Anti-GJB5 Monoclonal Antibody (DCABH-11735) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

Total Page：16

File Type：pdf, Size：1020Kb

Anti-GJB5 monoclonal antibody (DCABH-11735) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description Gap junctions are conduits that allow the direct cell-to-cell passage of small cytoplasmic molecules, including ions, metabolic intermediates, and second messengers, and thereby mediate intercellular metabolic and electrical communication. Gap junction channels consist of connexin protein subunits, which are encoded by a multigene family. Immunogen A synthetic peptide of human GJB5 is used for rabbit immunization. Isotype IgG Source/Host Rabbit Species Reactivity Human Purification Protein A Conjugate Unconjugated Applications Western Blot (Transfected lysate); ELISA Size 1 ea Buffer In 1x PBS, pH 7.4 Preservative None Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION Gene Name GJB5 gap junction protein, beta 5, 31.1kDa [ Homo sapiens ] Official Symbol GJB5 Synonyms GJB5; gap junction protein, beta 5, 31.1kDa; gap junction protein, beta 5 , gap junction protein, beta 5 (connexin 31.1); gap junction beta-5 protein; connexin 31.1; CX31.1; connexin-31.1; gap junction protein, beta 5 (connexin 31.1); Entrez Gene ID 2709 Protein Refseq NP_005259 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved UniProt ID O95377 Chromosome Location 1p34.3 Pathway Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Gap junction assembly, organism-specific biosystem; Gap junction trafficking, organism-specific biosystem; Gap junction trafficking and regulation, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.

Copy Link

Recommended publications

PRODUCT SPECIFICATION Prest Antigen GJB5
PrEST Antigen GJB5 Product Datasheet PrEST Antigen PRODUCT SPECIFICATION Product Name PrEST Antigen GJB5 Product Number APrEST78107 Gene Description gap junction protein, beta 5, 31.1kDa Alternative Gene CX31.1 Names Corresponding Anti-GJB5 (HPA038146) Antibodies Description Recombinant protein fragment of Human GJB5 Amino Acid Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: KRCHECLAARKAQAMCTGHHPHGTTSSCKQDDLLSGDLIFLGSDSHPPLL PDRPRDHVKK Fusion Tag N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) Expression Host E. coli Purification IMAC purification Predicted MW 24 kDa including tags Usage Suitable as control in WB and preadsorption assays using indicated corresponding antibodies. Purity >80% by SDS-PAGE and Coomassie blue staining Buffer PBS and 1M Urea, pH 7.4. Unit Size 100 µl Concentration Lot dependent Storage Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use. No products from Atlas Antibodies may be resold, modified for resale or used to manufacture commercial products without prior written approval from Atlas Antibodies AB. Warranty: The products supplied by Atlas Antibodies are warranted to meet stated product specifications and to conform to label descriptions when used and stored properly. Unless otherwise stated, this warranty is limited to one year from date of sales for products used, handled and stored according to Atlas Antibodies AB's instructions. Atlas Antibodies AB's sole liability is limited to replacement of the product or refund of the purchase price.
[Show full text]
A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
[Show full text]
Transcriptomic Analysis of Native Versus Cultured Human and Mouse Dorsal Root Ganglia Focused on Pharmacological Targets Short
bioRxiv preprint doi: https://doi.org/10.1101/766865; this version posted September 12, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-ND 4.0 International license. Transcriptomic analysis of native versus cultured human and mouse dorsal root ganglia focused on pharmacological targets Short title: Comparative transcriptomics of acutely dissected versus cultured DRGs Andi Wangzhou1, Lisa A. McIlvried2, Candler Paige1, Paulino Barragan-Iglesias1, Carolyn A. Guzman1, Gregory Dussor1, Pradipta R. Ray1,#, Robert W. Gereau IV2, # and Theodore J. Price1, # 1The University of Texas at Dallas, School of Behavioral and Brain Sciences and Center for Advanced Pain Studies, 800 W Campbell Rd. Richardson, TX, 75080, USA 2Washington University Pain Center and Department of Anesthesiology, Washington University School of Medicine # corresponding authors [email protected], [email protected] and [email protected] Funding: NIH grants T32DA007261 (LM); NS065926 and NS102161 (TJP); NS106953 and NS042595 (RWG). The authors declare no conflicts of interest Author Contributions Conceived of the Project: PRR, RWG IV and TJP Performed Experiments: AW, LAM, CP, PB-I Supervised Experiments: GD, RWG IV, TJP Analyzed Data: AW, LAM, CP, CAG, PRR Supervised Bioinformatics Analysis: PRR Drew Figures: AW, PRR Wrote and Edited Manuscript: AW, LAM, CP, GD, PRR, RWG IV, TJP All authors approved the final version of the manuscript. 1 bioRxiv preprint doi: https://doi.org/10.1101/766865; this version posted September 12, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity.
