9orf72 loss-of- function animals, including autoimmunity.
    [Show full text]
  • 4-6 Weeks Old Female C57BL/6 Mice Obtained from Jackson Labs Were Used for Cell Isolation
    Methods Mice: 4-6 weeks old female C57BL/6 mice obtained from Jackson labs were used for cell isolation. Female Foxp3-IRES-GFP reporter mice (1), backcrossed to B6/C57 background for 10 generations, were used for the isolation of naïve CD4 and naïve CD8 cells for the RNAseq experiments. The mice were housed in pathogen-free animal facility in the La Jolla Institute for Allergy and Immunology and were used according to protocols approved by the Institutional Animal Care and use Committee. Preparation of cells: Subsets of thymocytes were isolated by cell sorting as previously described (2), after cell surface staining using CD4 (GK1.5), CD8 (53-6.7), CD3ε (145- 2C11), CD24 (M1/69) (all from Biolegend). DP cells: CD4+CD8 int/hi; CD4 SP cells: CD4CD3 hi, CD24 int/lo; CD8 SP cells: CD8 int/hi CD4 CD3 hi, CD24 int/lo (Fig S2). Peripheral subsets were isolated after pooling spleen and lymph nodes. T cells were enriched by negative isolation using Dynabeads (Dynabeads untouched mouse T cells, 11413D, Invitrogen). After surface staining for CD4 (GK1.5), CD8 (53-6.7), CD62L (MEL-14), CD25 (PC61) and CD44 (IM7), naïve CD4+CD62L hiCD25-CD44lo and naïve CD8+CD62L hiCD25-CD44lo were obtained by sorting (BD FACS Aria). Additionally, for the RNAseq experiments, CD4 and CD8 naïve cells were isolated by sorting T cells from the Foxp3- IRES-GFP mice: CD4+CD62LhiCD25–CD44lo GFP(FOXP3)– and CD8+CD62LhiCD25– CD44lo GFP(FOXP3)– (antibodies were from Biolegend). In some cases, naïve CD4 cells were cultured in vitro under Th1 or Th2 polarizing conditions (3, 4).
    [Show full text]
  • Porcine Interferon Complex and Co-Evolution with Increasing Viral Pressure After Domestication
    viruses Review Porcine Interferon Complex and Co-Evolution with Increasing Viral Pressure after Domestication Jordan Jennings and Yongming Sang * Department of Agricultural and Environmental Sciences, College of Agriculture, Tennessee State University, Nashville, TN 37209, USA; [email protected] * Correspondence: [email protected]; Tel.: +615-963-5183 Received: 17 May 2019; Accepted: 13 June 2019; Published: 15 June 2019 Abstract: Consisting of nearly 60 functional genes, porcine interferon (IFN)-complex represents an evolutionary surge of IFN evolution in domestic ungulate species. To compare with humans and mice, each of these species contains about 20 IFN functional genes, which are better characterized using the conventional IFN-α/β subtypes as examples. Porcine IFN-complex thus represents an optimal model for studying IFN evolution that resulted from increasing viral pressure during domestication and industrialization. We hypothesize and justify that porcine IFN-complex may extend its functionality in antiviral and immunomodulatory activity due to its superior molecular diversity. Furthermore, these unconventional IFNs could even confer some functional and signaling novelty beyond that of the well-studied IFN-α/β subtypes. Investigations into porcine IFN-complex will further our understanding of IFN biology and promote IFN-based therapeutic designs to confront swine viral diseases. Keywords: interferon; immune evolution; antiviral; porcine model 1. Introduction Interferons (IFNs) are a group of cytokines that have evolved in jawed vertebrates and bear a pivotal role in antiviral regulation as well as other biological functions [1–4]. Three types of IFNs, namely Type I, II, and III IFNs, have been defined based on their molecular signatures, interacting receptors, and signaling propensities in immune regulation [3,4].