[Show full text]
Reproductionresearch
REPRODUCTIONRESEARCH Gap junctions are essential for murine primordial follicle assembly immediately before birth Zhen Teng*, Chao Wang*, Yijing Wang, Kun Huang, Xi Xiang, Wanbao Niu, Lizhao Feng, Lihua Zhao, Hao Yan and Hua Zhang State Key Laboratory of Agro-Biotechnology, College of Biological Science, China Agricultural University, Beijing 100193, China Correspondence should be addressed to C Wang; Email: [email protected] *(Z Teng and C Wang contributed equally to this work) Abstract The reserve of primordial follicles determines the reproductive ability of the female mammal over its reproductive life. The primordial follicle is composed of two types of cells: oocytes and surrounding pre-granulosa cells. However, the underlying mechanism regulating primordial follicle assembly is largely undefined. In this study, we found that gap junction communication (GJC) established between the ovarian cells in the perinatal mouse ovary may be involved in the process. First, gap junction structures between the oocyte and surrounding pre-granulosa cells appear at about 19.0 dpc (days post coitum). As many as 12 gap junction-related genes are upregulated at birth, implying that a complex communication may exist between ovarian cells, because specifically silencing the genes of individual gap junction proteins, such as Gja1, Gja4 or both, has no influence on primordial follicle assembly. On the other hand, non-specific blockers of GJC, such as carbenoxolone (CBX) and 18a-glycyrrhetinic acid (AGA), significantly inhibit mouse primordial follicle assembly. We proved that the temporal window for establishment of GJC in the fetal ovary is from 19.5 dpc to 1 dpp (days postpartum). In addition, the expression of ovarian somatic cell (OSC)-specific genes, such as Notch2, Foxl2 and Irx3, was negatively affected by GJC blockers, whereas oocyte-related genes, such as Ybx2, Nobox and Sohlh1, were hardly affected, implying that the establishment of GJC during this period may be more important to OSCs than to oocytes.
[Show full text]
Appendix 2. Significantly Differentially Regulated Genes in Term Compared with Second Trimester Amniotic Fluid Supernatant
Appendix 2. Significantly Differentially Regulated Genes in Term Compared With Second Trimester Amniotic Fluid Supernatant Fold Change in term vs second trimester Amniotic Affymetrix Duplicate Fluid Probe ID probes Symbol Entrez Gene Name 1019.9 217059_at D MUC7 mucin 7, secreted 424.5 211735_x_at D SFTPC surfactant protein C 416.2 206835_at STATH statherin 363.4 214387_x_at D SFTPC surfactant protein C 295.5 205982_x_at D SFTPC surfactant protein C 288.7 1553454_at RPTN repetin solute carrier family 34 (sodium 251.3 204124_at SLC34A2 phosphate), member 2 238.9 206786_at HTN3 histatin 3 161.5 220191_at GKN1 gastrokine 1 152.7 223678_s_at D SFTPA2 surfactant protein A2 130.9 207430_s_at D MSMB microseminoprotein, beta- 99.0 214199_at SFTPD surfactant protein D major histocompatibility complex, class II, 96.5 210982_s_at D HLA-DRA DR alpha 96.5 221133_s_at D CLDN18 claudin 18 94.4 238222_at GKN2 gastrokine 2 93.7 1557961_s_at D LOC100127983 uncharacterized LOC100127983 93.1 229584_at LRRK2 leucine-rich repeat kinase 2 HOXD cluster antisense RNA 1 (non- 88.6 242042_s_at D HOXD-AS1 protein coding) 86.0 205569_at LAMP3 lysosomal-associated membrane protein 3 85.4 232698_at BPIFB2 BPI fold containing family B, member 2 84.4 205979_at SCGB2A1 secretoglobin, family 2A, member 1 84.3 230469_at RTKN2 rhotekin 2 82.2 204130_at HSD11B2 hydroxysteroid (11-beta) dehydrogenase 2 81.9 222242_s_at KLK5 kallikrein-related peptidase 5 77.0 237281_at AKAP14 A kinase (PRKA) anchor protein 14 76.7 1553602_at MUCL1 mucin-like 1 76.3 216359_at D MUC7 mucin 7,
[Show full text]
Ion Channels
UC Davis UC Davis Previously Published Works Title THE CONCISE GUIDE TO PHARMACOLOGY 2019/20: Ion channels. Permalink https://escholarship.org/uc/item/1442g5hg Journal British journal of pharmacology, 176 Suppl 1(S1) ISSN 0007-1188 Authors Alexander, Stephen PH Mathie, Alistair Peters, John A et al. Publication Date 2019-12-01 DOI 10.1111/bph.14749 License https://creativecommons.org/licenses/by/4.0/ 4.0 Peer reviewed eScholarship.org Powered by the California Digital Library University of California S.P.H. Alexander et al. The Concise Guide to PHARMACOLOGY 2019/20: Ion channels. British Journal of Pharmacology (2019) 176, S142–S228 THE CONCISE GUIDE TO PHARMACOLOGY 2019/20: Ion channels Stephen PH Alexander1 , Alistair Mathie2 ,JohnAPeters3 , Emma L Veale2 , Jörg Striessnig4 , Eamonn Kelly5, Jane F Armstrong6 , Elena Faccenda6 ,SimonDHarding6 ,AdamJPawson6 , Joanna L Sharman6 , Christopher Southan6 , Jamie A Davies6 and CGTP Collaborators 1School of Life Sciences, University of Nottingham Medical School, Nottingham, NG7 2UH, UK 2Medway School of Pharmacy, The Universities of Greenwich and Kent at Medway, Anson Building, Central Avenue, Chatham Maritime, Chatham, Kent, ME4 4TB, UK 3Neuroscience Division, Medical Education Institute, Ninewells Hospital and Medical School, University of Dundee, Dundee, DD1 9SY, UK 4Pharmacology and Toxicology, Institute of Pharmacy, University of Innsbruck, A-6020 Innsbruck, Austria 5School of Physiology, Pharmacology and Neuroscience, University of Bristol, Bristol, BS8 1TD, UK 6Centre for Discovery Brain Science, University of Edinburgh, Edinburgh, EH8 9XD, UK Abstract The Concise Guide to PHARMACOLOGY 2019/20 is the fourth in this series of biennial publications. The Concise Guide provides concise overviews of the key properties of nearly 1800 human drug targets with an emphasis on selective pharmacology (where available), plus links to the open access knowledgebase source of drug targets and their ligands (www.guidetopharmacology.org), which provides more detailed views of target and ligand properties.
[Show full text]
Supp Figures & Tables.Pdf
SUPPLEMENTAL FIGURE LEGENDS Supplemental Figure 1. H226 cells express ΔNp63α and functional p53. (A) Western blot of total cell extracts from H226 cells as well as myc tagged p63 isoforms using a pan-p63 antibody and an antibody that specifically recognizes the α-isoforms of p63. (B) FACS analysis of cell cycle profile following staining with propidium iodide. H226 cells were treated with 10uM Nutlin-3, a non-genotoxic activator of p53, for 48 hours. (C) Sulforhodamine B (SRB) assay of cell proliferation following 5 days of knockdown of ΔNp63α and/or p53. (D) Cell cycle profile following 5 days of knockdown of ΔNp63α and/or p53. (E) Apoptotic index of cells following 5 days of knockdown of ΔNp63α. Treatment with 375 µM of the antimetabolite 5-fluorouracil (5FU) for 48 hours serves as a positive control. Cells were stained with annexin V and propidium iodide and analyzed by flow cytometry. Histograms represent the percentage of cells positive for annexin V staining. Supplemental Figure 2. ΔNp63α does not repress 14-3-3σ, GADD45A, NOXA or PUMA in H226 cells. Validation of microarray results by quantitative RT-PCR analysis of additional Class I genes following 12 hours of 10 µM Nutlin-3 treatment, 48 hours of ΔNp63α knockdown, or combination treatment. Supplemental Figure 3. Gene-specific repression by ΔNp63α in diverse cell types. Q-RT-PCR analysis of selected Class I, II, and III target genes following 48 hours of ΔNp63α knockdown in (A) HaCaT cells (immortalized keratinocytes), (B) SCC-13 cells (oral HNSCC), (C) Cal-27 (tongue HNSCC). Supplemental Figure 4.