    [Show full text]
  • 2018 Award Recipients
    AWARD RECIPIENTS 1 CREATING A BRIGHTER FUTURE FOR RHEUMATOLOGY The Rheumatology Research Foundation is committed to improving care for the more than 54 million Americans affected by arthritis or other forms of rheumatic disease. The Foundation’s extensive awards program helps patients by increasing the number of rheumatology health professionals while also funding research advancements that lead to new treatments and cures. For more than two decades, the Foundation has supported high-quality clinical and translational research as well as education and training programs. In the coming fiscal year (July 1, 2018 – June 30, 2019), the Foundation has committed to fund more than $9.4 million to rheumatology research and training. About half of those awards will support efforts to recruit and train the next generation of rheumatology professionals, which decreases patient wait times and increases access to rheumatology care. The remaining funds will be awarded to advance research projects that lead to breakthroughs in treating people with rheumatic diseases. In all, the Foundation has committed more than $161 million to fund more than 3,400 awards since 1985, making it the largest private funding source of rheumatology research and training in the United States. Congratulations to the Foundation’s latest award recipients. Their work is vital to creating a brighter future for the field of rheumatology and for the people impacted by rheumatic disease. BRYCE A. BINSTADT, MD, PHD CHAIR, SCIENTIFIC ADVISORY COUNCIL ASSOCIATE PROFESSOR OF PEDIATRICS AND A DISTINGUISHED UNIVERSITY TEACHING PROFESSOR, DIVISION OF PEDIATRIC RHEUMATOLOGY, UNIVERSITY OF MINNESOTA MEDICAL SCHOOL 2 TABLE OF CONTENTS 04 INNOVATIVE RESEARCH AWARDS 13 CAREER DEVELOPMENT RESEARCH AWARDS 14 CAREER DEVELOPMENT BRIDGE FUNDING AWARD: K BRIDGE 15 CAREER DEVELOPMENT BRIDGE FUNDING AWARD: K SUPPLEMENT 16 CAREER DEVELOPMENT BRIDGE FUNDING AWARD: R BRIDGE 18 INVESTIGATOR AWARD 21 SCIENTIST DEVELOPMENT AWARD 29 TOBÉ AND STEPHEN E.
    [Show full text]
  • IFNK (NM 020124) Human Tagged ORF Clone Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC221055L4 IFNK (NM_020124) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: IFNK (NM_020124) Human Tagged ORF Clone Tag: mGFP Symbol: IFNK Synonyms: IFNT1; INFE1 Vector: pLenti-C-mGFP-P2A-Puro (PS100093) E. coli Selection: Chloramphenicol (34 ug/mL) Cell Selection: Puromycin ORF Nucleotide The ORF insert of this clone is exactly the same as(RC221055). Sequence: Restriction Sites: SgfI-MluI Cloning Scheme: ACCN: NM_020124 ORF Size: 621 bp This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 IFNK (NM_020124) Human Tagged ORF Clone – RC221055L4 OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_020124.1 RefSeq Size: 1164 bp RefSeq ORF: 624 bp Locus ID: 56832 UniProt ID: Q9P0W0 Protein Families: Druggable Genome, Secreted Protein, Transmembrane Protein Pathways: Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway, RIG-I-like receptor signaling pathway MW: 22.1 kDa Gene Summary: This gene encodes a member of the type I interferon family.