[Show full text]
PRODUCT SPECIFICATION Anti-GJB5 Product
Anti-GJB5 Product Datasheet Polyclonal Antibody PRODUCT SPECIFICATION Product Name Anti-GJB5 Product Number HPA038146 Gene Description gap junction protein, beta 5, 31.1kDa Clonality Polyclonal Isotype IgG Host Rabbit Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: KRCHECLAARKAQAMCTGHHPHGTTSSCKQDDLLSGDLIFLGSDSHPPLL PDRPRDHVKK Purification Method Affinity purified using the PrEST antigen as affinity ligand Verified Species Human Reactivity Recommended IHC (Immunohistochemistry) Applications - Antibody dilution: 1:200 - 1:500 - Retrieval method: HIER pH6 WB (Western Blot) - Working concentration: 0.04-0.4 µg/ml Characterization Data Available at atlasantibodies.com/products/HPA038146 Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Concentration Lot dependent Storage Store at +4°C for short term storage. Long time storage is recommended at -20°C. Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. For protocols, additional product information, such as images and references, see atlasantibodies.com. Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use. No products from Atlas Antibodies may be resold, modified for resale or used to manufacture commercial products without prior written approval from Atlas Antibodies AB. Warranty: The products supplied by Atlas Antibodies are warranted to meet stated product specifications and to conform to label descriptions when used and stored properly. Unless otherwise stated, this warranty is limited to one year from date of sales for products used, handled and stored according to Atlas Antibodies AB's instructions. Atlas Antibodies AB's sole liability is limited to replacement of the product or refund of the purchase price.
[Show full text]
Pharmacological Target-Focused Transcriptomic Analysis of Native Vs Cultured Human and Mouse Dorsal Root Ganglia Andi Wangzhoua, Lisa A
Research Paper Pharmacological target-focused transcriptomic analysis of native vs cultured human and mouse dorsal root ganglia Andi Wangzhoua, Lisa A. McIlvriedb, Candler Paigea, Paulino Barragan-Iglesiasa, Stephanie Shiersa, Ayesha Ahmada, Carolyn A. Guzmana, Gregory Dussora, Pradipta R. Raya,*, Robert W. Gereau IVb, Theodore J. Pricea Abstract Dorsal root ganglion (DRG) neurons detect sensory inputs and are crucial for pain processing. They are often studied in vitro as dissociated cell cultures with the assumption that this reasonably represents in vivo conditions. However, to the best of our knowledge, no study has directly compared genome-wide transcriptomes of DRG tissue in vivo versus in vitro or between laboratories and culturing protocols. Comparing RNA sequencing-based transcriptomes of native to cultured (4 days in vitro) human or mouse DRG, we found that the overall expression levels of many ion channels and G-protein–coupled receptors specifically expressed in neurons are markedly lower although still expressed in culture. This suggests that most pharmacological targets expressed in vivo are present under the condition of dissociated cell culture, but with changes in expression levels. The reduced relative expression for neuronal genes in human DRG cultures is likely accounted for by increased expression of genes in fibroblast-like and other proliferating cells, consistent with their mitotic status in these cultures. We found that the expression of a subset of genes typically expressed in neurons increased in human and mouse DRG cultures relative to the intact ganglion, including genes associated with nerve injury or inflammation in preclinical models such as BDNF, MMP9, GAL,andATF3. We also found a striking upregulation of a number of inflammation- associated genes in DRG cultures, although many were different between mouse and human.
[Show full text]
1 1 2 3 Cell Type-Specific Transcriptomics of Hypothalamic
1 2 3 4 Cell type-specific transcriptomics of hypothalamic energy-sensing neuron responses to 5 weight-loss 6 7 Fredrick E. Henry1,†, Ken Sugino1,†, Adam Tozer2, Tiago Branco2, Scott M. Sternson1,* 8 9 1Janelia Research Campus, Howard Hughes Medical Institute, 19700 Helix Drive, Ashburn, VA 10 20147, USA. 11 2Division of Neurobiology, Medical Research Council Laboratory of Molecular Biology, 12 Cambridge CB2 0QH, UK 13 14 †Co-first author 15 *Correspondence to: [email protected] 16 Phone: 571-209-4103 17 18 Authors have no competing interests 19 1 20 Abstract 21 Molecular and cellular processes in neurons are critical for sensing and responding to energy 22 deficit states, such as during weight-loss. AGRP neurons are a key hypothalamic population 23 that is activated during energy deficit and increases appetite and weight-gain. Cell type-specific 24 transcriptomics can be used to identify pathways that counteract weight-loss, and here we 25 report high-quality gene expression profiles of AGRP neurons from well-fed and food-deprived 26 young adult mice. For comparison, we also analyzed POMC neurons, an intermingled 27 population that suppresses appetite and body weight. We find that AGRP neurons are 28 considerably more sensitive to energy deficit than POMC neurons. Furthermore, we identify cell 29 type-specific pathways involving endoplasmic reticulum-stress, circadian signaling, ion 30 channels, neuropeptides, and receptors. Combined with methods to validate and manipulate 31 these pathways, this resource greatly expands molecular insight into neuronal regulation of 32 body weight, and may be useful for devising therapeutic strategies for obesity and eating 33 disorders.
[Show full text]
Materials Table I: Antibodies Used for Immunohistochemistry and Immunofluorescence
Materials table I: Antibodies used for immunohistochemistry and immunofluorescence. Antibody Clone Reference Supplier Host SMA pAb ab124964 Abcam rabbit CD3 SP7 RM-9107-S Thermo rabbit Iba1 pAb 019-19741 Wako rabbit F4-80 D2S9R 70076 Cell Signaling rabbit FoxP3 1054C MAB8214 RD systems rabbit CD3 LN10 NCL-L-CD3-565 Novocastra mouse CD68 PG-M1 M0876 Agilent (ehemals Dako) mouse FoxP3 SP97 ab99963 Abcam rabbit Materials Table II: TaqMan probes TaqMan Gene Expression Assay 20X Gene Catalogue Number GAPDH housekeeping Mm99999915_g1 TBP (TATA-box binding protein) housekeeping Mm00446971_m1 KIM-1 (HAVCR1) Kidney injury marker Mm00506686_m1 NGAL (LCN2) Neutrophil gelatinase–associated lipocalin Mm001324470_m1 IL-1 beta interleukin- 1 beta Mm00434228_m1 VIM vimentin Mm01333430_m1 TNC tenascin C Mm00495662_m1 TGF-beta 1 transforming growth factor beta 1 Mm01178820_m1 COL1A1 collagen type I alpha 1 Mm00801666_g1 FN1 fibronectin 1 Mm01256735_m1 Osteopontin = SPP1 secreted phosphoprotein 1 Mm00436767_m1 Supplemental Figure 1: Characterization of two ischemia reperfusion Kidney injury (I/R) models to study regeneration and fibrosis. (A) Kaplan-meier survival curve of males and females subjected to 30 min I/R injury with contralateral nephrectomy (Regeneration model). (B) Schematic representation of the surgical protocol for fibrosis (left) and regeneration (right). (C) Serum creatinine (S-cre) measurements at indicated time points after injury, for fibrosis (blue) and regeneration (red) models. (D) Representative images of H&E staining in Regeneration (top) and Fibrosis (bottom) at indicated time points after injury, compared to sex-matched naive or sham control mice. Pictures at a higher magnification are taken from the cortico-medullary junction areas indicated on the squares from kidney images on the left.
[Show full text]
Distribution of Applied AC EF Strength in a 6−Well Plate During Htcepi Cell Stimulation
Supplementary information Supplementary Figure S1: Distribution of applied AC EF strength in a 6−well plate during hTCEpi cell stimulation. (electric potential: 200 mV; frequency: 20 Hz; wave form). Simulated by finite element method and the color−coding of the scale bar defines the range of values. Supplementary Figure S2: Analysis of the gene and protein array data. (A) represents principal component analysis of the RMA normalized microarray data. (B) represents hierarchical clustering of the protein extracts based on differentially expressed proteins. Supplementary Figure S3: Analysis of the gene array data. (A) represents the clustering heat map of the calibrated samples. (B) represents Volcano plot of the differentially expressed genes. X−axis shows the measured fold changes in the expression whereas the y−axis shows the significance of the change in terms of negative log (base 10) of the p−value. The threshold used to select the differentially expressed genes is 2 for expression change and 0.05 for significance. Supplementary Table S1 Gene array data: upregulated during AC EF stimulation downregulated during AC EF stimulation Gene Symbol Fold Change Gene Symbol Fold Change MMP1 48.87 SAMM50 −2 STC1 47.51 PGAP1 −2 PAPL 45.43 PRODH −2 HBEGF 34.58 CEP97 −2 IL1B 33.7 EML1 −2 TM4SF19 27.27 IRX2 −2 TRIB3 22.69 FETUB −2.01 MMP10 20.93 METAP1D −2.01 TM4SF19−TCTEX1D2 20.69 ZMYM3 −2.01 PTGS2 20.3 TGFBR3 −2.01 SLC2A3 19.33 ZMAT3 −2.01 IL1RL1 19.2 FAM111A −2.01 RAC2 14.32 LRRC1 −2.01 PLAUR 13.05 OR5P3 −2.01 BMP6 12.01 EFNA5 −2.01 ID1 11.59 NCAPG
[Show full text]