    [Show full text]
  • Genome-Scale Activation Screen Identifies a Lncrna Locus Regulating a Gene Neighbourhood Julia Joung1,2,3,4, Jesse M
    LETTER doi:10.1038/nature23451 Genome-scale activation screen identifies a lncRNA locus regulating a gene neighbourhood Julia Joung1,2,3,4, Jesse M. Engreitz2, Silvana Konermann2,3,4†, Omar O. Abudayyeh2,3,4,5, Vanessa K. Verdine2,3, Francois Aguet2, Jonathan S. Gootenberg2,3,4,6, Neville E. Sanjana2,3,4†, Jason B. Wright2,3,4, Charles P. Fulco2,6, Yuen-Yi Tseng2, Charles H. Yoon7, Jesse S. Boehm2, Eric S. Lander2,6,8 & Feng Zhang1,2,3,4 Mammalian genomes contain thousands of loci that transcribe long genes, one of which confers the resistance phenotype. Our screening noncoding RNAs (lncRNAs)1,2, some of which are known to carry and characterization approach provides a CRISPR toolkit with out critical roles in diverse cellular processes through a variety of which to systematically discover the functions of noncoding loci and mechanisms3–8. Although some lncRNA loci encode RNAs that elucidate their diverse roles in gene regulation and cellular function. act non-locally (in trans)5, there is emerging evidence that many We have previously used the Cas9 synergistic activation mediator lncRNA loci act locally (in cis) to regulate the expression of nearby (SAM) to screen for protein-coding genes that confer resistance to genes—for example, through functions of the lncRNA promoter, the BRAF inhibitor vemurafenib in melanoma cells9, making this an transcription, or transcript itself3,6–8. Despite their potentially ideal phenotype for screening lncRNA loci (Supplementary Note 1). important roles, it remains challenging to identify functional We designed a genome-scale single guide RNA (sgRNA) library lncRNA loci and distinguish among these and other mechanisms.
    [Show full text]
  • Regulation of Type I Interferons in Health and Autoimmune Disease
    Regulation of type I interferons in health and autoimmune disease Antonios Psarras Submitted in accordance with the requirements for the degree of Doctor of Philosophy (PhD) University of Leeds Leeds Institute of Rheumatic and Musculoskeletal Medicine September 2018 i Intellectual property and publication statements The candidate confirms that the work submitted is his own, except where work which has formed part of jointly-authored publications has been included. The contribution of the candidate and the other authors to this work has been explicitly indicated below. The candidate confirms that appropriate credit has been given within the thesis where reference has been made to the work of others. Chapter 1 includes data from a jointly-authored publication: Psarras A, Emery P, Vital EM. Type I interferon-mediated autoimmune diseases: pathogenesis, diagnosis and targeted therapy. Rheumatology (Oxford). 2017;56(10):1662-75. Psarras A performed the review of literature, critically appraised scientific evidences of the relevant topics and led the writing of the manuscripts. Emery revised the manuscripts for important intellectual content and final approval of the manuscript. Chapter 3 includes data from two jointly-authored publications: El-Sherbiny YM*, Psarras A*, Yusof MYM, Hensor EMA, Tooze R, Doody G, et al. A novel two-score system for interferon status segregates autoimmune diseases and correlates with clinical features. Sci Rep. 2018;8(1):5793. *joint first author El-Sherbiny YM, Emery P, and Vital EM performed conception and design
    [Show full text]
  • Genetic Regulation of Tmem106b in the Pathogenesis of Frontotemporal Lobar Degeneration
    University of Pennsylvania ScholarlyCommons Publicly Accessible Penn Dissertations 2017 Genetic Regulation Of Tmem106b In The Pathogenesis Of Frontotemporal Lobar Degeneration Michael Gallagher University of Pennsylvania, [email protected] Follow this and additional works at: https://repository.upenn.edu/edissertations Part of the Genetics Commons, Molecular Biology Commons, and the Neuroscience and Neurobiology Commons Recommended Citation Gallagher, Michael, "Genetic Regulation Of Tmem106b In The Pathogenesis Of Frontotemporal Lobar Degeneration" (2017). Publicly Accessible Penn Dissertations. 2294. https://repository.upenn.edu/edissertations/2294 This paper is posted at ScholarlyCommons. https://repository.upenn.edu/edissertations/2294 For more information, please contact [email protected]. Genetic Regulation Of Tmem106b In The Pathogenesis Of Frontotemporal Lobar Degeneration Abstract Neurodegenerative diseases are an emerging global health crisis, with the projected global cost of dementia alone expected to exceed $1 trillion, or >1% of world GDP, by 2018. However, there are no disease-modifying treatments for the major neurodegenerative diseases, such as Alzheimer’s disease, Parkinson’s disease, frontotemporal lobar degeneration (FTLD), and amyotrophic lateral sclerosis. Therefore, there is an urgent need for a better understanding of the pathophysiology underlying these diseases. While genome-wide association studies (GWAS) have identified ~200 genetic ariantsv that are associated with risk of developing neurodegenerative disease, the biological mechanisms underlying these associations are largely unknown. This dissertation investigates the mechanisms by which common genetic variation at TMEM106B, a GWAS-identified risk locus for FTLD, influences disease risk. First, using genetic and clinical data from thirty American and European medical centers, I demonstrate that the TMEM106B locus acts as a genetic modifier of a common Mendelian form of FTLD.
    [Show full text]
  • IFNK Monoclonal Antibody (M01), Expressed in Keratinocytes and the Gene Is Found on Clone 1B7 Chromosome 9, Adjacent to the Type I Interferon Cluster
    IFNK monoclonal antibody (M01), expressed in keratinocytes and the gene is found on clone 1B7 chromosome 9, adjacent to the type I interferon cluster. [provided by RefSeq] Catalog Number: H00056832-M01 References: Regulatory Status: For research use only (RUO) 1. High risk HPV repress constitutive interferon-kappa transcription via E6 to prevent pathogen recognition Product Description: Mouse monoclonal antibody receptor and antiviral gene expression. Reiser J, Hurst J, raised against a partial recombinant IFNK. Voges M, Kraus P, Munch P, Iftner T, Stubenrauch F. J Virol. 2011 Aug 17. [Epub ahead of print] Clone Name: 1B7 2. Epigenetic silencing of interferon-kappa in human papillomavirus type 16-positive cells. Rincon-Orozco B, Immunogen: IFNK (NP_064509, 35 a.a. ~ 129 a.a) Halec G, Rosenberger S, Muschik D, Nindl I, Bachmann partial recombinant protein with GST tag. MW of the A, Ritter TM, Dondog B, Ly R, Bosch FX, Zawatzky R, GST tag alone is 26 KDa. Rosl F. Cancer Res. 2009 Nov 15;69(22):8718-25. Epub 2009 Nov 3. Sequence: VHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQE FLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKE RHLKQIQIGLDQQAEYLNQCL Host: Mouse Reactivity: Human Applications: ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Isotype: IgG2a Kappa Storage Buffer: In 1x PBS, pH 7.4 Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 56832 Gene Symbol: IFNK Gene Alias: RP11-27J8.1 Gene Summary: This gene encodes a member of the type I interferon family.
    [Show full text]
  • Unique Responses of the Avian Macrophage to Different Species of Eimeria Rami A
    Molecular Immunology 44 (2007) 558–566 Unique responses of the avian macrophage to different species of Eimeria Rami A. Dalloul a,1, Travis W. Bliss b,1, Yeong-Ho Hong a, Imed Ben-Chouikha a, Dong Woon Park a, Calvin L. Keeler b, Hyun S. Lillehoj a,∗ a Animal Parasitic Diseases Laboratory, Animal and Natural Resources Institute, USDA Agricultural Research Service, Bldg. 1040, BARC-East, Beltsville, MD 20705, United States b Department of Animal and Food Sciences, College of Agriculture and Natural Resources, University of Delaware, Newark, DE 19716, United States Received 6 January 2006; received in revised form 7 February 2006; accepted 9 February 2006 Available online 24 March 2006 Abstract Coccidiosis is recognized as the major parasitic disease of poultry and is caused by the apicomplexan protozoa Eimeria. Increasing evidence shows the complexity of the host immune response to Eimeria and microarray technology presents a powerful tool for the study of such an intricate biological process. Using an avian macrophage microarray containing 4906 unique gene elements, we identified important host genes whose expression changed following infection of macrophages with sporozoites of Eimeria tenella (ET), Eimeria acervulina (EA), and Eimeria maxima (EM). This approach enabled us to identify a common core of 25 genetic elements whose transcriptional expression is induced or repressed by exposure to Eimeria sporozoites and to identify additional transcription patterns unique to each individual Eimeria species. Besides inducing the expression of IL-1␤, IL-6, and IL-18 and repressing the expression of IL-16, Eimeria treated macrophages were commonly found to induce the expression of the CCL chemokine family members macrophage inflammatory protein (MIP)-1␤ (CCLi1), K203 (CCLi3), and ah221 (CCLi7).
    [Show full text]
  • Complexes of Oligoribonucleotides with D-Mannitol Modulate the Innate Immune Response to Influenza a Virus H1N1
    pharmaceuticals Article Complexes of Oligoribonucleotides with D-Mannitol Modulate the Innate Immune Response to Influenza A Virus H1N1 (A/FM/1/47) In Vivo Nataliia Melnichuk 1 ID , Vladimir Kashuba 1,2, Svitlana Rybalko 3 and Zenoviy Tkachuk 1,* 1 Institute of Molecular Biology and Genetics, National Academy of Sciences of Ukraine, 03680 Kyiv, Ukraine; [email protected] (N.M.); [email protected] (V.K.) 2 Department of Microbiology, Tumor and Cell Biology (MTC), Karolinska Institute, S-17177 Stockholm, Sweden 3 Gromashevsky L. V. Institute of Epidemiology and Infectious Diseases, NAMSU, 5 Amosov str., 03038 Kyiv, Ukraine; [email protected] * Correspondence: [email protected]; Tel.: +38-067-728-0418 Received: 19 June 2018; Accepted: 18 July 2018; Published: 22 July 2018 Abstract: Rapid replication of the influenza A virus and lung tissue damage caused by exaggerated pro-inflammatory host immune responses lead to numerous deaths. Therefore, novel therapeutic agents that have anti-influenza activities and attenuate excessive pro-inflammatory responses that are induced by an influenza virus infection are needed. Oligoribonucleotides-D-mannitol (ORNs-D-M) complexes possess both antiviral and anti-inflammatory activities. The current research was aimed at studying the ORNs-D-M effects on expression of innate immune genes in mice lungs during an influenza virus infection. Expression of genes was determined by RT-qPCR and Western blot assays. In the present studies, we found that the ORNs-D-M reduced the influenza-induced up-expression of Toll-like receptors (TLRs) (tlr3, tlr7, tlr8), nuclear factor NF-kB (nfkbia, nfnb1), cytokines (ifn#, ifnk, ifna2, ifnb1, ifng, il6, il1b, il12a, tnf ), chemokines (ccl3, ccl4, ccl5, cxcl9, cxcl10, cxcl11), interferon-stimulated genes (ISGs) (oas1a, oas2, oas3, mx1), and pro-oxidation (nos2, xdh) genes.
    [Show full text]
  • Poster Abstracts
    CORE Metadata, citation and similar papers at core.ac.uk Provided by Edinburgh Research Explorer Edinburgh Research Explorer Poster 033 Follicle homing antigen presenting cells modulate TH2 bias Citation for published version: Bradford, B, Donaldson, D, Else, K & Mabbott, N 2014, 'Poster 033 Follicle homing antigen presenting cells modulate TH2 bias: Conditional knockout of CXCR5 on CD11c+ cells prevents protective TH2 response following T. muris infection' 9th European-Mucosal-Immunology-Group Meeting, Glasgow, United Kingdom, 1/10/14 - 12/10/14, . DOI: 10.13140/2.1.2667.2644 Digital Object Identifier (DOI): 10.13140/2.1.2667.2644 Link: Link to publication record in Edinburgh Research Explorer Document Version: Early version, also known as pre-print General rights Copyright for the publications made accessible via the Edinburgh Research Explorer is retained by the author(s) and / or other copyright owners and it is a condition of accessing these publications that users recognise and abide by the legal requirements associated with these rights. Take down policy The University of Edinburgh has made every reasonable effort to ensure that Edinburgh Research Explorer content complies with UK legislation. If you believe that the public display of this file breaches copyright please contact [email protected] providing details, and we will remove access to the work immediately and investigate your claim. Download date: 05. Apr. 2019 IMMUNOLOGY ABSTRACTS Poster Abstracts 001 002 Cryptosporidium parvum subverts the host innate immune Faecalibacterium prausnitzii strain HTF-F and its extracellular response through manipulation of CRAMP expression during polymeric matrix attenuate clinical parameters in DSS-induced neonatal infection colitis W.
    [Show full text]